Receptor protein-tyrosine kinase

Overview
NameReceptor protein-tyrosine kinase
Smed IDSMED30004546
Length (bp)4250
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor protein-tyrosine kinase (SMED30004546) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor protein-tyrosine kinase (SMED30004546) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor protein-tyrosine kinase (SMED30004546) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor protein-tyrosine kinase (SMED30004546) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004546

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004546SMESG000044602.1 SmedASXL_018314SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30004546SMESG000044602.1 dd_Smed_v4_11608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004546SMESG000044602.1 dd_Smed_v4_11608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004546SMESG000044602.1 dd_Smed_v4_11608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004546SMESG000044602.1 dd_Smed_v4_11608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004546SMESG000044602.1 Contig15543newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004546SMESG000044602.1 Contig15543uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004546SMESG000044602.1 Contig42987newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004546SMESG000044602.1 Contig42987uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004546SMESG000044602.1 Contig29727newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004546SMESG000044602.1 Contig29727uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30004546SMESG000044602.1 dd_Smed_v4_11608_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30004546SMESG000044602.1 Contig12844newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30004546SMESG000044602.1 Contig12844uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30004546SMESG000044602.1 Contig12844newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30004546SMESG000044602.1 Contig12844uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Match: ERBB3 (erb-b2 receptor tyrosine kinase 3 [Source:HGNC Symbol;Acc:HGNC:3431])

HSP 1 Score: 237.654 bits (605), Expect = 6.427e-64
Identity = 189/651 (29.03%), Postives = 292/651 (44.85%), Query Frame = 2
Query:  524 SFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGN--VIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVV--SNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKC--------KNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS---NQMNIYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQC--LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTK 2389
            S  R     + Q  C   L    +     N  +    L + C  V+GN  +++TG  N +LSFL  I E+TG++ +  N   ++ L NL+++RG    +Y + KF++ V+   N    + L+ L L +   IL   + +  N  + +  + I W  I+ + +  EIV   N  +          CH  C     K  CWG  S  CQ +    +  C        +G     QCCH+EC GGC GP +T C  C+HFN+ GACV +CP+ LV+N +      N   K+ +   CV  CP  + ++   CV  C        KNG      + C PC  G+CPK C  +        Q ++   +    NCT   GN+      I G  G+ W K I  +  + L     ++EI G L  N+ S  P +     F NL  I   +  N+  + L I +N ++  LG + LKE+  G + I  N +LCY  SL    +L      +++I +N     C  E + C  LC    GCWGP    C+ CR++  +   +C+++C+     F N E  +  HE +C  CH +C  +    TC G G+D C   C +++   +C   CP    G            N C+ CH++CT+
Sbjct:   15 SLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTG-HNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQ--VY-DGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHM-DTIDWRDIV-RDRDAEIVVKDNGRSCPP-------CHEVC-----KGRCWGPGSEDCQTLT---KTICAPQCNGHCFGP-NPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGL-----KMCEPC-GGLCPKAC--EGTGSGSRFQTVDSSNIDGFVNCTKILGNL---DFLITGLNGDPWHK-IPALDPEKLNVFRTVREITGYL--NIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFS-LLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCS-SGGCWGPGPGQCLSCRNY--SRGGVCVTHCN-----FLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCA-QCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQ 619          

HSP 2 Score: 63.929 bits (154), Expect = 2.352e-9
Identity = 45/206 (21.84%), Postives = 92/206 (44.66%), Query Frame = 2
Query: 3284 ILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPD-ELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            +L  G F  + KG W                     IP+ E + + V IKV+ + S     +     +  I S D    +R++ +   +  +L  Q    GSL++ ++Q+   +    +L W  Q+A G  Y++  G+++ ++   N+ ++SP ++ ++D G++ L    ++     E K  I W   E+ +   ++ +S V +Y 
Sbjct:  714 VLGSGVFGTVHKGVW---------------------IPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYG 898          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Match: ERBB3 (erb-b2 receptor tyrosine kinase 3 [Source:HGNC Symbol;Acc:HGNC:3431])

HSP 1 Score: 239.195 bits (609), Expect = 3.351e-63
Identity = 189/651 (29.03%), Postives = 293/651 (45.01%), Query Frame = 2
Query:  524 SFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGN--VIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVV--SNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGV--KHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKC--------KNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS---NQMNIYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQC--LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTK 2389
            S  R     + Q  C   L    +     N  +    L + C  V+GN  +++TG  N +LSFL  I E+TG++ +  N   ++ L NL+++RG    +Y + KF++ V+   N    + L+ L L +   IL   + +  N  + +  + I W  I+ + +  EIV   N  +          CH  C     K  CWG  S  CQ +   +   C        +G     QCCH+EC GGC GP +T C  C+HFN+ GACV +CP+ LV+N +  +   N   K+ +   CV  CP  + ++   CV  C        KNG      + C PC  G+CPK C  +        Q ++   +    NCT   GN+      I G  G+ W K I  +  + L     ++EI G L  N+ S  P +     F NL  I   +  N+  + L I +N ++  LG + LKE+  G + I  N +LCY  SL    +L      +++I +N     C  E + C  LC    GCWGP    C+ CR++  +   +C+++C+     F N E  +  HE +C  CH +C  +    TC G G+D C   C +++   +C   CP    G            N C+ CH++CT+
Sbjct:   15 SLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTG-HNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQ--VY-DGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHM-DTIDWRDIV-RDRDAEIVVKDNGRSCPP-------CHEVC-----KGRCWGPGSEDCQTLTKTI---CAPQCNGHCFGP-NPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGL-----KMCEPC-GGLCPKAC--EGTGSGSRFQTVDSSNIDGFVNCTKILGNL---DFLITGLNGDPWHK-IPALDPEKLNVFRTVREITGYL--NIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFS-LLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCS-SGGCWGPGPGQCLSCRNY--SRGGVCVTHCN-----FLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCA-QCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQ 619          

HSP 2 Score: 63.1586 bits (152), Expect = 4.615e-9
Identity = 45/206 (21.84%), Postives = 92/206 (44.66%), Query Frame = 2
Query: 3284 ILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPD-ELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            +L  G F  + KG W                     IP+ E + + V IKV+ + S     +     +  I S D    +R++ +   +  +L  Q    GSL++ ++Q+   +    +L W  Q+A G  Y++  G+++ ++   N+ ++SP ++ ++D G++ L    ++     E K  I W   E+ +   ++ +S V +Y 
Sbjct:  714 VLGSGVFGTVHKGVW---------------------IPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYG 898          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:HGNC Symbol;Acc:HGNC:3432])

HSP 1 Score: 231.491 bits (589), Expect = 5.061e-63
Identity = 201/654 (30.73%), Postives = 289/654 (44.19%), Query Frame = 2
Query:  548 SDHQNTCI-SKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGIT-NENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKH--QFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLS--INQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS--NQMNIYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN---ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTKENLFSFKRTCTG 2425
            SD Q+ C  ++     + D    Y +      +NC  V+GN+ IT I  N +LSFL S+ E+TG++ +  N    + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + V  N   L + + IHW  I+       L +V  + SS       G   CH SC        CWG +   CQ +    R  C        YG   +  CCH EC GGC GP +T C  C +FN+ GACV +CP+  V+N        N   K+T+   CV KCP  + +++  CV  C + +   V E     C PC + +CPK C         + Q ++   + +  NCT  +GN+I     I GD  N     I  I  + L     ++EI G L  N+ S  P +     F NL  I          +GLS  I +   +  L  Q LKE+  G + I +N  LCY  ++   ++  +   ++ I +N K   C  E   C+ LC    GCWGP    C+ CR F  +   +CI +C+   G F   EN       C +C  QC       +TC+GPG D CT  C ++K    C EKCP    G  S           C  CH +CT+  + S    C G
Sbjct:   23 SDSQSVCAGTENKLSSLSDLEQQY-RALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLY---EDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNK-FLCYADTIHWQDIVRNPWPSNLTLVSTNGSS-------GCGRCHKSCTGR-----CWGPTENHCQTL---TRTVCAEQCDGRCYGPY-VSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPS-SKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNA----IEAIDPEKLNVFRTVREITGFL--NIQSWPPNMTDFSVFSNLVTIGGRVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSD-GCWGPGPDQCLSCRRF--SRGRICIESCNLYDGEFREFENGSI----CVECDPQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCIGSSIEDCIG 635          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 225.713 bits (574), Expect = 7.619e-62
Identity = 184/609 (30.21%), Postives = 286/609 (46.96%), Query Frame = 2
Query:  644 NCTHVIGNVIITGIT-NENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNI-IGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCH----SSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIK--NRLEKFTFHNTCVDKCPDKYFI-ENEKCVPKCKNGATYAVNET----CLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLY-FRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSN--QMNIYNNGKDGKCEA--RKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCL--SSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGST--------SNICKACHQSCT 2386
            NC  V+GN+ IT +  N +LSFL +I+E+ G++ +  N+VE I L+NL+IIRG    +Y E  ++L V+SN    +  LK L +   Q IL   +   NNP +   ++ I W  I+             SS+F S    D   H      C P      CWG     CQ +   +    + S +C          CCH +C  GC GP  + CL+C+ F ++  C + CP  +++N   +    N   K++F  TCV KCP  Y + ++  CV  C    +Y + E     C  C  G C K C    + +  +   +N   +   +NCT   G++ I  ++  GD     P     +  ++L+ L  +KEI G L I      P  +T L+ F NLEIIR  T  +   +   ++ N  +  LGL+ LKE+ +G V I  N  LCY +++  K +  ++  +  I +N  +  C+A  + C  LC P+ GCWGP    CV CR+  ++    C+  C+   G    +        +C +CH +CL  + NITC G G D C   C +Y    +C + CP    G+ +T         ++C  CH +CT
Sbjct:   57 NCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGN---MYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVES-IQWRDIV-------------SSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQ-QCSGRCRGKSP---SDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRAC-GADSYEMEEDGVRKCKKC-EGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPP----LDPQELDILKTVKEITGFLLIQA---WPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLN--ITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPE-GCWGPEPRDCVSCRN--VSRGRECVDKCNLLEG----EPREFVENSECIQCHPECLPQAMNITCTGRGPDNC-IQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCT 625          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:HGNC Symbol;Acc:HGNC:3432])

HSP 1 Score: 234.187 bits (596), Expect = 8.470e-62
Identity = 197/626 (31.47%), Postives = 281/626 (44.89%), Query Frame = 2
Query:  641 KNCTHVIGNVIITGIT-NENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKH--QFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLS--INQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS--NQMNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN---ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTKENLFSFKRTCTGPGNH 2437
            +NC  V+GN+ IT I  N +LSFL S+ E+TG++ +  N    + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + V  N   L + + IHW  I+       L +V  + SS       G   CH SC    G+  CWG +   CQ +    R  C        YG   +  CCH EC GGC GP +T C  C +FN+ GACV +CP+  V+N        N   K+T+   CV KCP  + +++  CV  C + +   V E     C PC + +CPK C         + Q ++   + +  NCT  +GN+I     I GD  N     I  I  + L     ++EI G L  N+ S  P +     F NL  I          +GLS  I +   +  L  Q LKE+  G + I +N  LCY  ++   ++  +   ++ I +N K   C A    C+ LC    GCWGP    C+ CR F  +   +CI +C+   G F   EN       C +C  QC       +TC+GPG D CT  C ++K    C EKCP    G  S           C  CH +CT+         C GP +H
Sbjct:   28 ENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLY---EDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQN-KFLCYADTIHWQDIVRNPWPSNLTLVSTNGSS-------GCGRCHKSC---TGR--CWGPTENHCQTL---TRTVCAEQCDGRCYGPY-VSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPS-SKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNA----IEAIDPEKLNVFRTVREITGFL--NIQSWPPNMTDFSVFSNLVTIGGRVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSD-GCWGPGPDQCLSCRRF--SRGRICIESCNLYDGEFREFENGSI----CVECDPQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQ--------GCNGPTSH 605          

HSP 2 Score: 112.849 bits (281), Expect = 2.770e-24
Identity = 93/426 (21.83%), Postives = 164/426 (38.50%), Query Frame = 2
Query: 2687 HEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYEDDYISKNS-----SNAESLCLKCHEECMEGCTGSTEYDC-----------KQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
             E++ G+IC+ C P C +  DG +       ++C +C   + G  CV  C  D     NS     ++ +  C  CH  C +GC G T +DC            Q  R  +         F   I G  F ++V  + +                                          +K+  L+             S  AP+  +L  + E +     +L  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S D P  +R++ V +    +L  QL   G L+E++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  + I+D GL++L     +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  518 REFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKC-PDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSI------------------------------------------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSY 880          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 218.779 bits (556), Expect = 2.652e-57
Identity = 272/1169 (23.27%), Postives = 466/1169 (39.86%), Query Frame = 2
Query:  611 NYMKVTANLNKNCTHVIGNVIITGI-TNE----------------------NLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSIL--GKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLS-SKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLV--HNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNG----ATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIII-NTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSN------QMNIYNNGKDGKCEA--RKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQC------TFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDG---TIESCHRCK-----SHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEG--CTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVC----VQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVD---IESDFAPSSTK--LLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRII--------LVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            N ++    + + C  V GN+ IT I  NE                      +++F +++EEI G L ++  +++ IS   L++I G+   ++ +   +L +  N    + +  +++ + +VI   ++ + +NP M Y  + I W  +L     Q +E    H       K +    CH SC        CWG+    CQ +    R  C  S S+CF        +CC   C+GGC G     C+ C  +   G C+E CP + +  H   + + N   ++   N CV +CP +  IEN+ CV  C +G    AT  V E C  C +  CPK C +          +L  + L  LE C    G++II +  + E              Q K LE +  + E    ++ N          L + +NL+II     +N     L+I Q DDL  L L  LK ++ G V I+ N +LCY   +   SI+ S        + I  N     CE   R C K C+ K GCWG     C++C+ ++      C+  C  + G+  N+ +     M+C +C  +C     TC G G   C      T    ++     C   CP  H+   +  N+C+ CH +C       +   CTGP +++G  GC++C Y             ++   ++ C+ SS     G   + ++   P                     N+     + E      C  C   C  CS      +++   CK      +   + C+  C  + ++  +++N  ++C KCH EC +   C       C++CK   ++         C S C  N      +   C    +  ++ K           G +V+ +  + + W+C        +R   KLK +      +   I++   P+ ++  L+P +E Q   +  L  G F  +  G +  K                       V + V IKV    +D +   + L++   +        L+II        L +V  Y  L       G+L  FLK +   +     +L+ +Q+ASG  Y++ + +++ D+ T N+ ++    + I+D GLSK+         IK GK+ I W   E  +   ++  S V  +
Sbjct:   66 NILEDLETMYRGCRRVYGNLEITWIEANEIKKWRESTNSTVDPKNEDSPLKSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDE--VFHD--NALYIHKN----DKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMA--KCHESCNDK-----CWGSGDNDCQRV---YRSVCPKSCSQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRE-CEKCRSSSCPKICTVDG--------HLTNETLKNLEGCEQIDGHLIIEHAFTYE--------------QLKVLETVKIVSEYITIVQQN-------FYDLKFLKNLQIIEGRKLHNVRW-ALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCN-KRGCWGKEPEDCLECKTWKSV--GTCVEKCDTK-GFLRNQTS-----MKCERCSPECE----TCNGLGELDCLTCRHKTLYNSDFGNRMECVHDCPVSHF--PTQKNVCEKCHPTC-------YDNGCTGPDSNLGYGGCKQCKYA-----------VKYENDTIFCLQSS-----GMNNVCVENDLP---------------------NYYISTYDTEGVIETHCEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFMVPDTNN--TVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDIAQ---CVSECPKNLPFSNPANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRC--------QRIGKKLKIAEMVDMPELTPIDASVRPNMSRICLIPSSELQTKLDKKLGAGAFGTVFAGIYYPKRAKN-------------------VKIPVAIKVFQ--TDQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPL-------GNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADSITIKSGKVAIKWLAIEIFSKHCYTHASDVWAF 1085          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 218.394 bits (555), Expect = 2.840e-57
Identity = 264/1119 (23.59%), Postives = 453/1119 (40.48%), Query Frame = 2
Query:  692 ENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSIL--GKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLS-SKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLV--HNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNG----ATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIII-NTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSN------QMNIYNNGKDGKCEA--RKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYN-DY-----CTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDG---TIESCHRCK-----SHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEG--CTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVC----VQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVD---IESDFAPSSTK--LLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRII--------LVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            ++++F +++EEI G L ++  +++ IS   L++I G+   ++ +   +L +  N    + +  +++ + +VI   ++ + +NP M Y  + I W  +L     Q +E    H       K +    CH SC        CWG+    CQ +    R  C  S S+CF        +CC   C+GGC G     C+ C  +   G C+E CP + +  H   + + N   ++   N CV +CP +  IEN+ CV  C +G    AT  V E C  C +  CPK C +          +L  + L  LE C    G++II +  + E              Q K LE +  + E    ++ N          L + +NL+II     +N     L+I Q DDL  L L  LK ++ G V I+ N +LCY   +   SI+ S        + I  N     CE   R C K C+ K GCWG     C++C+ ++      C+  C  + G+  N+ +     M+C +C  +C     TC G G   C        YN D+     C   CP  H+   +  N+C+ CH +C       +   CTGP +++G  GC++C Y             ++   ++ C+ SS     G   + ++   P                     N+     + E      C  C   C  CS      +++   CK      +   + C+  C  + ++  +++N  ++C KCH EC +   C       C++CK   ++         C S C  N      +   C    +  ++ K           G +V+ +  + + W+C        +R   KLK +      +   I++   P+ ++  L+P +E Q   +  L  G F  +  G +  K                       V + V IKV    +D +   + L++   +        L+II        L +V  Y  L       G+L  FLK +   +     +L+ +Q+ASG  Y++ + +++ D+ T N+ ++    + I+D GLSK+         IK GK+ I W   E  +   ++  S V  +
Sbjct:   43 KSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDE--VFHDN--ALYIHKN----DKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMA--KCHESCNDK-----CWGSGDNDCQRV---YRSVCPKSCSQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRE-CEKCRSSSCPKICTVDG--------HLTNETLKNLEGCEQIDGHLIIEHAFTYE--------------QLKVLETVKIVSEYITIVQQN-------FYDLKFLKNLQIIEGRKLHNVRW-ALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCN-KRGCWGKEPEDCLECKTWKSV--GTCVEKCDTK-GFLRNQTS-----MKCERCSPECE----TCNGLGELDCLTCRHKTLYNSDFGNRMECVHDCPVSHF--PTQKNVCEKCHPTC-------YDNGCTGPDSNLGYGGCKQCKYA-----------VKYENDTIFCLQSS-----GMNNVCVENDLP---------------------NYYISTYDTEGVIETHCEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFMVPDTNN--TVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDIAQ---CVSECPKNLPFSNPANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRC--------QRIGKKLKIAEMVDMPELTPIDASVRPNMSRICLIPSSELQTKLDKKLGAGAFGTVFAGIYYPKRAKN-------------------VKIPVAIKVFQ--TDQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPL-------GNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADSITIKSGKVAIKWLAIEIFSKHCYTHASDVWAF 1012          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 218.009 bits (554), Expect = 4.167e-57
Identity = 274/1169 (23.44%), Postives = 467/1169 (39.95%), Query Frame = 2
Query:  611 NYMKVTANLNKNCTHVIGNVIITGI-TNE----------------------NLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSIL--GKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLS-SKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLV--HNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNG----ATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIII-NTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSN------QMNIYNNGKDGKCEA--RKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYN-DY-----CTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDG---TIESCHRCK-----SHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEG--CTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVC----VQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVD---IESDFAPSSTK--LLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRII--------LVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            N ++    + + C  V GN+ IT I  NE                      +++F +++EEI G L ++  +++ IS   L++I G+   ++ +   +L +  N    + +  +++ + +VI   ++ + +NP M Y  + I W  +L     Q +E    H       K +    CH SC        CWG+    CQ +    R  C  S S+CF        +CC   C+GGC G     C+ C  +   G C+E CP + +  H   + + N   ++   N CV +CP +  IEN+ CV  C +G    AT  V E C  C +  CPK C +          +L  + L  LE C    G++II +  + E              Q K LE +  + E    ++ N          L + +NL+II     +N     L+I Q DDL  L L  LK ++ G V I+ N +LCY   +   SI+ S        + I  N     CE   R C K C+ K GCWG     C++C+ ++      C+  C  + G+  N+ +     M+C +C  +C     TC G G   C        YN D+     C   CP  H+   +  N+C+ CH +C       +   CTGP +++G  GC++C Y             ++   ++ C+ SS     G   + ++   P                     N+     + E      C  C   C  CS      +++   CK      +   + C+  C  + ++  +++N  ++C KCH EC +   C       C++CK   ++         C S C  N      +   C    +  ++ K           G +V+ +  + + W+C        +R   KLK +      +   I++   P+ ++  L+P +E Q   +  L  G F  +  G +  K                       V + V IKV    +D +   + L++   +        L+II        L +V  Y  L       G+L  FLK +   +     +L+ +Q+ASG  Y++ + +++ D+ T N+ ++    + I+D GLSK+         IK GK+ I W   E  +   ++  S V  +
Sbjct:   59 NILEDLETMYRGCRRVYGNLEITWIEANEIKKWRESTNSTVDPKNEDSPLKSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDE--VFHDN--ALYIHKN----DKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMA--KCHESCNDK-----CWGSGDNDCQRV---YRSVCPKSCSQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRE-CEKCRSSSCPKICTVDG--------HLTNETLKNLEGCEQIDGHLIIEHAFTYE--------------QLKVLETVKIVSEYITIVQQN-------FYDLKFLKNLQIIEGRKLHNVRW-ALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCN-KRGCWGKEPEDCLECKTWKSV--GTCVEKCDTK-GFLRNQTS-----MKCERCSPECE----TCNGLGELDCLTCRHKTLYNSDFGNRMECVHDCPVSHF--PTQKNVCEKCHPTC-------YDNGCTGPDSNLGYGGCKQCKYA-----------VKYENDTIFCLQSS-----GMNNVCVENDLP---------------------NYYISTYDTEGVIETHCEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFMVPDTNN--TVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDIAQ---CVSECPKNLPFSNPANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRC--------QRIGKKLKIAEMVDMPELTPIDASVRPNMSRICLIPSSELQTKLDKKLGAGAFGTVFAGIYYPKRAKN-------------------VKIPVAIKVFQ--TDQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPL-------GNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADSITIKSGKVAIKWLAIEIFSKHCYTHASDVWAF 1078          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 218.009 bits (554), Expect = 4.860e-57
Identity = 274/1169 (23.44%), Postives = 467/1169 (39.95%), Query Frame = 2
Query:  611 NYMKVTANLNKNCTHVIGNVIITGI-TNE----------------------NLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSIL--GKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLS-SKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLV--HNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNG----ATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIII-NTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSN------QMNIYNNGKDGKCEA--RKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYN-DY-----CTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDG---TIESCHRCK-----SHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEG--CTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVC----VQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVD---IESDFAPSSTK--LLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRII--------LVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            N ++    + + C  V GN+ IT I  NE                      +++F +++EEI G L ++  +++ IS   L++I G+   ++ +   +L +  N    + +  +++ + +VI   ++ + +NP M Y  + I W  +L     Q +E    H       K +    CH SC        CWG+    CQ +    R  C  S S+CF        +CC   C+GGC G     C+ C  +   G C+E CP + +  H   + + N   ++   N CV +CP +  IEN+ CV  C +G    AT  V E C  C +  CPK C +          +L  + L  LE C    G++II +  + E              Q K LE +  + E    ++ N          L + +NL+II     +N     L+I Q DDL  L L  LK ++ G V I+ N +LCY   +   SI+ S        + I  N     CE   R C K C+ K GCWG     C++C+ ++      C+  C  + G+  N+ +     M+C +C  +C     TC G G   C        YN D+     C   CP  H+   +  N+C+ CH +C       +   CTGP +++G  GC++C Y             ++   ++ C+ SS     G   + ++   P                     N+     + E      C  C   C  CS      +++   CK      +   + C+  C  + ++  +++N  ++C KCH EC +   C       C++CK   ++         C S C  N      +   C    +  ++ K           G +V+ +  + + W+C        +R   KLK +      +   I++   P+ ++  L+P +E Q   +  L  G F  +  G +  K                       V + V IKV    +D +   + L++   +        L+II        L +V  Y  L       G+L  FLK +   +     +L+ +Q+ASG  Y++ + +++ D+ T N+ ++    + I+D GLSK+         IK GK+ I W   E  +   ++  S V  +
Sbjct:   54 NILEDLETMYRGCRRVYGNLEITWIEANEIKKWRESTNSTVDPKNEDSPLKSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDE--VFHDN--ALYIHKN----DKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMA--KCHESCNDK-----CWGSGDNDCQRV---YRSVCPKSCSQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRE-CEKCRSSSCPKICTVDG--------HLTNETLKNLEGCEQIDGHLIIEHAFTYE--------------QLKVLETVKIVSEYITIVQQN-------FYDLKFLKNLQIIEGRKLHNVRW-ALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCN-KRGCWGKEPEDCLECKTWKSV--GTCVEKCDTK-GFLRNQTS-----MKCERCSPECE----TCNGLGELDCLTCRHKTLYNSDFGNRMECVHDCPVSHF--PTQKNVCEKCHPTC-------YDNGCTGPDSNLGYGGCKQCKYA-----------VKYENDTIFCLQSS-----GMNNVCVENDLP---------------------NYYISTYDTEGVIETHCEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFMVPDTNN--TVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDIAQ---CVSECPKNLPFSNPANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRC--------QRIGKKLKIAEMVDMPELTPIDASVRPNMSRICLIPSSELQTKLDKKLGAGAFGTVFAGIYYPKRAKN-------------------VKIPVAIKVFQ--TDQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPL-------GNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADSITIKSGKVAIKWLAIEIFSKHCYTHASDVWAF 1073          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 62.003 bits (149), Expect = 4.063e-9
Identity = 113/455 (24.84%), Postives = 179/455 (39.34%), Query Frame = 2
Query:  716 IEEITGFLFLFSN----SVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGK------------------RFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLN-TQCLICKHFNNQGACVEKCPRKLV---------------HNGVKHIKNRLEKFTFHNTCVDKCPDKYFI------ENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDL--VFLGLQELKEVRNGIVEIVNNPKLCY 1942
            + EITG L +F       +  I   NL++I G +   +    ++L++  N   E     + L K  VI    + + +N  + Y K  I W  ++       +V+  N++ +   E G +    +C+   G+                  + CW N++ Q     D +  T ++   C   G+      CH++CVGGC    + T C  CK+  ++G C+EKC   L                 N V   K    K T    C DKCPD Y I      E  KCV KC+                 VC           N+ I    +    RL  C +  GN+   T+ I G   +G    +  I         N+  I G L +   S  P++ +L  FRNL  I A++   ++L  +++ +N +L  +F    +L   R G V I NN  LC+
Sbjct:  223 LREITGTLLVFETEGLVDLRKI-FPNLRVIGGRSLIQH----YALIIYRNPDLE-----IGLDKLSVIRNGGVRIIDNRKLCYTKT-IDWKHLITSSINDVVVD--NAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQSCWSNTTCQKSCAYDRLLPTKEIGPGCDANGDR-----CHDQCVGGCERVNDATACHACKNVYHKGKCIEKCDAHLYLLLQRRCVTREQCLQLNPVLSNKTVPIKAT-AGLCSDKCPDGYQINPDDHRECRKCVGKCEI----------------VCEI---------NHVIDTFPKAQAIRL--CNIIDGNL---TIEIRGKQDSGMASELKDI-------FANIHTITGYLLVRQSS--PFI-SLNMFRNLRRIEAKSL-FRNLYAITVFENPNLKKLFDSTTDLTLDR-GTVSIANNKMLCF 616          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Match: Egfr (gene:FBgn0003731 transcript:FBtr0071654)

HSP 1 Score: 345.125 bits (884), Expect = 1.384e-97
Identity = 301/1123 (26.80%), Postives = 495/1123 (44.08%), Query Frame = 2
Query:  644 NCTHVIGNVIITGITNENL--SFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIY--REVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEG--DIGNGW---PKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIY--NNGKDGKCE--ARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTI--ESCHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKI--------YLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQ-ELKPIQNSWYXXXXXXXXXXXXXXXXXWKCIC-------MSLNKRKRYDLKLKFSNGFSTVDIESDFAPSST-----KLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            NCT+V GN+ +T + NENL  SFL++I E+TG++ +    V+ +    L+IIRG   +     E K++L V  +      +  L +P  + +L   +  +NN  + + +  I W+ I+         + + + +FT+ E     CH SC        CWG     CQ  +           +C  YG  K  +CCH  C GGC GP    C+ CK+F ++G C E+CP    +N   ++   N   K+ +  TCV +CP     +N  CV  C         E C+PC NG CPK C    V+   NI            NCTV  GNI I   +  G  D+   +   P+ I  +  + LE  + +KEI G L  N+    P  + L YFRNLE I            L+I ++  L  L ++ LK++ +G V I +N  LCY  ++   +I    +  ++   N +   CE     CS  C+ + GCWG     C+ C++F       CI++C    GY  N   ++     C  CH +C     TC G GAD C   CV+ +   +C  +CP++ Y D     +C+ CH +C           CTGP + IG+  C  CN   L    ++  + R       C+   + C DGYF    ++  P+                       ++ +       A+C  CHPLC  C++     + C +C  ++R ++C   C  D Y  +        C +CH EC  GCTG    DCK C+  K+        Y+NS  T F C S C    R  VN +   + P     P ++S   A +  +++ ++   ++   IC       +   K+K     +K +   S  +      PS+      KL  + + +     +L +G F  + KG W  +  N                    V + V IK L + +    +++FL++  I+ S +    L+++ V + +   L  QL   G L+++++ N   +   ++L W+ Q+A G  Y++ + +++ D+   N+ +++P  + I+D GL+KL ++ +   K   GK+ I W   E   ++ F+SKS V  + 
Sbjct:  128 NCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYS-----KMYTLEIPDLRDVLNGQVGFHNNYNLCHMRT-IQWSEIVSNG-----TDAYYNYDFTAPERECPKCHESCT-----HGCWGEGPKNCQKFSKLTCSPQCAGGRC--YGP-KPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGE-CVPC-NGPCPKTCPGVTVLHAGNID--------SFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYI-PLDPERLEVFSTVKEITGYL--NIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKS-SLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCN-EDGCWGAGTDQCLTCKNFNFN--GTCIADC----GYISNA--YKFDNRTCKICHPECR----TCNGAGADHCQ-ECVHVRDGQHCVSECPKNKYND---RGVCRECHATCDG---------CTGPKDTIGIGACTTCN---LAIINNDATVKR-------CLLKDDKCPDGYF---WEYVHPQ-----------------------EQGSLKPLAGRAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQRE----CFQCHPEC-NGCTGPGADDCKSCRNFKLFDANETGPYVNS--TMFNCTSKCPLEMR-HVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEPLRPSNIGANLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVPEGEN--------------------VKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSSQMMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFG 1127          

HSP 2 Score: 51.2174 bits (121), Expect = 9.087e-6
Identity = 74/271 (27.31%), Postives = 106/271 (39.11%), Query Frame = 2
Query: 1544 NIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEIN-VGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVF--------LGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPK--YGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCP 2323
            N ++  R +  R  NCT   GN+ +            W  N    +  DL  L N++E+ G + I+ V  K       + F  L+IIR  T     L  LS+ +    +F        L + +L++V NG V   NN  LC+  ++    I+ SN  + Y N  D     R+C K CH    +GCWG     C      Q   K  C   C+   G  Y  +  +        CH  C      C GP    C   C N+     C E+CP
Sbjct:  114 NKEHHYRNLRDRYTNCTYVDGNLELT-----------WLPN----ENLDLSFLDNIREVTGYILISHVDVKK------VVFPKLQIIRGRT-----LFSLSVEEEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCHMRTIQWSEIV-SNGTDAYYN-YDFTAPERECPK-CHESCTHGCWGEGPKNC------QKFSKLTCSPQCAG--GRCYGPKPREC-------CHLFCAGG---CTGPTQKDC-IACKNFFDEGVCKEECP 336          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Match: Egfr (gene:FBgn0003731 transcript:FBtr0071653)

HSP 1 Score: 343.969 bits (881), Expect = 1.709e-97
Identity = 301/1123 (26.80%), Postives = 495/1123 (44.08%), Query Frame = 2
Query:  644 NCTHVIGNVIITGITNENL--SFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIY--REVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEG--DIGNGW---PKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIY--NNGKDGKCE--ARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTI--ESCHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKI--------YLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQ-ELKPIQNSWYXXXXXXXXXXXXXXXXXWKCIC-------MSLNKRKRYDLKLKFSNGFSTVDIESDFAPSST-----KLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            NCT+V GN+ +T + NENL  SFL++I E+TG++ +    V+ +    L+IIRG   +     E K++L V  +      +  L +P  + +L   +  +NN  + + +  I W+ I+         + + + +FT+ E     CH SC        CWG     CQ  +           +C  YG  K  +CCH  C GGC GP    C+ CK+F ++G C E+CP    +N   ++   N   K+ +  TCV +CP     +N  CV  C         E C+PC NG CPK C    V+   NI            NCTV  GNI I   +  G  D+   +   P+ I  +  + LE  + +KEI G L  N+    P  + L YFRNLE I            L+I ++  L  L ++ LK++ +G V I +N  LCY  ++   +I    +  ++   N +   CE     CS  C+ + GCWG     C+ C++F       CI++C    GY  N   ++     C  CH +C     TC G GAD C   CV+ +   +C  +CP++ Y D     +C+ CH +C           CTGP + IG+  C  CN   L    ++  + R       C+   + C DGYF    ++  P+                       ++ +       A+C  CHPLC  C++     + C +C  ++R ++C   C  D Y  +        C +CH EC  GCTG    DCK C+  K+        Y+NS  T F C S C    R  VN +   + P     P ++S   A +  +++ ++   ++   IC       +   K+K     +K +   S  +      PS+      KL  + + +     +L +G F  + KG W  +  N                    V + V IK L + +    +++FL++  I+ S +    L+++ V + +   L  QL   G L+++++ N   +   ++L W+ Q+A G  Y++ + +++ D+   N+ +++P  + I+D GL+KL ++ +   K   GK+ I W   E   ++ F+SKS V  + 
Sbjct:   79 NCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYS-----KMYTLEIPDLRDVLNGQVGFHNNYNLCHMRT-IQWSEIVSNG-----TDAYYNYDFTAPERECPKCHESCT-----HGCWGEGPKNCQKFSKLTCSPQCAGGRC--YGP-KPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGE-CVPC-NGPCPKTCPGVTVLHAGNID--------SFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYI-PLDPERLEVFSTVKEITGYL--NIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKS-SLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCN-EDGCWGAGTDQCLTCKNFNF--NGTCIADC----GYISNA--YKFDNRTCKICHPECR----TCNGAGADHCQ-ECVHVRDGQHCVSECPKNKYND---RGVCRECHATCDG---------CTGPKDTIGIGACTTCN---LAIINNDATVKR-------CLLKDDKCPDGYF---WEYVHPQ-----------------------EQGSLKPLAGRAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQRE----CFQCHPEC-NGCTGPGADDCKSCRNFKLFDANETGPYVNS--TMFNCTSKCPLEMR-HVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEPLRPSNIGANLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVPEGEN--------------------VKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSSQMMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFG 1078          

HSP 2 Score: 51.2174 bits (121), Expect = 8.661e-6
Identity = 74/271 (27.31%), Postives = 106/271 (39.11%), Query Frame = 2
Query: 1544 NIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEIN-VGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVF--------LGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPK--YGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCP 2323
            N ++  R +  R  NCT   GN+ +            W  N    +  DL  L N++E+ G + I+ V  K       + F  L+IIR  T     L  LS+ +    +F        L + +L++V NG V   NN  LC+  ++    I+ SN  + Y N  D     R+C K CH    +GCWG     C      Q   K  C   C+   G  Y  +  +        CH  C      C GP    C   C N+     C E+CP
Sbjct:   65 NKEHHYRNLRDRYTNCTYVDGNLELT-----------WLPN----ENLDLSFLDNIREVTGYILISHVDVKK------VVFPKLQIIRGRT-----LFSLSVEEEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCHMRTIQWSEIV-SNGTDAYYN-YDFTAPERECPK-CHESCTHGCWGEGPKNC------QKFSKLTCSPQCAG--GRCYGPKPREC-------CHLFCAGG---CTGPTQKDC-IACKNFFDEGVCKEECP 287          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Match: CG10702 (gene:FBgn0032752 transcript:FBtr0303241)

HSP 1 Score: 75.485 bits (184), Expect = 3.033e-13
Identity = 112/504 (22.22%), Postives = 208/504 (41.27%), Query Frame = 2
Query:  536 ADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNE---NLSFLNS--IEEITGFLFLFSNSVESISL----KNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCY--GPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPC-PNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTG-LSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLC------YTDSLTNKSILHSNQMN 1990
            A+S  +H+ T I      DIR++  N      +L  NCT V G V+IT IT E   N S  +   + EIT F+ +F++    +++     +L +IRG         +  L     +   + L+ L+ PK   I +  + + + P +      ++W+        L +    N+    +K      C      H     CW N   Q  I  +       +++             CHEEC+GGC         C +C+  ++ G CV+ CP+       K++    ++      CV K    Y I   +CV  C +G        C+ C P+  C   C  +   + + +   N      L  C +++G+++I   +I   +           + +  +  T+++E+ G +++   S+   L++L + RNLE +  +   N+H +  L  N+    ++   ++L+ +  G+    NN KLC      + +++T+   L S Q N
Sbjct:   22 AESKKEHECTSI------DIRNECKN-----MHLLDNCTVVTGYVMITLITIEQRCNFSEYSYPLLTEITEFM-IFTDVRGLVNITEMFPHLTVIRGR--------RLFLNYALGVTNMHELEQLVFPKLVAIQRGQVYIGSCPKLCSI-GRVNWD-------LLTLTRGENNIIMVNKNCSTPVCSGCSSSH-----CWSNHYCQRSINENVANPKANINA-------------CHEECLGGCKNNSSSPADCSVCRGLSDDGVCVKSCPKD------KYVMENYQRCYTKAECVLK--HGYVISGSQCVAFCPSGYKTNNRSECVLCSPDEACISFCTPEWPGKAFTV--YNLADAENLRGCQIFNGSLVI---TIRNKVN----------ETQLYQSFTSMREVRGHVKVYRSSQ---LRSLQFLRNLERVHGDPLENRHYSFILYDNKELSELWTPSRQLEFMEGGMFMHRNN-KLCNRRMREFQNAVTHDRALDSLQTN 452          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Match: CG10702 (gene:FBgn0032752 transcript:FBtr0081176)

HSP 1 Score: 75.485 bits (184), Expect = 3.033e-13
Identity = 112/504 (22.22%), Postives = 208/504 (41.27%), Query Frame = 2
Query:  536 ADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNE---NLSFLNS--IEEITGFLFLFSNSVESISL----KNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCY--GPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPC-PNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTG-LSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLC------YTDSLTNKSILHSNQMN 1990
            A+S  +H+ T I      DIR++  N      +L  NCT V G V+IT IT E   N S  +   + EIT F+ +F++    +++     +L +IRG         +  L     +   + L+ L+ PK   I +  + + + P +      ++W+        L +    N+    +K      C      H     CW N   Q  I  +       +++             CHEEC+GGC         C +C+  ++ G CV+ CP+       K++    ++      CV K    Y I   +CV  C +G        C+ C P+  C   C  +   + + +   N      L  C +++G+++I   +I   +           + +  +  T+++E+ G +++   S+   L++L + RNLE +  +   N+H +  L  N+    ++   ++L+ +  G+    NN KLC      + +++T+   L S Q N
Sbjct:   22 AESKKEHECTSI------DIRNECKN-----MHLLDNCTVVTGYVMITLITIEQRCNFSEYSYPLLTEITEFM-IFTDVRGLVNITEMFPHLTVIRGR--------RLFLNYALGVTNMHELEQLVFPKLVAIQRGQVYIGSCPKLCSI-GRVNWD-------LLTLTRGENNIIMVNKNCSTPVCSGCSSSH-----CWSNHYCQRSINENVANPKANINA-------------CHEECLGGCKNNSSSPADCSVCRGLSDDGVCVKSCPKD------KYVMENYQRCYTKAECVLK--HGYVISGSQCVAFCPSGYKTNNRSECVLCSPDEACISFCTPEWPGKAFTV--YNLADAENLRGCQIFNGSLVI---TIRNKVN----------ETQLYQSFTSMREVRGHVKVYRSSQ---LRSLQFLRNLERVHGDPLENRHYSFILYDNKELSELWTPSRQLEFMEGGMFMHRNN-KLCNRRMREFQNAVTHDRALDSLQTN 452          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Match: CG10702 (gene:FBgn0032752 transcript:FBtr0081174)

HSP 1 Score: 75.485 bits (184), Expect = 3.033e-13
Identity = 112/504 (22.22%), Postives = 208/504 (41.27%), Query Frame = 2
Query:  536 ADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNE---NLSFLNS--IEEITGFLFLFSNSVESISL----KNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCY--GPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPC-PNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTG-LSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLC------YTDSLTNKSILHSNQMN 1990
            A+S  +H+ T I      DIR++  N      +L  NCT V G V+IT IT E   N S  +   + EIT F+ +F++    +++     +L +IRG         +  L     +   + L+ L+ PK   I +  + + + P +      ++W+        L +    N+    +K      C      H     CW N   Q  I  +       +++             CHEEC+GGC         C +C+  ++ G CV+ CP+       K++    ++      CV K    Y I   +CV  C +G        C+ C P+  C   C  +   + + +   N      L  C +++G+++I   +I   +           + +  +  T+++E+ G +++   S+   L++L + RNLE +  +   N+H +  L  N+    ++   ++L+ +  G+    NN KLC      + +++T+   L S Q N
Sbjct:   22 AESKKEHECTSI------DIRNECKN-----MHLLDNCTVVTGYVMITLITIEQRCNFSEYSYPLLTEITEFM-IFTDVRGLVNITEMFPHLTVIRGR--------RLFLNYALGVTNMHELEQLVFPKLVAIQRGQVYIGSCPKLCSI-GRVNWD-------LLTLTRGENNIIMVNKNCSTPVCSGCSSSH-----CWSNHYCQRSINENVANPKANINA-------------CHEECLGGCKNNSSSPADCSVCRGLSDDGVCVKSCPKD------KYVMENYQRCYTKAECVLK--HGYVISGSQCVAFCPSGYKTNNRSECVLCSPDEACISFCTPEWPGKAFTV--YNLADAENLRGCQIFNGSLVI---TIRNKVN----------ETQLYQSFTSMREVRGHVKVYRSSQ---LRSLQFLRNLERVHGDPLENRHYSFILYDNKELSELWTPSRQLEFMEGGMFMHRNN-KLCNRRMREFQNAVTHDRALDSLQTN 452          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Match: egfra (epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) [Source:ZFIN;Acc:ZDB-GENE-030918-1])

HSP 1 Score: 246.514 bits (628), Expect = 4.512e-69
Identity = 196/617 (31.77%), Postives = 299/617 (48.46%), Query Frame = 2
Query:  611 NYMKVTANLNKNCTHVIGNVIITGITNE-NLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIG--ENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKH--IKNRLEKFTFHNTCVDKCPDKYFI-ENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNI--YNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN--ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGST--------SNICKACHQSCTK 2389
            ++ +V   + +NCT V+ N+ IT IT + +LSFL SI+E+ G++ +  N+V  I L+NL+IIRG + +   E KF+L V+ N     E  +K L L     IL+  +  +N    L     I W  IL       IV  HN S    K  G       C P      CWG    +CQ +   +    + S +C   G   I+ CC+E C  GC GP  T CL CK F ++G C + CPR ++++   H    N   K++F  TC+  CP  Y + ++  CV  C  G TY V+E     C  C  G+CPK C    +    N+  +N   +   ENCT   GN+ I + +  GD       N  G+    L  L+ +KEI G L I +  ++  +++L  F NLE+IR  T      +  ++ +   +  LG++ L+E+ +G V IV N  LCY+     K +  S Q ++    N     C  +   C+++C    GCWGP    C  C H+  +    C+++C+   G     E ++T    C +C  +CL  N   TC GPG D+CT  C NYK   +C  +CPQ   G+  T        +++C+ CH++CT+
Sbjct:   43 DHYQVLLRMYRNCTVVLENLEITHITEKYDLSFLKSIQEVGGYVLIAVNTVSKIPLENLRIIRGHSLY---EDKFALAVLVNYNNSIEQGVKELPLTSLTEILKGGVR-FNMNNHLCNVGTIEWADILNMKSLPTIVS-HNIS--YGKNCG------KCDPSCFNGSCWGTGPDKCQRMTKVICAE-QCSGRC--KGPRPID-CCNEHCAAGCTGPRPTDCLACKDFQDEGTCKDACPRLMLYDPNTHQLAPNPYGKYSFGATCIKTCPHNYVVTDHGACVRTCSPG-TYEVDEGGVRKCKRC-EGLCPKVCNGLGMGPLANVLSINATNIDSFENCTKISGNVAILSTTFRGDPHT----NTSGLDPAKLSVLSTVKEITGYLMIQLWPES--MQSLSAFENLEVIRGRTKTQGTYS-FAVTKT-AITHLGMRSLREISDGDVSIVKNKNLCYSSPEHWKRLFKSKQQSVKMIENMDAATCANQNSTCNEMCTAD-GCWGPGPTMCFGCEHY--SRGKHCVASCNLLNGEPREYEVNKT----CMECDPECLLMNETQTCNGPGPDKCTV-CANYKDGPHCVHRCPQGVPGEKDTLIWKYADVTHVCQPCHENCTQ 624          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Match: egfra (epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) [Source:ZFIN;Acc:ZDB-GENE-030918-1])

HSP 1 Score: 248.825 bits (634), Expect = 8.653e-69
Identity = 206/666 (30.93%), Postives = 318/666 (47.75%), Query Frame = 2
Query:  611 NYMKVTANLNKNCTHVIGNVIITGITNE-NLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIG--ENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKH--IKNRLEKFTFHNTCVDKCPDKYFI-ENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNI--YNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN--ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGST--------SNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCR--KCNYVQLLTNGSEGFISRFTVHSL 2530
            ++ +V   + +NCT V+ N+ IT IT + +LSFL SI+E+ G++ +  N+V  I L+NL+IIRG + +   E KF+L V+ N     E  +K L L     IL+  +  +N    L     I W  IL       IV  HN S    K  G       C P      CWG    +CQ +   +    + S +C   G   I+ CC+E C  GC GP  T CL CK F ++G C + CPR ++++   H    N   K++F  TC+  CP  Y + ++  CV  C  G TY V+E     C  C  G+CPK C    +    N+  +N   +   ENCT   GN+ I + +  GD       N  G+    L  L+ +KEI G L I +  ++  +++L  F NLE+IR  T      +  ++ +   +  LG++ L+E+ +G V IV N  LCY+     K +  S Q ++    N     C  +   C+++C    GCWGP    C  C H+  +    C+++C+   G     E ++T    C +C  +CL  N   TC GPG D+CT  C NYK   +C  +CPQ   G+  T        +++C+ CH++CT        + CTGP     +  C+  K + + ++  G  G +  F + +L
Sbjct:   43 DHYQVLLRMYRNCTVVLENLEITHITEKYDLSFLKSIQEVGGYVLIAVNTVSKIPLENLRIIRGHSLY---EDKFALAVLVNYNNSIEQGVKELPLTSLTEILKGGVR-FNMNNHLCNVGTIEWADILNMKSLPTIVS-HNIS--YGKNCG------KCDPSCFNGSCWGTGPDKCQRMTKVICAE-QCSGRC--KGPRPID-CCNEHCAAGCTGPRPTDCLACKDFQDEGTCKDACPRLMLYDPNTHQLAPNPYGKYSFGATCIKTCPHNYVVTDHGACVRTCSPG-TYEVDEGGVRKCKRC-EGLCPKVCNGLGMGPLANVLSINATNIDSFENCTKISGNVAILSTTFRGDPHT----NTSGLDPAKLSVLSTVKEITGYLMIQLWPES--MQSLSAFENLEVIRGRTKTQGTYS-FAVTKT-AITHLGMRSLREISDGDVSIVKNKNLCYSSPEHWKRLFKSKQQSVKMIENMDAATCANQNSTCNEMCTAD-GCWGPGPTMCFGCEHY--SRGKHCVASCNLLNGEPREYEVNKT----CMECDPECLLMNETQTCNGPGPDKCTV-CANYKDGPHCVHRCPQGVPGEKDTLIWKYADVTHVCQPCHENCT--------QGCTGP----DLKDCKDFKSSGLPMIAAGVVGGLLAFVILAL 661          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Match: egfra (epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) [Source:ZFIN;Acc:ZDB-GENE-030918-1])

HSP 1 Score: 252.292 bits (643), Expect = 7.941e-68
Identity = 207/667 (31.03%), Postives = 319/667 (47.83%), Query Frame = 2
Query:  611 NYMKVTANLNKNCTHVIGNVIITGITNE-NLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIG--ENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCV-RKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKH--IKNRLEKFTFHNTCVDKCPDKYFI-ENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNI--YNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN--ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGST--------SNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCR--KCNYVQLLTNGSEGFISRFTVHSL 2530
            ++ +V   + +NCT V+ N+ IT IT + +LSFL SI+E+ G++ +  N+V  I L+NL+IIRG + +   E KF+L V+ N     E  +K L L     IL+  +  +N    L     I W  IL       IV  HN S    K  G       C P      CWG    +CQ +   +  + C  S +C   G   I+ CC+E C  GC GP  T CL CK F ++G C + CPR ++++   H    N   K++F  TC+  CP  Y + ++  CV  C  G TY V+E     C  C  G+CPK C    +    N+  +N   +   ENCT   GN+ I + +  GD       N  G+    L  L+ +KEI G L I +  ++  +++L  F NLE+IR  T      +  ++ +   +  LG++ L+E+ +G V IV N  LCY+     K +  S Q ++    N     C  +   C+++C    GCWGP    C  C H+  +    C+++C+   G     E ++T    C +C  +CL  N   TC GPG D+CT  C NYK   +C  +CPQ   G+  T        +++C+ CH++CT+         CTGP     +  C+  K + + ++  G  G +  F + +L
Sbjct:   43 DHYQVLLRMYRNCTVVLENLEITHITEKYDLSFLKSIQEVGGYVLIAVNTVSKIPLENLRIIRGHSLY---EDKFALAVLVNYNNSIEQGVKELPLTSLTEILKGGVR-FNMNNHLCNVGTIEWADILNMKSLPTIVS-HNIS--YGKNCG------KCDPSCFNGSCWGTGPDKCQRMTKVICAEQC--SGRC--KGPRPID-CCNEHCAAGCTGPRPTDCLACKDFQDEGTCKDACPRLMLYDPNTHQLAPNPYGKYSFGATCIKTCPHNYVVTDHGACVRTCSPG-TYEVDEGGVRKCKRC-EGLCPKVCNGLGMGPLANVLSINATNIDSFENCTKISGNVAILSTTFRGDPHT----NTSGLDPAKLSVLSTVKEITGYLMIQLWPES--MQSLSAFENLEVIRGRTKTQGTYS-FAVTKT-AITHLGMRSLREISDGDVSIVKNKNLCYSSPEHWKRLFKSKQQSVKMIENMDAATCANQNSTCNEMCTAD-GCWGPGPTMCFGCEHY--SRGKHCVASCNLLNGEPREYEVNKT----CMECDPECLLMNETQTCNGPGPDKCTV-CANYKDGPHCVHRCPQGVPGEKDTLIWKYADVTHVCQPCHENCTQ--------GCTGP----DLKDCKDFKSSGLPMIAAGVVGGLLAFVILAL 661          

HSP 2 Score: 88.5817 bits (218), Expect = 5.118e-17
Identity = 54/227 (23.79%), Postives = 104/227 (45.81%), Query Frame = 2
Query: 3218 SDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            S  AP+   L  + E +     +L  G F  + KG W  +  N                    V + V IKVL E +    NK+ + +  ++ S + P   R++ + + +  +L  QL   G L++++++N   +    +L W  Q+A G  Y++   +++ D+   N+ +++P  + I+D GL+KL N   +      GK+ I W   E+   + ++ +S V +Y 
Sbjct:  694 SGEAPNQALLRILKETEFKKIKVLGSGAFGTVHKGLWVPEGEN--------------------VKIPVAIKVLREATSPKANKEIMDEAYVMASVEHPHVCRLLGICLTSTVQLITQLMPYGCLLDYVRENKDRIGSQHLLNWCVQIAKGMNYLEERHLVHRDLAARNVLVKTPQHVKITDFGLAKLLNADEKEYHADGGKVPIKWMALESIQHRTYTHQSDVWSYG 900          

HSP 3 Score: 51.6026 bits (122), Expect = 8.688e-6
Identity = 29/93 (31.18%), Postives = 41/93 (44.09%), Query Frame = 2
Query: 2690 EYQFGAICLPCHPLC------SQCSDGTIESCHRCKSHRRGKECVHNCY-----EDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCK 2935
            EY+    C+ C P C        C+    + C  C +++ G  CVH C      E D +    ++   +C  CHE C +GCTG    DCK  K
Sbjct:  546 EYEVNKTCMECDPECLLMNETQTCNGPGPDKCTVCANYKDGPHCVHRCPQGVPGEKDTLIWKYADVTHVCQPCHENCTQGCTGPDLKDCKDFK 638          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Match: erbb4a (erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030918-4])

HSP 1 Score: 248.44 bits (633), Expect = 3.061e-66
Identity = 201/634 (31.70%), Postives = 301/634 (47.48%), Query Frame = 2
Query:  620 KVTANLNKNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCV-RKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNG----VKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKC-KNGATYAVNET--CLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLT---NLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH-SNQMNIYNNGKDGKCEARKCS---KLCHP---KYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSS---NITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTKENLFSFKRTCTGP 2428
            K      +NC  V+GN+ IT I  N NLSFL SI E+TG++ +  N  + + L+NL+IIRG   +   E ++SL +  N    G   L+ L L     IL   + V  N   L   + IHW+ I+   +   +V P N+S  T +      CH SC    G+  CWG+   QCQ +   V  + C    +CF      +  CCH EC GGC+GP +T C  C +FN+ GACV +CP+  V+N     ++H  N   K+T+   CV KCP  + +++  CV  C  N      N+T  C+PC + +CPK C           Q ++   + +  NCT  +GN+I     I+GD+        +GI+  D ++L     ++EI G L  NV S    +  L  F NL  I   +  +     L I +   +  L  Q L+E+  G V + NN +LC+  ++   S+   S Q  +  N +    E R+CS   K+C P   + GCWGP    C+ C++F  +    C+ +C+     +Y       +   C +C +QC  +    +TC+GPG D C   C++ K    C EKCP    G  S       T+N C  CH +CT+         CTGP
Sbjct:   20 KTLRKFYENCEVVMGNLEITSIERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTKLY---EGRYSLAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQN-KFLCHADTIHWHDIIKNPRSELLVVPSNNSGNTCRR-----CHRSCN---GR--CWGHQEDQCQSLTKTVCAEQC--DGRCF---GPYVSNCCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPN--AKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENQTKMCIPCTD-ICPKVCDGIGTGSLQMAQTVDSSNIEKFVNCTKINGNLIFLITGIKGDM-------FHGIRALDPDRLNVFRTVREITGFL--NVQSWPENMTDLGVFSNLATIGGRSLYSG--ISLLILKQRWITSLQFQSLREISAGNVYMTNNSQLCFYSTVNWTSLFRTSTQRALIKNNR----EPRECSKEQKICDPLCSEAGCWGPGPDQCLSCKYF--SRGKTCVKSCN----LYYGDVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCV-KCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQ--------GCTGP 601          

HSP 2 Score: 98.9821 bits (245), Expect = 3.466e-20
Identity = 93/414 (22.46%), Postives = 164/414 (39.61%), Query Frame = 2
Query: 2690 EYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYEDDYISKNS-----SNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            E+  G++C+ C   C +  +  +       + C +C   + G  CV  C  D     NS     +   + C  CH  C +GCTG    DC     V I     +T      + G  F I + +  V V  +                            K I      +K+  L+             S  AP+  +L  + E +     IL  G F ++ KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S + P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  I I+D GL++L +T  +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  518 EFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKC-PDGLQGANSFIFKYAETNNECHPCHPNCTQGCTGPRIQDC-----VGIL---DRTPLIAAGLIGGLFVIVIIALGVAVYIRR---------------------------KSI------KKKRALRRFLETELVEPLTPSGAAPNQAQLRILKETELKRVKILGAGAFGMVYKGIWVPEG--------------------ETVKIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDTDEKEYNSDGGKMPIKWMALECIHYRKFTHQSDVWSY 869          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Match: erbb4a (erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030918-4])

HSP 1 Score: 246.128 bits (627), Expect = 9.466e-66
Identity = 196/618 (31.72%), Postives = 292/618 (47.25%), Query Frame = 2
Query:  620 KVTANLNKNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCV-RKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNG----VKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKC-KNGATYAVNET--CLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH-SNQMNIYNNGKDGKCEARKCS---KLCHP---KYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSS---NITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTK 2389
            K      +NC  V+GN+ IT I  N NLSFL SI E+TG++ +  N  + + L+NL+IIRG   +   E ++SL +  N    G   L+ L L     IL   + V  N   L   + IHW+ I+   +   +V P N+S  T K      CH SC        CWG+   QCQ +   V  + C    +CF      +  CCH EC GGC+GP +T C  C +FN+ GACV +CP+  V+N     ++H  N   K+T+   CV KCP  + +++  CV  C  N      N+T  C+PC + +CPK C           Q ++   + +  NCT  +GN+I     I+GD+ +G    I  +    L     ++EI G L  NV S    +  L  F NL  I   +  +     L I +   +  L  Q L+E+  G V + NN +LC+  ++   S+   S Q  +  N +    E R+CS   K+C P   + GCWGP    C+ C++F  +    C+ +C+     +Y       +   C +C +QC  +    +TC+GPG D C   C++ K    C EKCP    G  S       T+N C  CH +CT+
Sbjct:   20 KTLRKFYENCEVVMGNLEITSIERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTKLY---EGRYSLAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQN-KFLCHADTIHWHDIIKNPRSELLVVPSNNSGNTCKR-----CHRSCNGR-----CWGHQEDQCQSLTKTVCAEQC--DGRCF---GPYVSNCCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPN--AKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENQTKMCIPCTD-ICPKVCDGIGTGSLQMAQTVDSSNIEKFVNCTKINGNLIFLITGIKGDMFHG----IRALDPDRLNVFRTVREITGFL--NVQSWPENMTDLGVFSNLATIGGRSLYSG--ISLLILKQRWITSLQFQSLREISAGNVYMTNNSQLCFYSTVNWTSLFRTSTQRALIKNNR----EPRECSKEQKICDPLCSEAGCWGPGPDQCLSCKYF--SRGKTCVKSCN----LYYGDVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCV-KCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQ 596          

HSP 2 Score: 92.4337 bits (228), Expect = 3.508e-18
Identity = 91/424 (21.46%), Postives = 176/424 (41.51%), Query Frame = 2
Query: 2687 HEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYEDDYISKNS-----SNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLN-----KRKRYDLKLKFSNGFSTVDIE----SDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
             E+  G++C+ C   C +  +  +       + C +C   + G  CV  C  D     NS     +   + C  CH  C +G      + C+     +   ++    + C S+  + F     +   C  P+    IQ+          +++   +G ++  + ++L      +RK    K        T  +E    S  AP+  +L  + E +     IL  G F ++ KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S + P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  I I+D GL++L +T  +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  517 REFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKC-PDGLQGANSFIFKYAETNNECHPCHPNCTQGSVACNRFRCRTRILYRTSCDNPMQSYNC-SLDRNMFDAMFLNVTYCTGPR----IQDC-VGILDRTPLIAAGLIGGLFVIVIIALGVAVYIRRKSIKKKRALRRFLETELVEPLTPSGAAPNQAQLRILKETELKRVKILGAGAFGMVYKGIWVPEG--------------------ETVKIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDTDEKEYNSDGGKMPIKWMALECIHYRKFTHQSDVWSY 913          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 226.098 bits (575), Expect = 2.874e-59
Identity = 190/605 (31.40%), Postives = 273/605 (45.12%), Query Frame = 2
Query:  641 KNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHN--GVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVN---ETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH-SNQ-MNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQC---LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCT 2386
            +NC  V+GN+ IT I    NLSFL SI E+TG++ +  N  + + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + +  N   L + + IHW  I+             + N T   +    C  SC   MG+  CWG S   CQ +   V   C        YG   +  CCH EC GGC GP +T C  C  FN+ G+CV +CP+  ++N    +  +N   K+T+   CV+KCP  + +++  CV  C +          + C PC  G+CPK C         + Q ++   + +  NCT  +GN+      I+GD  +    NI  ++ + L     ++EI G L  N+ S    +  L  F NL  I      +     L I +   L  L  Q LKE+  G V I +N  LCY  ++   S+   SNQ   I  N K   C A    C  LC    GCWGP    C+ CR+F  +    C+ +C+      Y  E+ +  +   C  C +QC     S +TCYGPG D CT  C N+K    C EKCP+   G  S           C  CH +CT
Sbjct:   36 ENCEVVMGNLEITSIEPGRNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGIKLY---EDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQN-KFLCYADTIHWQDIV------------RTPNATLVPMSSGRCPKSC---MGR--CWGPSDQHCQRLTKTV---CAEQCDGRCYGSY-VSDCCHRECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPC-AGICPKVCDGIGTGSLQSAQTVDSSNIDKFINCTKINGNLHFLVTGIDGDPYH----NIAALEPQKLNIFFTVREITGFL--NIQSWPRNMTDLSVFSNLVNIGGRVLYSG--ISLLILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCS-NAGCWGPGANQCLSCRYF--SRGKSCVRSCN-----LYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCT-KCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCT 597          

HSP 2 Score: 102.834 bits (255), Expect = 2.671e-21
Identity = 90/416 (21.63%), Postives = 167/416 (40.14%), Query Frame = 2
Query: 2684 NHEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYE-----DDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            + E+  G++C+ C   C +  D  +       + C +C + + G  CV  C E     + +I K  ++ +  C  CH  C +GC   T +DC     + +    ++T     S+ G  F I + +    V  +                            K I      +K+  L+             S  AP+  +L  + E +     IL  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S D P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  + I+D GL++L     +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  518 SREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTKCSNFKDGPNCVEKCPEGLQGANSFIFK-YADEDKECHPCHPNCTDGCNNPTSHDCLWNDPLTL-PQHARTPLIAASVIGGLFIIVIMALTFAVYIRR---------------------------KSI------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSY 878          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 226.098 bits (575), Expect = 2.908e-59
Identity = 190/605 (31.40%), Postives = 273/605 (45.12%), Query Frame = 2
Query:  641 KNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHN--GVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVN---ETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH-SNQ-MNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQC---LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCT 2386
            +NC  V+GN+ IT I    NLSFL SI E+TG++ +  N  + + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + +  N   L + + IHW  I+             + N T   +    C  SC   MG+  CWG S   CQ +   V   C        YG   +  CCH EC GGC GP +T C  C  FN+ G+CV +CP+  ++N    +  +N   K+T+   CV+KCP  + +++  CV  C +          + C PC  G+CPK C         + Q ++   + +  NCT  +GN+      I+GD  +    NI  ++ + L     ++EI G L  N+ S    +  L  F NL  I      +     L I +   L  L  Q LKE+  G V I +N  LCY  ++   S+   SNQ   I  N K   C A    C  LC    GCWGP    C+ CR+F  +    C+ +C+      Y  E+ +  +   C  C +QC     S +TCYGPG D CT  C N+K    C EKCP+   G  S           C  CH +CT
Sbjct:   31 ENCEVVMGNLEITSIEPGRNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGIKLY---EDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQN-KFLCYADTIHWQDIV------------RTPNATLVPMSSGRCPKSC---MGR--CWGPSDQHCQRLTKTV---CAEQCDGRCYGSY-VSDCCHRECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPC-AGICPKVCDGIGTGSLQSAQTVDSSNIDKFINCTKINGNLHFLVTGIDGDPYH----NIAALEPQKLNIFFTVREITGFL--NIQSWPRNMTDLSVFSNLVNIGGRVLYSG--ISLLILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCS-NAGCWGPGANQCLSCRYF--SRGKSCVRSCN-----LYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCT-KCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCT 592          

HSP 2 Score: 102.834 bits (255), Expect = 2.666e-21
Identity = 90/416 (21.63%), Postives = 167/416 (40.14%), Query Frame = 2
Query: 2684 NHEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYE-----DDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            + E+  G++C+ C   C +  D  +       + C +C + + G  CV  C E     + +I K  ++ +  C  CH  C +GC   T +DC     + +    ++T     S+ G  F I + +    V  +                            K I      +K+  L+             S  AP+  +L  + E +     IL  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S D P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  + I+D GL++L     +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  513 SREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTKCSNFKDGPNCVEKCPEGLQGANSFIFK-YADEDKECHPCHPNCTDGCNNPTSHDCLWNDPLTL-PQHARTPLIAASVIGGLFIIVIMALTFAVYIRR---------------------------KSI------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSY 873          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 226.098 bits (575), Expect = 3.085e-59
Identity = 190/605 (31.40%), Postives = 273/605 (45.12%), Query Frame = 2
Query:  641 KNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHN--GVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVN---ETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH-SNQ-MNIYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQC---LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCT 2386
            +NC  V+GN+ IT I    NLSFL SI E+TG++ +  N  + + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + +  N   L + + IHW  I+             + N T   +    C  SC   MG+  CWG S   CQ +   V   C        YG   +  CCH EC GGC GP +T C  C  FN+ G+CV +CP+  ++N    +  +N   K+T+   CV+KCP  + +++  CV  C +          + C PC  G+CPK C         + Q ++   + +  NCT  +GN+      I+GD  +    NI  ++ + L     ++EI G L  N+ S    +  L  F NL  I      +     L I +   L  L  Q LKE+  G V I +N  LCY  ++   S+   SNQ   I  N K   C  E   C  LC    GCWGP    C+ CR+F  +    C+ +C+      Y  E+ +  +   C  C +QC     S +TCYGPG D CT  C N+K    C EKCP+   G  S           C  CH +CT
Sbjct:   62 ENCEVVMGNLEITSIEPGRNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGIKLY---EDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQN-KFLCYADTIHWQDIV------------RTPNATLVPMSSGRCPKSC---MGR--CWGPSDQHCQRLTKTV---CAEQCDGRCYGSY-VSDCCHRECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPC-AGICPKVCDGIGTGSLQSAQTVDSSNIDKFINCTKINGNLHFLVTGIDGDPYH----NIAALEPQKLNIFFTVREITGFL--NIQSWPRNMTDLSVFSNLVNIGGRVLYSG--ISLLILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCS-NAGCWGPGANQCLSCRYF--SRGKSCVRSCN-----LYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCT-KCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCT 623          

HSP 2 Score: 102.834 bits (255), Expect = 3.310e-21
Identity = 90/416 (21.63%), Postives = 167/416 (40.14%), Query Frame = 2
Query: 2684 NHEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYE-----DDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            + E+  G++C+ C   C +  D  +       + C +C + + G  CV  C E     + +I K  ++ +  C  CH  C +GC   T +DC     + +    ++T     S+ G  F I + +    V  +                            K I      +K+  L+             S  AP+  +L  + E +     IL  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S D P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  + I+D GL++L     +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  544 SREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTKCSNFKDGPNCVEKCPEGLQGANSFIFK-YADEDKECHPCHPNCTDGCNNPTSHDCLWNDPLTL-PQHARTPLIAASVIGGLFIIVIMALTFAVYIRR---------------------------KSI------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSY 904          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 226.098 bits (575), Expect = 3.138e-59
Identity = 190/605 (31.40%), Postives = 273/605 (45.12%), Query Frame = 2
Query:  641 KNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHN--GVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVN---ETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH-SNQ-MNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQC---LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCT 2386
            +NC  V+GN+ IT I    NLSFL SI E+TG++ +  N  + + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + +  N   L + + IHW  I+             + N T   +    C  SC   MG+  CWG S   CQ +   V   C        YG   +  CCH EC GGC GP +T C  C  FN+ G+CV +CP+  ++N    +  +N   K+T+   CV+KCP  + +++  CV  C +          + C PC  G+CPK C         + Q ++   + +  NCT  +GN+      I+GD  +    NI  ++ + L     ++EI G L  N+ S    +  L  F NL  I      +     L I +   L  L  Q LKE+  G V I +N  LCY  ++   S+   SNQ   I  N K   C A    C  LC    GCWGP    C+ CR+F  +    C+ +C+      Y  E+ +  +   C  C +QC     S +TCYGPG D CT  C N+K    C EKCP+   G  S           C  CH +CT
Sbjct:   36 ENCEVVMGNLEITSIEPGRNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGIKLY---EDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQN-KFLCYADTIHWQDIV------------RTPNATLVPMSSGRCPKSC---MGR--CWGPSDQHCQRLTKTV---CAEQCDGRCYGSY-VSDCCHRECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPC-AGICPKVCDGIGTGSLQSAQTVDSSNIDKFINCTKINGNLHFLVTGIDGDPYH----NIAALEPQKLNIFFTVREITGFL--NIQSWPRNMTDLSVFSNLVNIGGRVLYSG--ISLLILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCS-NAGCWGPGANQCLSCRYF--SRGKSCVRSCN-----LYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCT-KCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCT 597          

HSP 2 Score: 102.834 bits (255), Expect = 2.736e-21
Identity = 90/416 (21.63%), Postives = 167/416 (40.14%), Query Frame = 2
Query: 2684 NHEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYE-----DDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            + E+  G++C+ C   C +  D  +       + C +C + + G  CV  C E     + +I K  ++ +  C  CH  C +GC   T +DC     + +    ++T     S+ G  F I + +    V  +                            K I      +K+  L+             S  AP+  +L  + E +     IL  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S D P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  + I+D GL++L     +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  518 SREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTKCSNFKDGPNCVEKCPEGLQGANSFIFK-YADEDKECHPCHPNCTDGCNNPTSHDCLWNDPLTL-PQHARTPLIAASVIGGLFIIVIMALTFAVYIRR---------------------------KSI------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSY 878          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 226.098 bits (575), Expect = 3.240e-59
Identity = 190/605 (31.40%), Postives = 273/605 (45.12%), Query Frame = 2
Query:  641 KNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHN--GVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVN---ETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH-SNQ-MNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQC---LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCT 2386
            +NC  V+GN+ IT I    NLSFL SI E+TG++ +  N  + + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + +  N   L + + IHW  I+             + N T   +    C  SC   MG+  CWG S   CQ +   V   C        YG   +  CCH EC GGC GP +T C  C  FN+ G+CV +CP+  ++N    +  +N   K+T+   CV+KCP  + +++  CV  C +          + C PC  G+CPK C         + Q ++   + +  NCT  +GN+      I+GD  +    NI  ++ + L     ++EI G L  N+ S    +  L  F NL  I      +     L I +   L  L  Q LKE+  G V I +N  LCY  ++   S+   SNQ   I  N K   C A    C  LC    GCWGP    C+ CR+F  +    C+ +C+      Y  E+ +  +   C  C +QC     S +TCYGPG D CT  C N+K    C EKCP+   G  S           C  CH +CT
Sbjct:   35 ENCEVVMGNLEITSIEPGRNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGIKLY---EDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQN-KFLCYADTIHWQDIV------------RTPNATLVPMSSGRCPKSC---MGR--CWGPSDQHCQRLTKTV---CAEQCDGRCYGSY-VSDCCHRECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPC-AGICPKVCDGIGTGSLQSAQTVDSSNIDKFINCTKINGNLHFLVTGIDGDPYH----NIAALEPQKLNIFFTVREITGFL--NIQSWPRNMTDLSVFSNLVNIGGRVLYSG--ISLLILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCS-NAGCWGPGANQCLSCRYF--SRGKSCVRSCN-----LYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCT-KCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCT 596          

HSP 2 Score: 102.834 bits (255), Expect = 3.027e-21
Identity = 90/416 (21.63%), Postives = 167/416 (40.14%), Query Frame = 2
Query: 2684 NHEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYE-----DDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            + E+  G++C+ C   C +  D  +       + C +C + + G  CV  C E     + +I K  ++ +  C  CH  C +GC   T +DC     + +    ++T     S+ G  F I + +    V  +                            K I      +K+  L+             S  AP+  +L  + E +     IL  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S D P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  + I+D GL++L     +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  517 SREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTKCSNFKDGPNCVEKCPEGLQGANSFIFK-YADEDKECHPCHPNCTDGCNNPTSHDCLWNDPLTL-PQHARTPLIAASVIGGLFIIVIMALTFAVYIRR---------------------------KSI------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSY 877          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Match: Erbb4 (erb-b2 receptor tyrosine kinase 4 [Source:MGI Symbol;Acc:MGI:104771])

HSP 1 Score: 230.335 bits (586), Expect = 9.699e-63
Identity = 194/622 (31.19%), Postives = 279/622 (44.86%), Query Frame = 2
Query:  641 KNCTHVIGNVIITGIT-NENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKH--QFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLS--INQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS--NQMNIYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN---ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTKENLFSFKRTCTG 2425
            +NC  V+GN+ IT I  N +LSFL SI E+TG++ +  N    + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + V  N   L + + IHW  I+       + +V  + SS       G   CH SC        CWG +   CQ +    R  C        YG   +  CCH EC GGC GP +T C  C +FN+ GACV +CP+  V+N        N   K+T+   CV KCP  + +++  CV  C + +   V E     C PC + +CPK C         + Q ++   + +  NCT  +GN+I     I GD  N     I  I  + L     ++EI G L  N+ S  P +     F NL  I          +GLS  I +   +  L  Q LKE+  G + I +N  LCY  ++   ++  +   ++ I +N +   C  E   C+ LC    GCWGP    C+ CR F  +   +CI +C+   G F   EN       C +C +QC       +TC+GPG D CT  C ++K    C EKCP    G  S           C  CH +CT+  + S    C G
Sbjct:   54 ENCEVVMGNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLY---EDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNK-FLCYADTIHWQDIVRNPWPSNMTLVSTNGSS-------GCGRCHKSCTGR-----CWGPTENHCQTL---TRTVCAEQCDGRCYGPY-VSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPS-SKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNA----IDAIDPEKLNVFRTVREITGFL--NIQSWPPNMTDFSVFSNLVTIGGRVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRRAENCTAEGMVCNHLCSND-GCWGPGPDQCLSCRRF--SRGKICIESCNLYDGEFREFENGSI----CVECDSQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQGCIGSSIEDCIG 635          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Match: Erbb3 (erb-b2 receptor tyrosine kinase 3 [Source:MGI Symbol;Acc:MGI:95411])

HSP 1 Score: 234.958 bits (598), Expect = 4.841e-62
Identity = 189/650 (29.08%), Postives = 291/650 (44.77%), Query Frame = 2
Query:  524 SFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGN--VIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVV--SNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGV--KHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKC--------KNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS---NQMNIYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQC--LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTK 2389
            S  R     + Q  C   L    +    +N  +    L + C  V+GN  +++TG  N +LSFL  I E+TG++ +  N    + L NL+++RG    +Y + KF++ V+   N    + L+ L   +   IL   + +  N  + +  + I W  I+ +    EIV  +N  N          CH  C     K  CWG     CQI+   +    + + +CF        QCCH+EC GGC GP +T C  C+HFN+ GACV +CP  LV+N +  +   N   K+ +   CV  CP  + ++   CV  C        KNG      + C PC  G+CPK C        Y  Q ++   +    NCT   GN+      I G  G+ W K I  +  + L     ++EI G L  N+ S  P +     F NL  I   +  N+  + L I +N ++  LG + LKE+  G V I  N +LCY  SL    +L      +++I  N   G+C  E + C  LC    GCWGP    C+ CR++  + + +C+++C+        +     HE  C  CH +C  +    TC G G+D C   C +++   +C   CP    G            N C+ CH++CT+
Sbjct:   15 SLARGSEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLEIVLTG-HNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQ--VY-DGKFAIFVMLNYNTNSSHALRQLRFTQLTEILLGGVYIEKNDKLCHM-DTIDWRDIV-RVPDAEIVVKNNGGNCPP-------CHEVC-----KGRCWGPGPEDCQILTKTICAP-QCNGRCF---GPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPAPLVYNKLTFQLEPNPHIKYQYGGVCVASCPHNFVVDQTFCVRACPADKMEVDKNGL-----KMCEPC-RGLCPKACEGTGSGSRY--QTVDSSNIDGFVNCTKILGNL---DFLITGLNGDPWHK-IPALDPEKLNVFRTVREITGYL--NIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFS-LLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPAEERLDIKYNRPLGECVAEGKVCDPLCS-SGGCWGPGPGQCLSCRNY--SREGVCVTHCN----VLQGEPREFVHEAHCFSCHPECQPMEGTSTCNGSGSDACAR-CAHFRDGPHCVNSCPHGILGAKGPIYKYPDAQNECRPCHENCTQ 619          

HSP 2 Score: 60.077 bits (144), Expect = 2.365e-8
Identity = 44/206 (21.36%), Postives = 91/206 (44.17%), Query Frame = 2
Query: 3284 ILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPD-ELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            +L  G F  + KG W                     IP+ E + + V IKV+ + S     +     +  + S D    +R++ +   +  +L  Q    GSL++ ++Q+   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP ++ ++D G++ L    ++     E K  I W   E+ +   ++ +S V +Y 
Sbjct:  712 VLGSGVFGTVHKGIW---------------------IPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAVGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRETLGPQLLLNWGVQIAKGMYYLEEHSMVHRDLALRNVMLKSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYG 896          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Match: Erbb4 (erb-b2 receptor tyrosine kinase 4 [Source:MGI Symbol;Acc:MGI:104771])

HSP 1 Score: 233.032 bits (593), Expect = 1.518e-61
Identity = 196/626 (31.31%), Postives = 282/626 (45.05%), Query Frame = 2
Query:  641 KNCTHVIGNVIITGIT-NENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKH--QFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLS--INQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS--NQMNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN---ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTKENLFSFKRTCTGPGNH 2437
            +NC  V+GN+ IT I  N +LSFL SI E+TG++ +  N    + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + V  N   L + + IHW  I+       + +V  + SS       G   CH SC    G+  CWG +   CQ +    R  C        YG   +  CCH EC GGC GP +T C  C +FN+ GACV +CP+  V+N        N   K+T+   CV KCP  + +++  CV  C + +   V E     C PC + +CPK C         + Q ++   + +  NCT  +GN+I     I GD  N     I  I  + L     ++EI G L  N+ S  P +     F NL  I          +GLS  I +   +  L  Q LKE+  G + I +N  LCY  ++   ++  +   ++ I +N +   C A    C+ LC    GCWGP    C+ CR F  +   +CI +C+   G F   EN       C +C +QC       +TC+GPG D CT  C ++K    C EKCP    G  S           C  CH +CT+         C GP +H
Sbjct:   54 ENCEVVMGNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLY---EDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQN-KFLCYADTIHWQDIVRNPWPSNMTLVSTNGSS-------GCGRCHKSC---TGR--CWGPTENHCQTL---TRTVCAEQCDGRCYGPY-VSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPS-SKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNA----IDAIDPEKLNVFRTVREITGFL--NIQSWPPNMTDFSVFSNLVTIGGRVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRRAENCTAEGMVCNHLCS-NDGCWGPGPDQCLSCRRF--SRGKICIESCNLYDGEFREFENGSI----CVECDSQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQ--------GCNGPTSH 631          

HSP 2 Score: 104.76 bits (260), Expect = 5.492e-22
Identity = 90/426 (21.13%), Postives = 162/426 (38.03%), Query Frame = 2
Query: 2687 HEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYEDDYISKNS-----SNAESLCLKCHEECMEGCTGSTEYDC-----------KQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
             E++ G+IC+ C   C +  DG +       ++C +C   + G  CV  C  D     NS     ++ +  C  CH  C +GC G T +DC            Q  R  +         F   I    F ++V  + +                                          +K+  L+             S  AP+  +L  + E +     +L  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S D P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  + I+D GL++L     +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  544 REFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKC-PDGLQGANSFIFKYADQDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIMALTFAVYVRRKSI------------------------------------------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSY 906          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Match: Erbb4 (erb-b2 receptor tyrosine kinase 4 [Source:MGI Symbol;Acc:MGI:104771])

HSP 1 Score: 232.646 bits (592), Expect = 1.788e-61
Identity = 196/626 (31.31%), Postives = 282/626 (45.05%), Query Frame = 2
Query:  641 KNCTHVIGNVIITGIT-NENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKH--QFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLS--INQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS--NQMNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN---ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTKENLFSFKRTCTGPGNH 2437
            +NC  V+GN+ IT I  N +LSFL SI E+TG++ +  N    + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + V  N   L + + IHW  I+       + +V  + SS       G   CH SC    G+  CWG +   CQ +    R  C        YG   +  CCH EC GGC GP +T C  C +FN+ GACV +CP+  V+N        N   K+T+   CV KCP  + +++  CV  C + +   V E     C PC + +CPK C         + Q ++   + +  NCT  +GN+I     I GD  N     I  I  + L     ++EI G L  N+ S  P +     F NL  I          +GLS  I +   +  L  Q LKE+  G + I +N  LCY  ++   ++  +   ++ I +N +   C A    C+ LC    GCWGP    C+ CR F  +   +CI +C+   G F   EN       C +C +QC       +TC+GPG D CT  C ++K    C EKCP    G  S           C  CH +CT+         C GP +H
Sbjct:   54 ENCEVVMGNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLY---EDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQN-KFLCYADTIHWQDIVRNPWPSNMTLVSTNGSS-------GCGRCHKSC---TGR--CWGPTENHCQTL---TRTVCAEQCDGRCYGPY-VSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPS-SKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNA----IDAIDPEKLNVFRTVREITGFL--NIQSWPPNMTDFSVFSNLVTIGGRVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRRAENCTAEGMVCNHLCS-NDGCWGPGPDQCLSCRRF--SRGKICIESCNLYDGEFREFENGSI----CVECDSQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQ--------GCNGPTSH 631          

HSP 2 Score: 104.76 bits (260), Expect = 5.410e-22
Identity = 90/426 (21.13%), Postives = 162/426 (38.03%), Query Frame = 2
Query: 2687 HEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYEDDYISKNS-----SNAESLCLKCHEECMEGCTGSTEYDC-----------KQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
             E++ G+IC+ C   C +  DG +       ++C +C   + G  CV  C  D     NS     ++ +  C  CH  C +GC G T +DC            Q  R  +         F   I    F ++V  + +                                          +K+  L+             S  AP+  +L  + E +     +L  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S D P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  + I+D GL++L     +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  544 REFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKC-PDGLQGANSFIFKYADQDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIMALTFAVYVRRKSI------------------------------------------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSY 906          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Match: Egfr (epidermal growth factor receptor [Source:MGI Symbol;Acc:MGI:95294])

HSP 1 Score: 216.853 bits (551), Expect = 8.492e-59
Identity = 186/623 (29.86%), Postives = 283/623 (45.43%), Query Frame = 2
Query:  644 NCTHVIGNVIITGIT-NENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNI-IGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSS----CQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIK--NRLEKFTFHNTCVDKCPDKYFI-ENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS--NQMNIYNNGKDGKCEA--RKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCL--SSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGST--------SNICKACHQSCTKENLFSFKRTCTGPG 2431
            NC  V+GN+ IT +  N +LSFL +I+E+ G++ +  N+VE I L+NL+IIRG   +   E  ++L ++SN       L+ L +   Q IL   +   NNP +L   + I W  I+              + F S    DL  H S    C P      CWG     CQ +   +    + S +C          CCH +C  GC GP  + CL+C+ F ++  C + CP  +++N   +    N   K++F  TCV KCP  Y + ++  CV  C     Y V E     C  C +G C K C    + +  +   +N   +   + CT   G++ I  ++ +GD     P     +  ++LE L  +KEI G L I       W   L  F NLEIIR  T  +   +   +  N  +  LGL+ LKE+ +G V I  N  LCY +++  K +  +   +  I NN  +  C+A    C+ LC  + GCWGP    CV C++  ++    C+  C+   G    +        +C +CH +CL  + NITC G G D C   C +Y    +C + CP    G+ +T        +N+C  CH +CT          C GPG
Sbjct:   57 NCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALY---ENTYALAILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNP-ILCNMDTIQWRDIV-------------QNVFMSNMSMDLQSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQ-QCSHRCRGRSP---SDCCHNQCAAGCTGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRAC-GPDYYEVEEDGIRKCKKC-DGPCRKVCNGIGIGEFKDTLSINATNIKHFKYCTAISGDLHILPVAFKGDSFTRTPP----LDPRELEILKTVKEITGFLLIQAWPDN-WTD-LHAFENLEIIRGRTKQHGQFSLAVVGLN--ITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKLFGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSE-GCWGPEPRDCVSCQN--VSRGRECVEKCNILEG----EPREFVENSECIQCHPECLPQAMNITCTGRGPDNC-IQCAHYIDGPHCVKTCPAGIMGENNTLVWKYADANNVCHLCHANCT--------YGCAGPG 632          
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Match: sp|P04412|EGFR_DROME (Epidermal growth factor receptor OS=Drosophila melanogaster OX=7227 GN=Egfr PE=1 SV=3)

HSP 1 Score: 331.643 bits (849), Expect = 3.685e-92
Identity = 299/1123 (26.63%), Postives = 492/1123 (43.81%), Query Frame = 2
Query:  644 NCTHVIGNVIITGITNENL--SFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIY--REVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEG--DIGNGW---PKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIY--NNGKDGKCE--ARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSD-GTIES-CHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKI--------YLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQ-ELKPIQNSWYXXXXXXXXXXXXXXXXXWKCIC-------MSLNKRKRYDLKLKFSNGFSTVDIESDFAPSST-----KLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            NCT+V GN+ +T + NENL  SFL++I E+TG++ +    V+ +    L+IIRG   +     E K++L V  +      +  L +P  + +L   +  +NN  + + +  I W+ I+         + + + +FT+ E     CH SC        CWG     CQ  +           +C  YG  K  +CCH  C GGC GP    C+ CK+F ++    E+CP    +N   ++   N   K+ +  TCV +CP     +N  CV  C         E C+PC NG CPK C    V+   NI            NCTV  GNI I   +  G  D+   +   P+ I  +  +  E  + +KEI G L  N+    P  + L YFRNLE I            L+I ++  L  L ++ LK++ +G V I +N  LCY  ++   +I    +  ++   N +   CE     CS  C+ + GCWG     C+ C++F       CI++C    GY  N   ++     C  CH +C     TC G GAD C   CV+ +   +C  +CP++ Y D     +C+ CH +C           CTGP + IG+  C  CN   L    ++  + R       C+   + C DGYF    ++  P+                       ++ +       A+C  CHPLC  C++ G  E  C +C  ++R ++C   C  D Y  +        C + H EC  GCTG    DCK C+  K+        Y+NS  T F C S C    R  VN +   + P     P ++S   A +  +++ ++   ++   IC       +   K+K     +K +   S  +      PS+      KL  + + +     +L +G F  + KG W  +  N                    V + V IK L + +    +++FL++  I+ S +    L+++ V + +   L  QL   G L+++++ N   +   ++L W+ Q+A G  Y++ + +++ D+   N+ +++P  + I+D GL+KL ++ +   K   GK+ I W   E   ++ F+SKS V  + 
Sbjct:  128 NCTYVDGNLKLTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYS-----KMYTLEIPDLRDVLNGQVGFHNNYNLCHMRT-IQWSEIVSNG-----TDAYYNYDFTAPERECPKCHESCT-----HGCWGEGPKNCQKFSKLTCSPQCAGGRC--YGP-KPRECCHLFCAGGCTGPTQKDCIACKNFFDEAVSKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGE-CVPC-NGPCPKTCPGVTVLHAGNID--------SFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYI-PLDPERREVFSTVKEITGYL--NIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKS-SLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCN-EDGCWGAGTDQCLTCKNFNFN--GTCIADC----GYISNA--YKFDNRTCKICHPECR----TCNGAGADHCQ-ECVHVRDGQHCVSECPKNKYND---RGVCRECHATCDG---------CTGPKDTIGIGACTTCN---LAIINNDATVKR-------CLLKDDKCPDGYF---WEYVHPQ-----------------------EQGSLKPLAGRAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQRE----CFQRHPEC-NGCTGPGADDCKSCRNFKLFDANETGPYVNS--TMFNCTSKCPLEMR-HVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEPLRPSNIGANLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVPEGEN--------------------VKIPVAIKELLKSTGAESSEEFLREAYIMASEEHVNLLKLLAVCMSSQMMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFG 1127          
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Match: sp|P0CY46|EGFR_APIME (Epidermal growth factor receptor OS=Apis mellifera OX=7460 GN=Egfr PE=2 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 3.524e-84
Identity = 273/1026 (26.61%), Postives = 432/1026 (42.11%), Query Frame = 2
Query:  926 VYNNPGMLYFKNNIHWNSIL-GKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEG--------DIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMN--IYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIES--CHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYL----NSSKTKFFCNSICGDNF--RIF-VNSEMVC------VQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSS-----TKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            +YNN  + + +  I+W  I+ G       V      NFTS E     C  SC+     + CWG     CQ  +           +CF        +CCH  C GGC GP  + C+ CK+F + G C ++CP    +N   +    N   K+ +  TCV +CP+    +N  CV  C      A+N  C+PC +G CPK C   + V + NI           ++CT+  G+I I   S +G          G  + K    +    LE  + LKEI G L I    K    K L YFRNLE+I   T   ++   L + +   LV  GL  LK++ +G + I+ N  LCY  S+    I  S++    + NN  + +C  +   C + C  + GCWGP    C+ C++F +   N C+ +C+  PG +      Q  E  C  CH +C  S   C GP  D C   C + +   +C  +CP   Y D   + +CK+CH +C           C GP N+IG NGC  C+   L  +  EG           C+    +C DGY+    ++ SP                       +++         A+C  CH  C +C+        C  C  ++RG++C   C  D +     ++A  LC+ C  EC  GC G     C +C+  KIY+    + + T F C   C   +  +IF  +SE  C      +   EL+P   +         +V    +   W+       + K  +  +K +   + +D      P+       KL  I E +     IL  G F  + KG W  +  N                    V + V IKVL + +    +K+FL +  I+ S + P  L+++ V + +   L  QL   G L++F+++    +   ++L W  Q+A G  Y++   +++ D+   N+ +++P  + I+D GL+KL +      K   GK+ I W   E    + F+ KS V  + 
Sbjct:    1 MYNNYNLCHIRT-INWEEIITGPSAMYSYV-----YNFTSPERACTPCDKSCE-----QGCWGEGPENCQKYSKTNCSPQCWQGRCF---GPNPRECCHLFCAGGCTGPKQSDCIACKNFFDDGVCTQECPPMQKYNPTTYSWEPNPDGKYAYGATCVRRCPEHLLKDNGACVRSCPPKKK-ALNGECVPC-DGPCPKTCKGVEKVHSGNID--------SFKDCTIIEGSITILDQSFQGFQHVYRNFSFGKRYEK----MHPDKLEVFSTLKEITGFLNIQGDHKD--FKNLSYFRNLEVIGGRTL-TEYFASLYVVKT-SLVSFGLSSLKKIYSGSIAILENKNLCYAQSINWTRIKKSSEHESLLSNNRNESECIKDGLVCDEQCSDE-GCWGPGPAQCLSCKNFILG--NDCLQDCTA-PGIY------QADEKTCKVCHEECDGS---CIGPNTDHCK-KCKHARDGPFCVPECPASKYND---NGVCKSCHGNCVG--------GCEGPENNIGPNGCHSCDKAILNDHVPEG-----------CLQKKESCPDGYY---YEWVSP-----------------------LEQGPLKPLASKAVCRKCHSRCKKCTGYGFHEHVCQECTKYKRGEQCEDECPADYF-----ADANKLCIPCFSEC-RGCFGPGPNQCYKCRNYKIYIDEDTDGNTTSFNCTETCTPEYPHKIFNPDSEPYCSLETAGLIENELQPAILAGVAVFALAFLVVAAIIMYFWRV------RAKAKENTVKMTMALTGLDDNEPLRPTGVKPNLAKLRIIKEEEMRKGGILGYGAFGNVYKGVWVPEGEN--------------------VKIPVAIKVLHDGTGANTSKEFLDEAYIMASVEHPNLLQLLAVCMTSQMMLVTQLMPLGCLLDFVRRFKDKIGSKALLNWCTQIARGMAYLEERRLVHRDLAARNVLVQTPNCVKITDFGLAKLLDINEEQYKAAGGKMPIKWLALECIQHRVFTHKSDVWAFG 900          
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Match: sp|P13388|XMRK_XIPMA (Melanoma receptor tyrosine-protein kinase OS=Xiphophorus maculatus OX=8083 GN=xmrk PE=2 SV=2)

HSP 1 Score: 246.899 bits (629), Expect = 2.753e-65
Identity = 203/647 (31.38%), Postives = 306/647 (47.30%), Query Frame = 2
Query:  608 NNYMKVTANLNKNCTHVIGNVIITGIT-NENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNI--------IGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEI-VEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKH--IKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGD----IGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCL--SSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGST--------SNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCR 2458
            N+Y+K+   +   C  V+ N+ IT    N++LSFL SI+E+ G++ +  N V +I L NL++IRG+N +   E  F+L+V+SN         + +  LK L L     IL   + V +NP +L     I+W  I+ K     + + PH       K      C   C        CW    G CQ      +  C         G   I+ CC+E C GGC GP  T CL C+ FN+ G C + CP   +++ V H  + N   K+TF   CV +CP  Y +    CV  C  G    V+E    +C PC +GVCPK C    +    N   +N   +    NCT  +G+II+N  S EGD    IG   P++++         LT +KEI G L I    +   + +L  F+NLEIIR  TT ++  +   + Q   L +LGL+ LKEV  G V + N  +L Y +++  + +  S   +I     D + E + C+  C  + GCWGP    CV C H  +     C+++C+   G    +      + +C +CH +CL  + ++TCYGPG   C+    +++    C  +CP    GDG T           C+ CHQ+CT+         C+GP    G++GCR
Sbjct:   44 NHYLKM-KKMYSGCNVVLENLEITYTQENQDLSFLQSIQEVGGYVLIAMNEVSTIPLVNLRLIRGQNLY---EGNFTLLVMSNYQKNPSSPDVYQVGLKQLQLSNLTEILSGGVKVSHNP-LLCNVETINWWDIVDKTSNPTMNLIPHAFERQCQK------CDHGCV----NGSCWAPGPGHCQKF---TKLLCAEQCNRRCRGPKPID-CCNEHCAGGCTGPRATDCLACRDFNDDGTCKDTCPPPKIYDIVSHQVVDNPNIKYTFGAACVKECPSNYVVTEGACVRSCSAG-MLEVDENGKRSCKPC-DGVCPKVCDGIGIGSLSNTIAVNSTNIRSFSNCTKINGDIILNRNSFEGDPHYKIGTMDPEHLW--------NLTTVKEITGYLVIMWWPEN--MTSLSVFQNLEIIRGRTTFSRGFS-FVVVQVRHLQWLGLRSLKEVSAGNVILKNTLQLRYANTINWRRLFRSEDQSIE---YDARTENQTCNNECS-EDGCWGPGPTMCVSCLH--VDRGGRCVASCNLLQG----EPREAQVDGRCVQCHQECLVQTDSLTCYGPGPANCS-KSAHFQDGPQCIPRCPHGILGDGDTLIWKYADKMGQCQPCHQNCTQ--------GCSGP----GLSGCR 635          

HSP 2 Score: 82.0333 bits (201), Expect = 3.270e-14
Identity = 54/227 (23.79%), Postives = 103/227 (45.37%), Query Frame = 2
Query: 3218 SDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            S  AP+   L  + E +   + +L  G F  + KG W     N                    + + V IKVL E +    N++ L +  ++ S D P   R++ + + +  +L  QL   G L+++++Q+   +    +L W  Q+A G  Y++   +++ D+   N+ +++P  + I+D GLSKL     +  +   GK+ I W   E+     ++ +S V +Y 
Sbjct:  693 SGQAPNQAFLRILKETEFKKDRVLGSGAFGTVYKGLWNPDGEN--------------------IRIPVAIKVLREATSPKVNQEVLDEAYVMASVDHPHVCRLLGICLTSAVQLVTQLMPYGCLLDYVRQHQERICGQWLLNWCVQIAKGMNYLEERHLVHRDLAARNVLLKNPNHVKITDFGLSKLLTADEKEYQADGGKVPIKWMALESILQWTYTHQSDVWSYG 899          
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Match: sp|P21860|ERBB3_HUMAN (Receptor tyrosine-protein kinase erbB-3 OS=Homo sapiens OX=9606 GN=ERBB3 PE=1 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.609e-62
Identity = 189/651 (29.03%), Postives = 293/651 (45.01%), Query Frame = 2
Query:  524 SFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGN--VIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVV--SNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGV--KHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKC--------KNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS---NQMNIYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQC--LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTK 2389
            S  R     + Q  C   L    +     N  +    L + C  V+GN  +++TG  N +LSFL  I E+TG++ +  N   ++ L NL+++RG    +Y + KF++ V+   N    + L+ L L +   IL   + +  N  + +  + I W  I+ + +  EIV   N  +          CH  C     K  CWG  S  CQ +   +   C        +G     QCCH+EC GGC GP +T C  C+HFN+ GACV +CP+ LV+N +  +   N   K+ +   CV  CP  + ++   CV  C        KNG      + C PC  G+CPK C  +        Q ++   +    NCT   GN+      I G  G+ W K I  +  + L     ++EI G L  N+ S  P +     F NL  I   +  N+  + L I +N ++  LG + LKE+  G + I  N +LCY  SL    +L      +++I +N     C  E + C  LC    GCWGP    C+ CR++  +   +C+++C+     F N E  +  HE +C  CH +C  +    TC G G+D C   C +++   +C   CP    G            N C+ CH++CT+
Sbjct:   15 SLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTG-HNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQ--VY-DGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHM-DTIDWRDIV-RDRDAEIVVKDNGRSCPP-------CHEVC-----KGRCWGPGSEDCQTLTKTI---CAPQCNGHCFGP-NPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGL-----KMCEPC-GGLCPKAC--EGTGSGSRFQTVDSSNIDGFVNCTKILGNL---DFLITGLNGDPWHK-IPALDPEKLNVFRTVREITGYL--NIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFS-LLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCS-SGGCWGPGPGQCLSCRNY--SRGGVCVTHCN-----FLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCA-QCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQ 619          

HSP 2 Score: 63.1586 bits (152), Expect = 2.216e-8
Identity = 45/206 (21.84%), Postives = 92/206 (44.66%), Query Frame = 2
Query: 3284 ILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPD-ELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            +L  G F  + KG W                     IP+ E + + V IKV+ + S     +     +  I S D    +R++ +   +  +L  Q    GSL++ ++Q+   +    +L W  Q+A G  Y++  G+++ ++   N+ ++SP ++ ++D G++ L    ++     E K  I W   E+ +   ++ +S V +Y 
Sbjct:  714 VLGSGVFGTVHKGVW---------------------IPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYG 898          
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Match: sp|Q5RB22|ERBB3_PONAB (Receptor tyrosine-protein kinase erbB-3 OS=Pongo abelii OX=9601 GN=ERBB3 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.059e-62
Identity = 188/651 (28.88%), Postives = 293/651 (45.01%), Query Frame = 2
Query:  524 SFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGN--VIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVV--SNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGV--KHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKC--------KNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHS---NQMNIYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQC--LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTK 2389
            S  R     + Q  C   L    +     N  +    L + C  V+GN  +++TG  N +LSFL  I E+TG++ +  N   ++ L NL+++RG    +Y + KF++ V+   N    + L+ L L +   IL   + +  N  + +  + I W  I+ + +  EIV   N  +          CH  C     K  CWG+    CQ +   +   C        +G     QCCH+EC GGC GP +T C  C+HFN+ GACV +CP+ LV+N +  +   N   K+ +   CV  CP  + ++   CV  C        KNG      + C PC  G+CPK C  +        Q ++   +    NCT   GN+      I G  G+ W K I  +  + L     ++EI G L  N+ S  P +     F NL  I   +  N+  + L I +N ++  LG + LKE+  G + I  N +LCY  SL    +L      +++I +N     C  E + C  LC    GCWGP    C+ CR++  +   +C+++C+     F N E  +  HE +C  CH +C  +    TC G G+D C   C +++   +C   CP    G            N C+ CH++CT+
Sbjct:   15 SLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTG-HNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQ--VY-DGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHM-DTIDWRDIV-RDRDAEIVVKDNGKSCPP-------CHEVC-----KGRCWGSGPEDCQTLTKTI---CAPQCNGHCFGP-NPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGL-----KMCEPC-GGLCPKAC--EGTGSGSRFQTVDSSNIDGFVNCTKILGNL---DFLITGLNGDPWHK-IPALDPEKLNVFQTVREITGYL--NIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFS-LLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCS-SGGCWGPGPGQCLSCRNY--SRGGVCVTHCN-----FLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCA-QCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQ 619          

HSP 2 Score: 63.1586 bits (152), Expect = 1.825e-8
Identity = 45/206 (21.84%), Postives = 92/206 (44.66%), Query Frame = 2
Query: 3284 ILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPD-ELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            +L  G F  + KG W                     IP+ E + + V IKV+ + S     +     +  I S D    +R++ +   +  +L  Q    GSL++ ++Q+   +    +L W  Q+A G  Y++  G+++ ++   N+ ++SP ++ ++D G++ L    ++     E K  I W   E+ +   ++ +S V +Y 
Sbjct:  714 VLGSGVFGTVHKGVW---------------------IPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYG 898          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A1B1ACY8 (Epidermal growth factor receptor Smed-egfr-6 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 2524.97 bits (6543), Expect = 0.000e+0
Identity = 1265/1266 (99.92%), Postives = 1265/1266 (99.92%), Query Frame = 2
Query:  401 KPNPNHHKEINGNDSLVKINVSNFDRQASEFNLKTNNASSDSFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIESCHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCNSDHDTRPNLRKLKQSIEMIMKNPCSFIILQINRDMSERQITVVNGLHSQIIYHVESSESKLQNEDLITTFNNHLEVPDESLRNPTSHHEDIVNNLILN 4198
            KPNPNHHKEINGNDSLVKINVSNFDRQASEFNLKTNNASSDSFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMSLLKLYSNNSSLKMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIESCHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYIAAVGGSVVSVLAVGIVWKCICMSLNKRKRYDLKLKF NGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCNSDHDTRPNLRKLKQSIEMIMKNPCSFIILQINRDMSERQITVVNGLHSQIIYHVESSESKLQNEDLITTFNNHLEVPDESLRNPTSHHEDIVNNLILN
Sbjct:   18 KPNPNHHKEINGNDSLVKINVSNFDRQASEFNLKTNNASSDSFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMSLLKLYSNNSSLKMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIESCHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYIAAVGGSVVSVLAVGIVWKCICMSLNKRKRYDLKLKFPNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCNSDHDTRPNLRKLKQSIEMIMKNPCSFIILQINRDMSERQITVVNGLHSQIIYHVESSESKLQNEDLITTFNNHLEVPDESLRNPTSHHEDIVNNLILN 1283          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A1B1ACY9 (Receptor protein-tyrosine kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 882.093 bits (2278), Expect = 0.000e+0
Identity = 484/1205 (40.17%), Postives = 701/1205 (58.17%), Query Frame = 2
Query:  539 DSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSS-NFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIESCHRCKSHRRGKECVHNCYEDDYIS-KNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVD--IESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCN-------------------------------------------------SDHDTRPNLRKLKQSIEMIMKNPCSFIILQ 3994
            D    H   C S     D+    N+Y  +  N +KNC+++IG+V+I  ITNEN+SFLNSIE+I+G+L +FSN+VESISL  LK+IRGENP + + +KFSL+V  N    +ML+ ++ P  QVIL+HN+   NNP + Y    I+WNS++ + Q + IVE +       SK   +LSCH SCQ H+ K +CWGNSS  CQ INDC  +TC  S+KC++   LK E+CCHEECVGGC GP  +QCL CK+FNN G CVE CP +  H+G+K+I+N L K  F+  CVDKCP K+F E+  CV +C    TYAVN+TC+PCPNG CPK C  +D++ +  I Y++RK+L RLENCTVY GNI+IN  S+EGD  +   K   GI+ +DL+KL NL+EIYG L I+V   + W  +L + +NL IIRAE   +    G+ I  N  L +LGL+ LKEVRNG + I +N +LC++++LTNKSILH  +     NGK   C  +KC   C  + GCWGP    CVKC+ F I E   C+S CS +PGYFYN  +       CS+CH++CL    TC+G   ++C  GC NYK+ + C +KCP  +Y D   +  C  CH +CT EN  + + TC GP + +G  GC  CN++ + +N S  + +    + L C+ +S+ C  G++K  +DF S   +       +   S   +LE WI+   NH+    ++CLPCHP CS+C  G+   C  CK  R   +C+  C ++ +I+   ++  ES C KCHEEC EGC GST YDC +CK  KIY+N S T+FFCNS CGD  ++F  SE++C     L   + + YI   G + + +  V I+   I  S N+ K++  KL     F   D    S   P+   LL I E Q   + I+  G F I+ KG W    +  +   S  K  + KI  D  + LNV +K+L++ SD ++N++ L++ K++ S D P  LRI+ V + A+ +L  Q    GSL+EF+++N S++  I++L+WA Q+ASG  Y++ +GII+ D+   N+ I+SP ++ I+D GL+K+ +   +  + K G++ I W   E   ++ FSSKS V +Y                                                     D D RP+  +L+++ EM+  NP  ++++Q
Sbjct:   82 DKRYRHGKVCKSTQTQIDV--SKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYN----SMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNSKIDEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKN--CYPCHTNCT-ENSQNKESTCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKV------NAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVTETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGS-TQFFCNSTCGDRIQLFQTSEIICT--DHLIYSRFNMYIYIGGPAGIVISFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ 1268          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A1L8DJK4 (Receptor protein-tyrosine kinase OS=Nyssomyia neivai OX=330878 PE=3 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 1.459e-106
Identity = 332/1240 (26.77%), Postives = 536/1240 (43.23%), Query Frame = 2
Query:  275 LRRYQTISQLSLLVV*QVYRRNIFDMGXXXXXXXXXXXXXXXKPNPNHHKEINGNDSLVKINVSNFDRQASEFNLKTNNASSDSFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGI--TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIY--REVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGD----IGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSL----TNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGA---ICLPCHPLCSQCSDGTIES--CHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSK----TKFFCNSICGDNFRI-------FVNSEMVCVQPQELKPIQNSW-YXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIE-SDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            +R Y  +  L LL V          +G +          R  +P   HH++      L    V   D+Q SEF        ++      S+ DH         Y ++RD+             NCT+V GN+ +T +  T  +LSFL  I E+TG++ +    ++ I L  L+IIRG   +     + +F L V  +      +  L +P  + IL  ++ ++NN  + + +  I W  I+           H   NFTS E    SCH +CQ       CWG     CQ  +           +CF     K  +CCH  C GGC GP    CL C++F + G C ++CP    +N   ++   N   K+ +  TCV  CP+    +N  CV  C      A N  C+PC NG CPK C  + +V + NI           + CTV  G++ I   +  G         + +    +    LE  + LKE+ G   IN+ +       L YFRNLE+I        +   L I +   L  L LQ LK + +G V I+ N  LC+ D +      KS  H+  ++   N  + + E + CS  C  K GCWG     C++CR+++  +   C+++C   PG +  + NH T    C  CH++C +S   C+G GAD CT  CVN +  ++C  KCP+  Y  G T   CK CH++C           CTGP N I   GC+ C+  + + NG +  I R       C+  +  C +GY+                               W+  Q     +  A   IC  CHP C +CS        C  C  ++RG++C   C  D ++ + +      C  CH EC  GC G TE  C QC+  K++ N       + F C + C  ++         + +S  V  Q  + + ++  + ++  V  ++V ++AV  VW+C      K +   + +  +    +  +  S+  P+  KL  I E +  +  IL +G F  +  G W  ++ +                    + + V IKVL++ S    +K+FL +  I+ S D P  LR++ V + +   L  QL  +G L+++++ N   +   ++L W+ Q+A G  Y++   I++ D+   N+ +++   + I+D GL+KL +      K   GK+ I W   E   ++ F+SKS V  + 
Sbjct:    1 MRGYLIVGLLVLLAV--------ESLGALERVQRPEGGKRFDRPRKQHHQQHQLTTDLAP-KVPQDDKQPSEFVKGKICIGTNGRMSVPSNRDHH--------YRNLRDR-----------FTNCTYVDGNLELTWLQDTKLDLSFLQHIREVTGYVLISHVDIQQIVLPRLQIIRGRTLFKLNISDQEFGLFVTYS-----QMHTLEMPALRDILSGSVGIFNNYNLCHMRT-IDWEEIISGPN----ASMHYMYNFTSPERQCASCHPTCQAG-----CWGEGPHNCQQFSKTTCSPQCAQGRCF---GPKPRECCHLFCAGGCTGPTQKDCLACRNFYDDGVCKQECPPMQKYNPTNYLWEPNPDGKYAYGATCVRNCPEHLLKDNGACVRTCPPNKM-AKNGECVPC-NGACPKTCPGQGIVHSGNID--------SFKGCTVIEGSLEILEQTFNGYQHVFANFSFGQRFIRLHPDRLEVFSTLKEVTGY--INIQADHEHFTNLSYFRNLEVIGGRQLMENYFASLYIVKT-SLKSLELQSLKRINSGSVVILENKNLCFADDIEWNKVKKSSDHACVVSANRNKTECELEGQVCSDQCT-KTGCWGAGSNQCLECRNYKYND--TCLASCQSFPGIY--EVNHTT----CGTCHSECKNS---CHGAGADNCT-ECVNVRDGNFCVAKCPESKYSAGGT---CKPCHETCIG---------CTGPQNTINAYGCKTCH--KAIING-DATIER-------CLGRNEACPEGYYS-----------------------------EWVMSQEQGALRLLANKPICRRCHPRCKKCSGYGFHEHVCQECAGYKRGEQCEDECPTDHFVDETTRE----CFACHLEC-RGCNGPTEAHCLQCRNYKLFGNGDPANNGSAFNCTAACPSDYPYQMFDYGPYCSSSNV-YQLSDDEFVKKVFSFVGIVILALVVLIAVAFVWRCCQKQKAKEETVKMTMVLAGCEDSEPLRPSNVGPNLAKLRIIKEAELRHGRILGMGAFGRVFGGYWYPENQS--------------------IKVPVAIKVLTDMSGSESSKEFLDEAYIMASVDHPNLLRLLAVCMSSQMMLITQLMPSGCLLDYVRTNKEKIGSKALLSWSKQIAKGMAYLEERSIVHRDLAARNVLVQNANSVKITDFGLAKLLDVGTDEYKASGGKMPIKWLALECIRNRVFTSKSDVWAFG 1091          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A1L8DJK1 (Receptor protein-tyrosine kinase (Fragment) OS=Nyssomyia neivai OX=330878 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 2.467e-106
Identity = 333/1240 (26.85%), Postives = 535/1240 (43.15%), Query Frame = 2
Query:  275 LRRYQTISQLSLLVV*QVYRRNIFDMGXXXXXXXXXXXXXXXKPNPNHHKEINGNDSLVKINVSNFDRQASEFNLKTNNASSDSFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGI--TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIY--REVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGD----IGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSL----TNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGA---ICLPCHPLCSQCSDGTIES--CHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSK----TKFFCNSICGDN--FRIF------VNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIE-SDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            +R Y  +  L LL V          +G +          R  +P   HH++      L    V   D+Q SEF        ++      S+ DH         Y ++RD+             NCT+V GN+ +T +  T  +LSFL  I E+TG++ +    ++ I L  L+IIRG   +     + +F L V  +      +  L +P  + IL  ++ ++NN  + + +  I W  I+           H   NFTS E    SCH +CQ       CWG     CQ  +           +CF     K  +CCH  C GGC GP    CL C++F + G C ++CP    +N   ++   N   K+ +  TCV  CP+    +N  CV  C      A N  C+PC NG CPK C  + +V + NI           + CTV  G++ I   +  G         + +    +    LE  + LKE+ G   IN+ +       L YFRNLE+I        +   L I +   L  L LQ LK + +G V I+ N  LC+ D +      KS  H+  ++   N  + + E + CS  C  K GCWG     C++CR+++  +   C+++C   PG +  + NH T    C  CH++C +S   C+G GAD CT  CVN +  ++C  KCP+  Y  G T   CK CH++C           CTGP N I   GC+ C+  + + NG +  I R       C+  +  C +GY+                               W+  Q     +  A   IC  CHP C +CS        C  C  ++RG++C   C  D ++ + +      C  CH EC  GC G TE  C QC+  K++ N       + F C + C  +  +++F       +S +  +   E      S ++  V  ++V ++AV  VW+C      K +   + +  +    +  +  S+  P+  KL  I E +  +  IL +G F  +  G W  ++ +                    + + V IKVL++ S    +K+FL +  I+ S D P  LR++ V + +   L  QL  +G L+++++ N   +   ++L W+ Q+A G  Y++   I++ D+   N+ +++   + I+D GL+KL +      K   GK+ I W   E   ++ F+SKS V  + 
Sbjct:    6 MRGYLIVGLLVLLAV--------ESLGALERVQRPEGGKRFDRPRKQHHQQHQLTTDLAP-KVPQDDKQPSEFVKGKICIGTNGRMSVPSNRDHH--------YRNLRDR-----------FTNCTYVDGNLELTWLQDTKLDLSFLQHIREVTGYVLISHVDIQQIVLPRLQIIRGRTLFKLNISDQEFGLFVTYS-----QMHTLEMPALRDILSGSVGIFNNYNLCHMRT-IDWEEIISGPN----ASMHYMYNFTSPERQCASCHPTCQAG-----CWGEGPHNCQQFSKTTCSPQCAQGRCF---GPKPRECCHLFCAGGCTGPTQKDCLACRNFYDDGVCKQECPPMQKYNPTNYLWEPNPDGKYAYGATCVRNCPEHLLKDNGACVRTCPPNKM-AKNGECVPC-NGACPKTCPGQGIVHSGNID--------SFKGCTVIEGSLEILEQTFNGYQHVFANFSFGQRFIRLHPDRLEVFSTLKEVTGY--INIQADHEHFTNLSYFRNLEVIGGRQLMENYFASLYIVKT-SLKSLELQSLKRINSGSVVILENKNLCFADDIEWNKVKKSSDHACVVSANRNKTECELEGQVCSDQCT-KTGCWGAGSNQCLECRNYKYND--TCLASCQSFPGIY--EVNHTT----CGTCHSECKNS---CHGAGADNCT-ECVNVRDGNFCVAKCPESKYSAGGT---CKPCHETCIG---------CTGPQNTINAYGCKTCH--KAIING-DATIER-------CLGRNEACPEGYYS-----------------------------EWVMSQEQGALRLLANKPICRRCHPRCKKCSGYGFHEHVCQECAGYKRGEQCEDECPTDHFVDETTRE----CFACHLEC-RGCNGPTEAHCLQCRNYKLFGNGDPANNGSAFNCTAACPSDYPYQMFDYGPYCSSSNVYQLSDDEFVKKVFS-FVGIVILALVVLIAVAFVWRCCQKQKAKEETVKMTMVLAGCEDSEPLRPSNVGPNLAKLRIIKEAELRHGRILGMGAFGRVFGGYWYPENQS--------------------IKVPVAIKVLTDMSGSESSKEFLDEAYIMASVDHPNLLRLLAVCMSSQMMLITQLMPSGCLLDYVRTNKEKIGSKALLSWSKQIAKGMAYLEERSIVHRDLAARNVLVQNANSVKITDFGLAKLLDVGTDEYKASGGKMPIKWLALECIRNRVFTSKSDVWAFG 1096          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A0U3TFJ4 (Receptor protein-tyrosine kinase OS=Leptinotarsa decemlineata OX=7539 PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 8.229e-106
Identity = 322/1138 (28.30%), Postives = 508/1138 (44.64%), Query Frame = 2
Query:  605 PNNYMKVTANLNK---NCTHVIGNVIITGITNENL--SFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIY--REVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILG--KHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYG-----IQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSIL--HSNQMNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFG-AICLPCHPLCSQCSDGTI--ESCHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNS----SKTKFFCNSICGDNF--RIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLN-------KRKRYDLKLKFSNGFSTVDIESDFAPSS-----TKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            P+N  +   NL +   NCT+V GN+ +T +  +NL  SFL  I E+TG++ +    V+ + L +L+IIRG   +    R+ +F+L+V  +      + YL LP  + +L+ N+  +NN  + + K  I+W  I+   K  F  +       NF S E     CH  C+       CWG+    CQ  +           +CF     K  +CCH  C GGC GP  + C+ C++F + G C ++CP   ++N   +    N   KF +  TCV KCP+    +N  CV  C     +AV+  C+PC  G CPK C     +   NIQ          +NCTV  GNI I   S +G   + +P   +G     +    L   + LKEI G L  N+ +  P  K L YF NLE+I       ++ T + I +   L  L L+ LK +  G V I+ N  LC  + +    I   H N + + NN     C+AR   C + C  K GCWGP    C+ C HF++  K  C+ NCS   G  Y  EN+     +C  CH QC SS   C+GPGA+ CT  C + +  ++C  KC Q+ Y +   + +CK CH +C          +CTGP   +G  GC  C             ++     +  C+H  +NC DGY+   +  H                         I  + + +   G  IC  CHP C +C+       SC +C  +++G++C   C  D Y   N++     C+ C +EC  GCTG    +C  C+  KI+++     + T F C + C  +F  ++F +         ++     S Y       V+ + AV      + +S+        K K  +  +K +   + ++      PS+      KL  I E +     IL  G F  + KG W  +   +                     + V IKVL E +   ++KDFL +  I+ S D P  L+++ V + +   L  QL   G L++F++ N   +   S+L W+ Q+A G  Y++ + +++ D+   N+ +++P  + I+D GL+KL +      K   GK+ I W   E    + F+ KS V  +
Sbjct:   25 PSNRERHYRNLKERYTNCTYVDGNLELTWLQEDNLDLSFLQYIREVTGYVLISHVDVKRVVLPSLQIIRGRTLFKMNVRDEEFALIVTLS-----KMYYLELPALRDVLKGNVGSFNNYNLCHVKT-INWKEIMSDSKGNFSYVY------NFASPERECPPCHKDCE-----HGCWGDGRENCQQFSKEFCSPQCFQGRCF---GPKPRECCHLFCAGGCTGPKQSDCIACQNFYDDGVCTQECPPMQLYNPTTYSWEPNPNGKFAYGATCVKKCPEHLLKDNGACVRTCPPNK-HAVDGECVPC-EGPCPKTCSGDGTIHFGNIQ--------NFKNCTVLEGNIDILENSFKG-FQSVFPNYTFGDRYPAMHPSALSVFSTLKEITGYL--NIQAYHPDFKNLSYFSNLEVIGGRAL-YEYSTSVYIVKT-SLESLDLRSLKRINMGTVAILENKHLCLAEGINWDLIRKSHDNHLMLSNNSDLNSCKARGLVCDEQCS-KDGCWGPGPDQCLSCAHFRLGTK--CLENCSVVSG--YRAENN-----ECKPCHEQCGSS---CHGPGANNCT-SCKHLQDGNFCVSKCSQNKYEE---NGVCKECHANCVD--------SCTGPSEILGEGGCNSCE------------LAIMDDTNYVCLHKKDNCPDGYYYEYVGQH-------------------------IQEETSLKLLAGKGICRKCHPRCKECTGYGFHESSCQKCMQYKKGEQCEDECTPDYYPDVNTNE----CIACDDEC-RGCTGPGPENCVVCQNFKIFIDGNNDDNNTAFVCVASCPADFPHKVFPDDGHASAFCSDVATSSYSVYPKNPYDIVIIIGAVIGGIFLLILSIGFICYYQRKEKIKENAMKMTMALTGLEDNEPLRPSNVMPNIAKLRIIKETEIRRGTILGYGAFGTVYKGVWVLEGETS-------------------AKIPVAIKVLRENTGANNSKDFLDEAYIMASVDHPNLLQLLAVCMSSQMMLVTQLMPLGCLLDFVRTNRDRIGSKSLLNWSTQIARGMAYLEEKRLVHRDLAARNVLVQTPACVKITDFGLAKLLDINEDEYKAAGGKMPIKWLALECIQHRIFTHKSDVWAF 1041          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: erbb2 (erb-b2 receptor tyrosine kinase 2 [Source:NCBI gene;Acc:103042851])

HSP 1 Score: 241.121 bits (614), Expect = 3.088e-64
Identity = 190/642 (29.60%), Postives = 300/642 (46.73%), Query Frame = 2
Query:  611 NYMKVTANLNKNCTHVIGNVIITGITN-ENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAV--------NETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMN--IYNNGKDGK-CEAR--KCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQC--LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGD-------GSTSNICKACHQSCTKENLFSFKRTC-----TGPGNHIGV 2446
            N+ ++   L  +C  V GN+ IT +   ++LSFL  I E+ G++ +   SV  I LKNL+IIRG    +Y    F+L  + N      ++ L       IL   + ++ NP + Y +N I+W  I+G  + + +    ++  + +      SC ++C    G R CWG ++  CQ +    R  C  +S C          CCH +C  GC GP ++ CL C+HFN+ G C + CP  ++++ + +    N  +KF+F  TCV +CP  Y      C   C       +         + C  C +G CPK C    +     +  +N   +   + C   +G++   T S +GD  +    N+  +Q  DLE    L+EI G L I+   +  W   L  F NL++IR      K +  L + Q+  +  LGL+ L+ V  G+V + NNP+LCYT SL   S+L+ +Q    I NN ++ + CEA   +C  LC     CWGP    CV C+ +Q      C+  C+   G     +        C  CH +C  ++ + +C GPGAD C   C+NY+  D C ++CP+   GD        + S  C  C  +C+  N  + +R C     +GPG  I  
Sbjct:   42 NHYEMLRLLYTDCQVVHGNLEITHLQGKQDLSFLEGIVEVQGYVLIAHVSVPVIPLKNLRIIRGSQ--LYNS-SFALAALEN----PQVEQLQFSSLTEILLGEVYIWGNPQLCYPRN-INWKDIVGDSKSIRV---QSAVPYCT------SCPATC----GSRGCWGRAAEDCQTLT---RIPC--ASGCTRCKGPDASDCCHVQCAAGCSGPKDSDCLACRHFNDSGTCRDNCPPPIIYDPLTYQSKPNPNKKFSFGATCVKQCPHNYLAMEVACTLVCPKANQEVITIEPDAQETQKCEKC-DGECPKVCYGLGMGSLQRVMAVNSSNIGLFKGCKKIYGSLAFLTQSFKGDPFS----NLSSLQPDDLEVFRTLEEITGYLYIDAWPQN-W-TDLGVFENLKVIRGRML-YKGVFSLGV-QSLQIESLGLRSLRSVSGGLVLVHNNPQLCYTSSLPWSSLLYPSQEPNLISNNNREPQACEAEGHQCDPLCK-DGACWGPGPSQCVSCKSYQ--RGTECVEQCNIWSGL----QREFIDGSSCIPCHAECRPINGSASCIGPGADDCK-ECLNYQDGDMCVDQCPKSIKGDRHNVWKYSNESGYCLPCPHNCSL-NCLTDERGCPIQQKSGPGTTIAA 639          

HSP 2 Score: 94.7449 bits (234), Expect = 5.392e-19
Identity = 99/421 (23.52%), Postives = 170/421 (40.38%), Query Frame = 2
Query: 2720 CHPLC--SQCSDGTIESCHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECME-----GCTGSTEYDCKQCKRVKIYLNSSKTKFFC-NSICGDNFRIFV-------------NSEMVCVQPQELKPIQN-SWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSST-----KLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPD-ELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            C PLC    C       C  CKS++RG ECV  C     + +   +  S C+ CH EC        C G    DCK+C     Y +       C  SI GD   ++              N  + C+  +   PIQ  S     +  ++  V+   I+   +   L ++KR   K          ++     PS       ++  + E +     +L  G F  + KG W                      PD E V + V IKVL E +    NK+ L +  ++     P+  R++ + + +  +L  QL   G L++++++N   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  + I+D GL++L +          GK+ I W   E+   + F+ +S V +Y 
Sbjct:  497 CDPLCKDGACWGPGPSQCVSCKSYQRGTECVEQCNIWSGLQREFIDGSS-CIPCHAECRPINGSASCIGPGADDCKECLN---YQDGDMCVDQCPKSIKGDRHNVWKYSNESGYCLPCPHNCSLNCLTDERGCPIQQKSGPGTTIAAAMGGVVLFLILLALLIFYLRRQKRMKKKETMRRILQEHELVEPLTPSGAMPNQAQMRILKETELKKLRVLGSGAFGTVYKGIWA---------------------PDGEKVKIPVAIKVLRENTSPKANKEILDEAYVMAGVASPYVCRLLGICLTSTVQLVTQLMPYGCLLDYVRENKDHIGSQYLLNWCVQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILHRRFTHQSDVWSYG 892          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: ENSAMXT00000051131.1 (epidermal growth factor receptor-like [Source:NCBI gene;Acc:103032492])

HSP 1 Score: 236.113 bits (601), Expect = 8.728e-63
Identity = 205/685 (29.93%), Postives = 322/685 (47.01%), Query Frame = 2
Query:  590 DIRDKPNNYMKVTANLNKNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENM----------LKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTC--KLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKH--IKNRLEKFTFHNTCVDKCPDKYFI-ENEKCVPKCKNGATYAVNET----CLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNI--YNNGKDGKCEA--RKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNIT--CYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGST--------SNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCR-KCNYVQLLTNGSEGFISRFTVHSLTCI 2539
            ++  + +++ +    +  NCT V+ N+ IT +  N +LSFL SIEE+ G++ +  N V  I L+NL++IRG + +   E KF+L V++N    N           L+ L L   + IL+  + +  NP +   +  I W+ I+ K     ++    S++ T K   D SC++          CW      CQ +    R  C  + S +C       I  CC+E C  GC GPL T CL C+ F + G C + CPR ++++   H  + N   KF+F  TCV  CP  Y + ++  CV  C +  T+ V E     C  C NG CPK C      +   I  +N   +   +NCT  +G+I I   ++ GD     PK    +    L+    +KEI G L I    +   L +L  F NLE+IR  T  +  ++  ++N    + +LGL+ LKE+ +G V I NNP+LCYT++   + +  S+   I   +N     CE   R C  +C  + GCWGP    C  CRH  ++ +  C+ +C+   G       + ++ M C +C  +C + N T  C+GPGADQC   C ++K    C  +C     G  +         +  C+ CH +CT          CTGP    G+  C  + + V ++ +G  G +  F V    CI
Sbjct:   35 NLLSQADDHYRALMKMYSNCTVVLENLEITHVGENYDLSFLRSIEEVGGYVLIAINDVNVIPLENLRLIRGHSLY---EGKFALAVMANYHTANSSSAESSIPTGLRELPLRNLREILRGGVRIARNPRLCNIET-IKWHDIVSKESTNAVIT-SESTDSTCKPC-DKSCYNGS--------CWAPGPENCQKL---TRLICAEQCSHRC---KGPAIADCCNEHCAAGCTGPLATDCLACREFKDDGMCKDACPRLMLYDPNLHQLVVNPNGKFSFGATCVKNCPHNYVVTDHGACVRTCGD-KTHEVEENGIRKCKNC-NGPCPKVCNGLGNGELAGIMTVNASNIDTFQNCTKINGDISIFATTLRGDPYTKTPK----LDPAKLDYFKTVKEITGFLLIQAWPEN--LTSLSPFENLEVIRGRTQQHGRVSFAALNIA-HIEYLGLRSLKEISDGDVVIKNNPRLCYTNANYWRKLFRSDTQTIKTRDNLAPEACEVQNRMCDGMCT-EEGCWGPGPSMCFSCRH--VSRQGQCVDSCNILEGM---PREYISNNM-CLECDQECRTLNGTPSCHGPGADQCV-ECAHFKDGSNCVSQCANGVPGMNNRLIWTFVDKNRQCQPCHPNCT--------HGCTGP----GLKSCETQSSQVSMVASGVVGGL-LFVVIVFLCI 669          

HSP 2 Score: 85.5001 bits (210), Expect = 3.290e-16
Identity = 58/227 (25.55%), Postives = 106/227 (46.70%), Query Frame = 2
Query: 3218 SDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPD-ELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            S  AP+   L  + E +     +L  G F  + KG W                     IP+ E V + V IKVL E +    NK+ L +  ++ S D P   R++ + + +  +L  QL   G L++++++N   +   ++L W  Q+A G  Y++   +++ D+   N+ +++P  + I+D GL+KL N   +      GK+ I W   E+     ++ +S V +Y
Sbjct:  700 SGAAPNQALLRILKETEFKKVKVLGSGAFGTVYKGLW---------------------IPEGEDVKIPVAIKVLREVTSPKANKEILDEAYVMASVDHPHICRLLGICLTSTVQLITQLMPFGCLLDYIRENQDNIGSQNLLNWCVQIAKGMNYLEEHRLVHRDLAARNVLVKTPNHVKITDFGLAKLLNANEKEYHSDGGKVPIKWMALESILHWTYTHQSDVWSY 905          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: ENSAMXT00000047506.1 (epidermal growth factor receptor-like [Source:NCBI gene;Acc:103032492])

HSP 1 Score: 235.728 bits (600), Expect = 9.738e-63
Identity = 205/685 (29.93%), Postives = 322/685 (47.01%), Query Frame = 2
Query:  590 DIRDKPNNYMKVTANLNKNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENM----------LKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTC--KLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKH--IKNRLEKFTFHNTCVDKCPDKYFI-ENEKCVPKCKNGATYAVNET----CLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNI--YNNGKDGKCEA--RKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNIT--CYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGST--------SNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCR-KCNYVQLLTNGSEGFISRFTVHSLTCI 2539
            ++  + +++ +    +  NCT V+ N+ IT +  N +LSFL SIEE+ G++ +  N V  I L+NL++IRG + +   E KF+L V++N    N           L+ L L   + IL+  + +  NP +   +  I W+ I+ K     ++    S++ T K   D SC++          CW      CQ +    R  C  + S +C       I  CC+E C  GC GPL T CL C+ F + G C + CPR ++++   H  + N   KF+F  TCV  CP  Y + ++  CV  C +  T+ V E     C  C NG CPK C      +   I  +N   +   +NCT  +G+I I   ++ GD     PK    +    L+    +KEI G L I    +   L +L  F NLE+IR  T  +  ++  ++N    + +LGL+ LKE+ +G V I NNP+LCYT++   + +  S+   I   +N     CE   R C  +C  + GCWGP    C  CRH  ++ +  C+ +C+   G       + ++ M C +C  +C + N T  C+GPGADQC   C ++K    C  +C     G  +         +  C+ CH +CT          CTGP    G+  C  + + V ++ +G  G +  F V    CI
Sbjct:   25 NLLSQADDHYRALMKMYSNCTVVLENLEITHVGENYDLSFLRSIEEVGGYVLIAINDVNVIPLENLRLIRGHSLY---EGKFALAVMANYHTANSSSAESSIPTGLRELPLRNLREILRGGVRIARNPRLCNIET-IKWHDIVSKESTNAVIT-SESTDSTCKPC-DKSCYNGS--------CWAPGPENCQKL---TRLICAEQCSHRC---KGPAIADCCNEHCAAGCTGPLATDCLACREFKDDGMCKDACPRLMLYDPNLHQLVVNPNGKFSFGATCVKNCPHNYVVTDHGACVRTCGD-KTHEVEENGIRKCKNC-NGPCPKVCNGLGNGELAGIMTVNASNIDTFQNCTKINGDISIFATTLRGDPYTKTPK----LDPAKLDYFKTVKEITGFLLIQAWPEN--LTSLSPFENLEVIRGRTQQHGRVSFAALNIA-HIEYLGLRSLKEISDGDVVIKNNPRLCYTNANYWRKLFRSDTQTIKTRDNLAPEACEVQNRMCDGMCT-EEGCWGPGPSMCFSCRH--VSRQGQCVDSCNILEGM---PREYISNNM-CLECDQECRTLNGTPSCHGPGADQCV-ECAHFKDGSNCVSQCANGVPGMNNRLIWTFVDKNRQCQPCHPNCT--------HGCTGP----GLKSCETQSSQVSMVASGVVGGL-LFVVIVFLCI 659          

HSP 2 Score: 85.8853 bits (211), Expect = 2.563e-16
Identity = 58/227 (25.55%), Postives = 106/227 (46.70%), Query Frame = 2
Query: 3218 SDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPD-ELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
            S  AP+   L  + E +     +L  G F  + KG W                     IP+ E V + V IKVL E +    NK+ L +  ++ S D P   R++ + + +  +L  QL   G L++++++N   +   ++L W  Q+A G  Y++   +++ D+   N+ +++P  + I+D GL+KL N   +      GK+ I W   E+     ++ +S V +Y
Sbjct:  690 SGAAPNQALLRILKETEFKKVKVLGSGAFGTVYKGLW---------------------IPEGEDVKIPVAIKVLREVTSPKANKEILDEAYVMASVDHPHICRLLGICLTSTVQLITQLMPFGCLLDYIRENQDNIGSQNLLNWCVQIAKGMNYLEEHRLVHRDLAARNVLVKTPNHVKITDFGLAKLLNANEKEYHSDGGKVPIKWMALESILHWTYTHQSDVWSY 895          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: egfra (epidermal growth factor receptor-like [Source:NCBI gene;Acc:103031629])

HSP 1 Score: 233.802 bits (595), Expect = 4.949e-62
Identity = 197/657 (29.98%), Postives = 296/657 (45.05%), Query Frame = 2
Query:  644 NCTHVIGNVIITGITNE-NLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTC--KLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKH--IKNRLEKFTFHNTCVDKCPDKYFI-ENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQND-DLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQ--MNIYNNGKDGKCEA--RKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQC--LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGST--------SNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRK---CNYVQLLTNGSEGFISRFTVHSL 2530
            NCT ++ N+ IT  ++E +LSFL SIEE+ G++ +  N    I L NL+IIRG    +Y     +L V+SN      L+ L L     IL+  +   +NP +   +  I W  I+      + V+  ++++   K      CHS C        CW      CQ      + TC  + S +C      K   CC+  C  GC GP  T CL C+ F +   C + CP  +++N   H    N   K+ F  TCV  CP  Y + ++  CV  C  G TY V+E     C  C  G+CPK C    V     +  +N   +   ENCT  +G+++I   ++ GD     PK    +    L     +KEI GSL +    K   + +L  F NLE+IR  T   KH   +S+      +  LGL+ L+E+ +G V I  N KLCY      K +  S         N     C A  + C ++C P+ GCWGP    C  C+H+  + K  C++ C+   G     E +    M C +C  +C  L+ ++TC  PG D C   C +++   +C  +CPQ   G+  T          +C+ CHQ+CT+         CTGP     +  CR+    + + ++  G  G I  F + SL
Sbjct:   61 NCTVILENLEITYTSHEHDLSFLKSIEEVGGYVLIGLNKAPRIPLDNLRIIRGHT--LYD--GLALAVLSNYNNSKGLRELPLISLTEILKGGVKFAHNPYLCNVET-IQWADIMSSKDSSQFVKFESTTSKDCK-----MCHSDCY----NGSCWAPGRANCQTF---TKLTCAEQCSGRC---KGPKPSDCCNMHCASGCTGPRPTDCLACRDFQDDNTCKDACPPLMLYNPNTHQLAPNPDGKYNFGATCVKNCPHNYVVTDHGACVRSCSPG-TYEVDEDGVRKCKKC-EGLCPKVCSGLGVGNLVGVMSINSSNIDSFENCTTINGDVLILKTTLNGDTFTKTPK----MDPAKLNVFRTVKEITGSLLVQYWPKN--MPSLSPFENLEVIRGRT---KHQGTVSLGIGKLPITHLGLRALREISDGDVSISANAKLCYNSPEHWKRLFRSEDQVARPMQNADPATCAALNQTCDEMCTPE-GCWGPGPTMCFSCKHY--SRKKSCVAFCNLLEGEHRECEVN----MTCLECDPECRPLNGSLTCSKPGPDGCV-ECAHFRDGPHCVARCPQGIPGEKDTLVWKYPDSMRVCQLCHQNCTQ--------GCTGP----ELKDCREYKPFSGMSVIAAGVVGGILAFVILSL 666          

HSP 2 Score: 105.145 bits (261), Expect = 2.915e-22
Identity = 94/418 (22.49%), Postives = 160/418 (38.28%), Query Frame = 2
Query: 2684 NHEYQFGAICLPCHPLCSQ------CSDGTIESCHRCKSHRRGKECVHNCY-----EDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGD--NFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            + E +    CL C P C        CS    + C  C   R G  CV  C      E D +     ++  +C  CH+ C +GCTG    DC++      Y   S        + G    F I      V V+ + +K                                  RKR   +L            S  AP+ + L  + E +     +L  G F  + KG W  +                     E V + V IKVL E +    NK+ L +  ++ S + P   R++ + + +  +L  QL   G L++++K+N   +    +L W  Q+A G  Y++   +++ D+   N+ +++P  + I+D GL+KL +   +      GK+ I W   E+   + ++ +S V +Y 
Sbjct:  548 HRECEVNMTCLECDPECRPLNGSLTCSKPGPDGCVECAHFRDGPHCVARCPQGIPGEKDTLVWKYPDSMRVCQLCHQNCTQGCTGPELKDCRE------YKPFSGMSVIAAGVVGGILAFVILSLGVAVLVRRRHIK----------------------------------RKRTLRRLLQERELVEPLTPSGEAPNQSLLRILKETEFKKIKVLGSGAFGTVYKGLWVPEG--------------------EDVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPHVCRLLGICLTSTVQLVSQLMPYGCLLDYVKENKDNIGSQHLLNWCVQIAKGMNYLEDRHLVHRDLAARNVLVKTPQHVKITDFGLAKLLSADEKEYHADGGKVPIKWMALESILHRTYTHQSDVWSYG 905          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: erbb4b (erb-b2 receptor tyrosine kinase 4b [Source:ZFIN;Acc:ZDB-GENE-030918-5])

HSP 1 Score: 233.032 bits (593), Expect = 1.165e-61
Identity = 184/619 (29.73%), Postives = 279/619 (45.07%), Query Frame = 2
Query:  641 KNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCV-RKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGV--KHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVN---ETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH-SNQMNIYNNGKDGK---CEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN---ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTKENLFSFKRTCTGP 2428
            +NC  V+GN+ IT I  + +LSFL SI E+TG++ +  N  + + L+NL+IIRG   +   E +++L +  N    G   L+ L L     IL   + V  N   L   + IHW  I+   +   +V P NSS+   +      CH +C    G+  CWG    QCQ +   V  + C    +CF      +  CCH EC GGC GP +T C  C +FN+ GACV +CP+  V+N    +   N   K+T+   CV KCP  + +++  CV  C +          + C+PC + +CPK C           Q ++   + +  NCT  +GN++     I+GD+ +    NI  +  + L     ++EI G             +++L F    I             L + +   +  L LQ ++E+  G V I NN +LCY +++   S+     Q  +  N +D K    E   C  LC    GCWGP    C+ CR F  +    C+ +C+   G      N       C +C  QC  ++   +TC GPG D C   C+++K    C EKCP    G  S        +N C  CH +CT+         CTGP
Sbjct:   23 ENCEVVMGNLEITSIDRSRDLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGTRLY---EDRYALAIFLNYRRDGNFGLRQLGLKNLTEILHGGVYVDQN-KFLCHADTIHWQDIVKNARSDHLVVPSNSSSSCQR------CHRACN---GR--CWGPKENQCQSLTKTVCAEQC--DGRCF---GPYVSDCCHRECAGGCSGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPRAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENKIKMCIPCTD-ICPKACDGIGTASLQTAQTVDSSNIDKFINCTKINGNLVFLITGIKGDVYH----NIEALDPEKLNVFRTVREITGK-----------TRSILTFSGRGI------------SLLVLKQQWITSLQLQSMREISAGNVYITNNSQLCYYNTINWTSLFRIPTQKALIRNNRDPKECIMEKMICDPLCS-DGGCWGPGPDQCLSCRFF--SRGRTCVESCNLHQGDVREFANGSV----CLECDAQCQKADDDGLTCTGPGPDHCV-KCLHFKDGPNCVEKCPDGLQGTNSFIFKYAEANNECHPCHANCTQ--------GCTGP 577          

HSP 2 Score: 100.908 bits (250), Expect = 6.822e-21
Identity = 92/415 (22.17%), Postives = 161/415 (38.80%), Query Frame = 2
Query: 2687 HEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYEDDYISKNS-----SNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
             E+  G++CL C   C +  D  +       + C +C   + G  CV  C  D     NS     + A + C  CH  C +GCTG    DC             +T      + G  F + + +  V V  +                            K I      +K+  L+             S  AP+  +L  + E +     IL  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S + P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  I I+D GL++L +   +      GK+ I W   E  + + F+ +S V +Y
Sbjct:  493 REFANGSVCLECDAQCQKADDDGLTCTGPGPDHCVKCLHFKDGPNCVEKC-PDGLQGTNSFIFKYAEANNECHPCHANCTQGCTGPRLQDCIGM--------IDRTPLIAAGVIGGLFVVVIIALGVAVSVRR---------------------------KSI------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKILGAGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNEATGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSY 845          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010487.1 (pep scaffold:Pmarinus_7.0:GL501102:818:30108:-1 gene:ENSPMAG00000009497.1 transcript:ENSPMAT00000010487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 198.749 bits (504), Expect = 1.503e-53
Identity = 171/617 (27.71%), Postives = 270/617 (43.76%), Query Frame = 2
Query:  635 LNKNCTHVIGNVIITGIT-NENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNI---IGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIK--NRLEKFTFHNTCVDKCPDKYFIENEKCVPKC--------KNGATY--AVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKC----EARKCSKLCHP---KYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN--ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDH--------YGDGSTSNICKACHQSCT 2386
            L + C  V+GN+ IT ++  ++LSFL  + E+ G++ +  N  E + L++L+I+RG    +Y + KF+L +V N    +G   L+ L+L     IL   + + +NP  L   + I W  IL +    + V P+   +  S       C   C        CW   +  CQ +    R  C        YG     QCCH+ C  GC GP +T CL CK FN+ G CV  CP   ++N   +++  N   K++    CV +CP  + I+   C   C        +NG     A +E    CP  VC       ++    ++  LN   +     CT  +GN++     ++ D+             + ++   +++EI G L I   +  P +  L  F NLEI+R     +   + L +     L  LGL+ L EV  G V   N P+LCY  ++    +L S +      G           R  S+ CHP     GCWGP    C++C+ F+      C+ +C++  G      N       C+ CH++CL +N  ++C GP +D CT  C ++K   YC +KCP           +      N C  CH +CT
Sbjct:   50 LYQGCEVVLGNLEITHLSRGDDLSFLKDVREVMGYVLVALNDFEELPLESLRIVRGMK--LYDD-KFALAIVDNGQRGLGTG-LRALLLRSLTEILSGGVNITDNP-FLCHADTIKWEDILEQKNLNQSVLPYGRPDCESPA-SRPPCPQGCS------HCWSADTNYCQKLT---RTICAKECTLRCYGT-NTNQCCHKHCASGCTGPRDTDCLACKTFNDTGVCVMHCPPTHIYNRDTYLQEPNPDVKYSHGAICVKRCPQNFLIDENSCARSCPHEKMEVEENGVKMCKACSEK-QGCPKVVC-HGIGSGNLKDAKSVSSLN---VDTFSECTTINGNLVFLESGLDSDL---------LAHPEKMKVFRSVREITGYLHIE--AWLPNMTDLSVFENLEIVRGRNIRSVGYSVL-VRNLPHLEVLGLRALSEVTEGSVLAQNVPRLCYVLTVNWTRLLRSPRQKADLEGVPSSSVCVFACRAGSEACHPLCSSDGCWGPGPEQCMQCKLFK--RGRTCVESCNQNDGEVREFINGTL----CTPCHSECLPTNGTLSCKGPTSDMCTR-CRHFKDGPYCVDKCPLGQNTEHGALIFKFPDAHNACMPCHANCT 626          

HSP 2 Score: 49.6766 bits (117), Expect = 4.829e-6
Identity = 30/82 (36.59%), Postives = 41/82 (50.00%), Query Frame = 2
Query: 2720 CHPLCSQ--CSDGTIESCHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECME-----GCTGSTEYDCKQCKRVK 2944
            CHPLCS   C     E C +CK  +RG+ CV +C ++D   +   N  +LC  CH EC+       C G T   C +C+  K
Sbjct:  507 CHPLCSSDGCWGPGPEQCMQCKLFKRGRTCVESCNQNDGEVREFING-TLCTPCHSECLPTNGTLSCKGPTSDMCTRCRHFK 587          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003172.1 (pep scaffold:Pmarinus_7.0:GL476855:1052:76454:1 gene:ENSPMAG00000002842.1 transcript:ENSPMAT00000003172.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.815 bits (486), Expect = 4.134e-50
Identity = 153/520 (29.42%), Postives = 231/520 (44.42%), Query Frame = 2
Query:  905 ILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIK--NRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVN------ETCLPCPNGVCPKDCLIKDVVQNYNI---QYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLT-GLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMN--IYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN--ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDG--------STSNICKACHQSCT 2386
            IL   + +  N  + Y  N + W  I+ +   + I +  NS+  TS       CH  C  H     CWGN    CQ    C + TC        +G    E CCH +C  GC GP +T C  CK+FN+ G+CV  CP   ++N V   +  N   K+++   CV +CP  + ++   CV  C  G            ETC      VCPK C   D +   N+   Q ++   +   ENCT  +GNI   T  I+GD     P     +    L    ++KEI G L I    +   +     F NL  IR     +   T  L + +  ++  LGL  L+EV  G V + NN +LCY +++   ++  S Q    +++N  +  C A    C  LC  ++GCWGP    C+ CR F+      C+ +C    G +  +E+ Q  +  C+ C  +CL  N  +TC+GPG++ C   C +YK   +C   CP    G+           +N C+ CH +C+
Sbjct:    4 ILHGGVYIKENKHLCY-HNTVDWWDIVKEGSIVNI-DMDNSTTCTS-------CHKGCHKH-----CWGNGMKYCQ---KCTKLTCARQCDGRCHGPTPSE-CCHSQCAAGCDGPRDTHCFACKNFNDSGSCVSHCPPPTIYNPVTFAQGENPDVKYSYGAICVKECPHNFVVDYNSCVRACPAGKHEVEKFGKKKCETC----TDVCPKAC---DGIGTGNLSRSQTVDATNIDTFENCTKINGNIAFLTTGIKGDDYMKIPP----LDPDKLNVFRSIKEITGHLMIQAWPEN--MTDFAVFENLTTIRGRVLQSVGRTFSLLVARIPNITALGLASLQEVSAGNVYLKNNERLCYYNTIKWPAVFVSEQQTSYVHDNKPEADCNADGAVCDLLCS-EHGCWGPGPDQCISCRFFR--RARSCVESCYITEGPY--REHMQ--DAVCAPCDPECLPVNDSVTCFGPGSNSCVR-CAHYKDGPHCVSACPVGAQGENDEIISKYPDKNNTCQPCHPNCS 484          

HSP 2 Score: 107.071 bits (266), Expect = 1.379e-23
Identity = 94/424 (22.17%), Postives = 162/424 (38.21%), Query Frame = 2
Query: 2666 WIDRQANHEYQFGAICLPCHPLCSQCSDGTI------ESCHRCKSHRRGKECVHNCY-----EDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFR--IFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            +I      E+   A+C PC P C   +D          SC RC  ++ G  CV  C      E+D I     +  + C  CH  C  GC G    DC     +   L  + +        G  F   + +   +VCV+ + +                                   RKR  ++             S  AP+  +L  + E +     +L  G F  + KG WT +  +                    V + V IKVL E +    NK+ L +  I+ S   P  +R++ + +    +L  QL   G L+E+ +++   +    +L WA Q+A G  Y++ + +++ D+   N+ + +P  + I+D GL++L +          GK+ I W   E+   + F+ +S V +Y 
Sbjct:  399 YITEGPYREHMQDAVCAPCDPECLPVNDSVTCFGPGSNSCVRCAHYKDGPHCVSACPVGAQGENDEIISKYPDKNNTCQPCHPNCSHGCKGGGLLDC----HLIGPLFRTGSPVLAVMAVGGLFACVMLLLLAVVCVRRRNIA----------------------------------RKRA-MRRYIEKELVEPLTPSGAAPNQAQLRILKETELRKGKMLGSGAFGTVHKGIWTPEGED--------------------VKIPVAIKVLREATSPKANKEILDEAYIMASVSHPHLVRLLGICLTPSVQLVTQLMPLGCLLEYTREHKEHIGSQLLLNWAVQIAKGMMYLEEQRLVHRDLAARNVLVRTPQHVKITDFGLARLLDINEIEYHADGGKMPIKWLALESIQYRTFTHQSDVWSYG 763          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 174.866 bits (442), Expect = 1.456e-44
Identity = 160/611 (26.19%), Postives = 266/611 (43.54%), Query Frame = 2
Query:  632 NLNKNCTHVIGNVIITGITN-ENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENM--LKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCV-RKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEK--FTFHNTCVDKCPDKYF-IENEKCVPKCKNGATYAVNET----CLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKL--TNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSIL--HSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSN--ITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS--------TSNICKACHQSCTK 2389
            ++  NC  V+GN+ IT I N  +LSFL +I E++G++ +  N V+ + L+NL+++RG   +  R     L+  ++ + E    LK L L +   IL+  + V   PG+        W+ I  ++       P  + +F+S  +    CH SC     K FCWG+    CQ     +  K C    +C  YG L   QCCH+ C  GC GP  T C     + ++ +  +     L  +   +  +   +         V   P   F ++   CV  C    T   + +    C PCP+ +CPK C      +    Q ++ K +    NCT   GN+I         + NG+  N +   G  ++     +L+++ GSL +N      W + L +  +L++ +        L  L ++++  L+F+ ++    V++  V    +P  C+  +L   S+    SN  +     + GK E   C  LC  + GCWGP  M C+ C+  +      C+ +CS   G     E        C  CH +C+  N  +TC+GPG D CT  C NY+   +C   CP+   G+             +C  CH +CT+
Sbjct:   23 SMYTNCEVVMGNLEITYIRNGSDLSFLRTIREVSGYVLIALNEVDHVPLENLRVVRGTRLYDQRYALTVLLNYNDSVPEERLGLKELRLTRLTEILRGGVYVRKEPGL------PSWDDIRNRNSKENFFLPVVACDFSSVSLSGQPCHPSC-----KNFCWGSGPQYCQTFTSTICAKQC--DGRC--YG-LDPNQCCHKHCASGCTGPRETDCFPASSWRSRASIQDNVLCGLFFSVTIYQFDNPPRGNLALRQALVADFPAGNFVVDYNSCVRSCPVNKTEVEDGSGVKHCKPCPDNLCPKVCDGIGSGKLKEAQTVDAKNIHFFSNCTTISGNLIF--------LRNGFDGNCHFQNGIHVKPRCCQSLQQLTGSLLLN-HYPVRW-QVLPFLLHLDLSKPSRKQFWRLHVLLVHKS--LLFMLMRYCTYVKSFQVTATVHPIFCFVSTLFGSSLYSTKSNGRHCCACDRPGK-EGYVCDALCSAE-GCWGPGPMQCLSCKFHK--RGKTCVESCSVLDG----DEREFVSGALCIACHAECMLINGSLTCHGPGPDNCT-RCRNYREGPHCVGFCPEGVPGESGELIYKYPDEDGVCHPCHYNCTQ 596          

HSP 2 Score: 67.0106 bits (162), Expect = 3.215e-11
Identity = 50/227 (22.03%), Postives = 99/227 (43.61%), Query Frame = 2
Query: 3218 SDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            S   P+  +L  + E +     +L  G F  + KG W  +                     E V + V +KVL + +    NKD L +  ++ S D P  +R++ + + + ++L  QL   G L+E+++++   V    IL W  Q+A     I+   ++  D+    + + +P RI ++ + L +   + +  K   +  + I W   E+   + F+ +S V +Y 
Sbjct:  669 SGAQPNQAQLRILKETELKKGKVLGSGAFGTVYKGIWVPEG--------------------ESVKIAVAVKVLRDSASSKANKDILDEAYLMASVDHPHLVRLLGICMSSTTQLVTQLMPHGCLLEYVREHRGRVGSQLILNWCVQIAKNASEIQALQMVCDDLVRLVMSLRTPPRITLASANLFQ---SIDDAKHWHDRDMPIKWMALESIQYRKFTHQSDVWSYG 872          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002120.1 (pep scaffold:Pmarinus_7.0:GL478472:36400:43944:-1 gene:ENSPMAG00000001922.1 transcript:ENSPMAT00000002120.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 4.192e-24
Identity = 93/344 (27.03%), Postives = 148/344 (43.02%), Query Frame = 2
Query: 1409 YFIENEKCVPKCKNGATYAVNET----CLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPK-NIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSL--TNKSILHSNQMNIYNNGKDGKCEA--RKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCL--SSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTS--------NICKACHQSC 2383
            + +++  CV  C        N +    C  C +  CP  C           Q +N   +   +NCT   GN++I    I GD     P   I  +  + L     ++EI G    N+      L  L  F NL +++     +       I+  +++  L L+ L+E+  G + I  N KLC+ +S+  T  +   S  + I +N K+ +C    ++C  LC    GCWGP    C+ C+HFQ      C+  C+      + +    T    C  C+ +CL  ++N+TC GPG++ C+  C N+K    C  KCP    G+ +T         NIC  CH SC
Sbjct:    2 FVVDSNSCVRSCSANKMEVENSSGVKHCTACGD-TCPTVCDGIGSGSLKESQTINSANIHLFQNCTKIRGNLVIQKPGINGD-----PYLRIERMNPEHLNYFRTVQEITGYF--NIEGWPEELPDLGVFENLRVVQGRELRSSKEYSFLISNLNNITSLNLKSLQEISKGNILIQQNKKLCFYNSVNWTRLTGSTSTLIKIVDNNKNCECYCLNKQCDVLCSTD-GCWGPGPSQCLACKHFQ--RNRTCVEACN----LMHGEVREFTDGNMCKACNPECLPVNNNLTCNGPGSENCS-ACRNFKEGPLCVSKCPSGIQGENNTVIYKYPNAFNICMPCHTSC 329          

HSP 2 Score: 63.1586 bits (152), Expect = 1.563e-10
Identity = 69/289 (23.88%), Postives = 124/289 (42.91%), Query Frame = 2
Query:  635 LNKNCTHVIGNVII--TGITN-----------ENLSFLNSIEEITGFLFLFSNSVESISL---KNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGK-HQFLEIVEPH-NSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELK------IEQCCHEECVG-----GCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTF----HNTCVDKCP 1402
            L +NCT + GN++I   GI             E+L++  +++EITG+  +     E   L   +NL++++G      +E  F   ++SN+   N +  L L   Q I + NIL+  N  + ++ N+++W  + G     ++IV+ + N   +   +  D+ C +          CWG    QC       R    + +   ++GE++      + + C+ EC+       C GP +  C  C++F     CV KCP  +       I      F      H +C+  CP
Sbjct:   61 LFQNCTKIRGNLVIQKPGINGDPYLRIERMNPEHLNYFRTVQEITGYFNIEGWPEELPDLGVFENLRVVQGRELRSSKEYSF---LISNL---NNITSLNLKSLQEISKGNILIQQNKKLCFY-NSVNWTRLTGSTSTLIKIVDNNKNCECYCLNKQCDVLCSTD--------GCWGPGPSQCLACKHFQRNRTCVEACNLMHGEVREFTDGNMCKACNPECLPVNNNLTCNGPGSENCSACRNFKEGPLCVSKCPSGIQGENNTVIYKYPNAFNICMPCHTSCIHSCP 334          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008321.1 (pep scaffold:Pmarinus_7.0:GL483972:456:13241:-1 gene:ENSPMAG00000007528.1 transcript:ENSPMAT00000008321.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 7.337e-23
Identity = 83/302 (27.48%), Postives = 130/302 (43.05%), Query Frame = 2
Query: 1271 CKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIK--DVVQNYNI---QYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMN--IYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNC 2143
            CK+FN+ GACV  CP  +++N V     +N   K+++   CV +CP  + ++   CV  C  G      +    C +  C + C  K  D +   N+   Q ++   +   ENCT  +GNI      I+GD     P     ++ + L    ++KE+ G L I    +   +     F NL  IR           L + +   +  LGL  L E+  G V +  N +LCY +++   S+  S +    I++N     C  E   C  LC    GCWGP    C+ CR F  +    C+  C
Sbjct:    2 CKNFNDSGACVSHCPPPMIYNPVSFQLEENPDVKYSYGAICVKECPHNFVVDYNSCVRACPAGKHEVEKQGKKKCES--CTRICPTKACDGIGTGNLSHAQTVDASNIDTFENCTKINGNIAFLVTGIKGDSYMKIPP----LEPEKLNVFRSVKEVTGYLMIQAWPQN--MTDFGVFENLTTIRGRVLQRGF--SLLVARIPTVTALGLASLHEISAGNVYLKQNERLCYYNTINWTSVFMSERQTPFIHDNKPPPNCTSEGMLCDPLCS-NDGCWGPGPDQCISCRFF--SRGRACVEAC 290          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Match: EDO31298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYB5])

HSP 1 Score: 53.9138 bits (128), Expect = 1.526e-7
Identity = 46/179 (25.70%), Postives = 84/179 (46.93%), Query Frame = 2
Query: 3410 GLNVTIKVLSECSDLADNK--DFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSK-LSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCN----SDHDTRP 3925
            G  + + V S  SD  +N   + L + +++   D P+ +RII +       L  +L   G L ++LK+N  +   ++IL+   QVA G  Y++    ++ D+   N+ + +   + ISD G+S+ +    +  K    G+  + W   E    + FSSKS V +Y       + +  RP
Sbjct:   50 GERIPVAVKSLKSDDINNPKSEILHEARVMMELDHPYIVRIIGMCQGPSMMLVMELAGEGPLNKYLKKNKGM-PLLNILVLMLQVAEGMQYLESLQFVHRDLAARNVLVVNDSFVKISDFGMSRAMGAGSDYYKAGTAGRWPLKWYAPECIYFRKFSSKSDVWSYGITLWEATSYGARP 227          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Match: EDO40994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K8])

HSP 1 Score: 53.5286 bits (127), Expect = 4.222e-7
Identity = 54/210 (25.71%), Postives = 89/210 (42.38%), Query Frame = 2
Query: 3278 EHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITST-DPPWNLRIILVVVCAYSELS--KQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
            E ++  G+F  + KGT  +   NT              IP       V IK L + S   +  DFL +  ++    DP  N+  +  VV     L    +  + GSL  FLK+  S +  I ++  A  +ASG  Y+     ++ D+   NI +   L   ++D GLS+     +   +   GK+ + W+  E    + FS+ S V +Y 
Sbjct:   61 EKVIGGGEFGDVYKGTLKRPGENT--------------IP-------VAIKTLKQGSTSKNRGDFLSEASVMGQFCDP--NVIFLEGVVSKTHPLMIVTEFMSNGSLDNFLKKMDSKLSLIQLMGMARGIASGMKYLSEMNFVHRDLAARNILVTETLVCKVADFGLSR--ELEDSAYETSGGKIPVRWTAPEAIKYRKFSTSSDVWSYG 245          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Match: EDO33731 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD2])

HSP 1 Score: 51.9878 bits (123), Expect = 6.395e-7
Identity = 43/167 (25.75%), Postives = 75/167 (44.91%), Query Frame = 2
Query: 3419 VTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELS--KQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSK-LSNTCNRMK---KIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNC 3901
            V +K+L   S   + +DF  +  I+   D P N+  +  V+     +    +    GSL  FLK N   +  + ++     VA+G  Y+     I+ D+   NI +   L   +SD GLS+ L ++    +   + + GK+ + W+  E    + FSS S V +Y  
Sbjct:   59 VAVKILKPGSSHKNREDFCVEASIMGQFDHP-NVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGI 224          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Match: EDO33732 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD3])

HSP 1 Score: 51.9878 bits (123), Expect = 6.756e-7
Identity = 43/167 (25.75%), Postives = 75/167 (44.91%), Query Frame = 2
Query: 3419 VTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELS--KQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSK-LSNTCNRMK---KIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNC 3901
            V +K+L   S   + +DF  +  I+   D P N+  +  V+     +    +    GSL  FLK N   +  + ++     VA+G  Y+     I+ D+   NI +   L   +SD GLS+ L ++    +   + + GK+ + W+  E    + FSS S V +Y  
Sbjct:   57 VAVKILKPGSSHKNREDFCVEASIMGQFDHP-NVIALKGVITRTRPMMIITEFLENGSLENFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGI 222          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 52.373 bits (124), Expect = 8.160e-7
Identity = 43/167 (25.75%), Postives = 75/167 (44.91%), Query Frame = 2
Query: 3419 VTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELS--KQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSK-LSNTCNRMK---KIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNC 3901
            V +K+L   S   + +DF  +  I+   D P N+  +  V+     +    +    GSL  FLK N   +  + ++     VA+G  Y+     I+ D+   NI +   L   +SD GLS+ L ++    +   + + GK+ + W+  E    + FSS S V +Y  
Sbjct:   56 VAVKILKPGSSHKNREDFCVEASIMGQFDHP-NVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGI 221          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb4a (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:101165379])

HSP 1 Score: 246.514 bits (628), Expect = 1.190e-65
Identity = 195/629 (31.00%), Postives = 297/629 (47.22%), Query Frame = 2
Query:  620 KVTANLNKNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCV-RKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVN---ETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKL---TNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH--SNQMNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQCL---SSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTKENLFSFKRTCTG 2425
            +    L +NC  V+GN+ IT I  N NLSFL SI E+TG++ +  N  E + L+NL+IIRG   +   E +++L +  N    G   LK L L     IL   + V  N   L   + IHW  ++   Q   +V P N+SN   +      CH SC    G+  CWG+   QCQ +   V  + C    +CF      +  CCH EC GGC+GP +T C  C +FN+ GACV +CP+  V+N        N   K+T+   CV +CP  + +++  CV  C +          + C+PC + +CPK C           Q ++   + +  NCT  +GN+I     I+GD+        +GI   D E+L     +KEI G L  N+ S    +  L  F NL  I   +  +     L I +   +     Q L E+  G V I NN +LC+ +++   S+    S ++ I NN +  +C  ++  C ++C  + GCWGP    C+ CR+F+      C+ +C+      +N E  +  +   C +C +QC     +++TC G G DQC   C+N+K    C EKCP    G  S        +N C  CH +CT+  +    + C G
Sbjct:  137 RTLRKLYENCEVVMGNLEITSIDRNRNLSFLKSIREVTGYVLVALNQFEYLPLENLRIIRGTTLY---EGRYALAIFLNYRRDGNYGLKQLGLRSLTEILNGGVYVDQN-KFLCHADTIHWQDVIKNPQAELLVVPSNNSNNGCRR-----CHRSCN---GR--CWGHQEDQCQTLTKTVCAEQC--DGRCF---GPYVSDCCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPRAKYTYGAFCVRECPHNFVVDHSSCVRACPSNKMEVEENRIKMCIPCTD-ICPKVCDGIGTGSLQTAQTVDASNIDKFVNCTKINGNLIFLITGIKGDM-------YHGIGPLDPERLNVFRTVKEITGFL--NIQSWPENMTDLSVFSNLVTIGGRSLYSGSGISLLILKQRRISSFQFQSLNEISAGNVYIFNNSRLCFYNTINWTSLFRTPSQKVLIRNNREPMECLQQQMICDRMCS-EDGCWGPGPDQCLSCRYFK--RGRTCVESCN-----LFNGEVREFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCV-KCLNFKDGPNCVEKCPDGLQGANSFIFKYAKANNECHPCHVNCTQGCIGPRIQDCVG 727          

HSP 2 Score: 98.5969 bits (244), Expect = 3.362e-20
Identity = 91/416 (21.88%), Postives = 161/416 (38.70%), Query Frame = 2
Query: 2687 HEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYEDDYISKNS-----SNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
             E+  G++CL C   C +    ++       + C +C + + G  CV  C  D     NS     + A + C  CH  C +GC G    DC             +T      I G  F I + +  V +  +                            K I      +K+  L+             S  AP+  +L  + E +     IL  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S + P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  I I+D GL++L +   +      GK+ I W   E  + + F+ +S V +Y 
Sbjct:  636 REFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCVKCLNFKDGPNCVEKC-PDGLQGANSFIFKYAKANNECHPCHVNCTQGCIGPRIQDCVGMM--------DRTPLIAAGIIGGLFIIVIVALTVAIYARR---------------------------KSI------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKILGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNEATGPKANVEFMDEALIMASVEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDADEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYG 989          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb4a (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:101165379])

HSP 1 Score: 246.128 bits (627), Expect = 1.523e-65
Identity = 194/624 (31.09%), Postives = 295/624 (47.28%), Query Frame = 2
Query:  635 LNKNCTHVIGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCV-RKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHN--GVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVN---ETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKL---TNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH--SNQMNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQCL---SSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTKENLFSFKRTCTG 2425
            L +NC  V+GN+ IT I  N NLSFL SI E+TG++ +  N  E + L+NL+IIRG   +   E +++L +  N    G   LK L L     IL   + V  N   L   + IHW  ++   Q   +V P N+SN   +      CH SC        CWG+   QCQ +   V  + C    +CF      +  CCH EC GGC+GP +T C  C +FN+ GACV +CP+  V+N    +   N   K+T+   CV +CP  + +++  CV  C +          + C+PC + +CPK C           Q ++   + +  NCT  +GN+I     I+GD+        +GI   D E+L     +KEI G L  N+ S    +  L  F NL  I   +  +     L I +   +     Q L E+  G V I NN +LC+ +++   S+    S ++ I NN +  +C  ++  C ++C  + GCWGP    C+ CR+F+      C+ +C+      +N E  +  +   C +C +QC     +++TC G G DQC   C+N+K    C EKCP    G  S        +N C  CH +CT+  +    + C G
Sbjct:  142 LYENCEVVMGNLEITSIDRNRNLSFLKSIREVTGYVLVALNQFEYLPLENLRIIRGTTLY---EGRYALAIFLNYRRDGNYGLKQLGLRSLTEILNGGVYVDQN-KFLCHADTIHWQDVIKNPQAELLVVPSNNSNNGCRR-----CHRSCNGR-----CWGHQEDQCQTLTKTVCAEQC--DGRCF---GPYVSDCCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPRAKYTYGAFCVRECPHNFVVDHSSCVRACPSNKMEVEENRIKMCIPCTD-ICPKVCDGIGTGSLQTAQTVDASNIDKFVNCTKINGNLIFLITGIKGDM-------YHGIGPLDPERLNVFRTVKEITGFL--NIQSWPENMTDLSVFSNLVTIGGRSLYSGSGISLLILKQRRISSFQFQSLNEISAGNVYIFNNSRLCFYNTINWTSLFRTPSQKVLIRNNREPMECLQQQMICDRMCS-EDGCWGPGPDQCLSCRYFK--RGRTCVESCN-----LFNGEVREFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCV-KCLNFKDGPNCVEKCPDGLQGANSFIFKYAKANNECHPCHVNCTQGCIGPRIQDCVG 727          

HSP 2 Score: 98.9821 bits (245), Expect = 3.041e-20
Identity = 91/416 (21.88%), Postives = 161/416 (38.70%), Query Frame = 2
Query: 2687 HEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYEDDYISKNS-----SNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
             E+  G++CL C   C +    ++       + C +C + + G  CV  C  D     NS     + A + C  CH  C +GC G    DC             +T      I G  F I + +  V +  +                            K I      +K+  L+             S  AP+  +L  + E +     IL  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S + P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  I I+D GL++L +   +      GK+ I W   E  + + F+ +S V +Y 
Sbjct:  636 REFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCVKCLNFKDGPNCVEKC-PDGLQGANSFIFKYAKANNECHPCHVNCTQGCIGPRIQDCVGMM--------DRTPLIAAGIIGGLFIIVIVALTVAIYARR---------------------------KSI------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKILGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNEATGPKANVEFMDEALIMASVEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDADEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYG 989          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb4a (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:101165379])

HSP 1 Score: 239.965 bits (611), Expect = 8.956e-64
Identity = 191/616 (31.01%), Postives = 291/616 (47.24%), Query Frame = 2
Query:  659 IGNVIITGI-TNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCV-RKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHI--KNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVN---ETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLT---NLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILH--SNQMNIYNNGKDGKCEARK--CSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQ-THEMQCSKCHNQCL---SSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGS-------TSNICKACHQSCTKENLFSFKRTCTG 2425
            +GN+ IT I  N NLSFL SI E+TG++ +  N  E + L+NL+IIRG   +   E +++L +  N    G   LK L L     IL   + V  N   L   + IHW  ++   Q   +V P N+SN   +      CH SC    G+  CWG+   QCQ +   V  + C    +CF      +  CCH EC GGC+GP +T C  C +FN+ GACV +CP+  V+N        N   K+T+   CV +CP  + +++  CV  C +          + C+PC + +CPK C           Q ++   + +  NCT  +GN+I     I+GD+        +GI   D E+L     +KEI G L  N+ S    +  L  F NL  I   +  +     L I +   +     Q L E+  G V I NN +LC+ +++   S+    S ++ I NN +  +C  ++  C ++C  + GCWGP    C+ CR+F+      C+ +C+      +N E  +  +   C +C +QC     +++TC G G DQC   C+N+K    C EKCP    G  S        +N C  CH +CT+  +    + C G
Sbjct:    1 MGNLEITSIDRNRNLSFLKSIREVTGYVLVALNQFEYLPLENLRIIRGTTLY---EGRYALAIFLNYRRDGNYGLKQLGLRSLTEILNGGVYVDQN-KFLCHADTIHWQDVIKNPQAELLVVPSNNSNNGCRR-----CHRSCN---GR--CWGHQEDQCQTLTKTVCAEQC--DGRCF---GPYVSDCCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPRAKYTYGAFCVRECPHNFVVDHSSCVRACPSNKMEVEENRIKMCIPCTD-ICPKVCDGIGTGSLQTAQTVDASNIDKFVNCTKINGNLIFLITGIKGDM-------YHGIGPLDPERLNVFRTVKEITGFL--NIQSWPENMTDLSVFSNLVTIGGRSLYSGSGISLLILKQRRISSFQFQSLNEISAGNVYIFNNSRLCFYNTINWTSLFRTPSQKVLIRNNREPMECLQQQMICDRMCS-EDGCWGPGPDQCLSCRYFK--RGRTCVESCN-----LFNGEVREFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCV-KCLNFKDGPNCVEKCPDGLQGANSFIFKYAKANNECHPCHVNCTQGCIGPRIQDCVG 578          

HSP 2 Score: 98.9821 bits (245), Expect = 3.002e-20
Identity = 91/416 (21.88%), Postives = 161/416 (38.70%), Query Frame = 2
Query: 2687 HEYQFGAICLPCHPLCSQCSDGTI-------ESCHRCKSHRRGKECVHNCYEDDYISKNS-----SNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYN 3898
             E+  G++CL C   C +    ++       + C +C + + G  CV  C  D     NS     + A + C  CH  C +GC G    DC             +T      I G  F I + +  V +  +                            K I      +K+  L+             S  AP+  +L  + E +     IL  G F  + KG W  +                     E V + V IK+L+E +    N +F+ +  I+ S + P  +R++ V +    +L  QL   G L++++ ++   +    +L W  Q+A G  Y++   +++ D+   N+ ++SP  I I+D GL++L +   +      GK+ I W   E  + + F+ +S V +Y 
Sbjct:  487 REFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCVKCLNFKDGPNCVEKC-PDGLQGANSFIFKYAKANNECHPCHVNCTQGCIGPRIQDCVGMM--------DRTPLIAAGIIGGLFIIVIVALTVAIYARR---------------------------KSI------KKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKILGSGAFGTVYKGIWVPEG--------------------ETVKIPVAIKILNEATGPKANVEFMDEALIMASVEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDADEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYG 840          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb3a (erb-b2 receptor tyrosine kinase 3 [Source:NCBI gene;Acc:101172402])

HSP 1 Score: 237.654 bits (605), Expect = 6.431e-63
Identity = 199/683 (29.14%), Postives = 308/683 (45.10%), Query Frame = 2
Query:  611 NYMKVTANLNKNCTHVIGNVIITGIT-NENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNII--GENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDL-SCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHN--GVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNE---TCLPCPNGVCPKDC-----LIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTN---NKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQ-------MNIYNNGKDGKC--EARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQC--LSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGD-------GSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFIS----RFTVHSLTCIH 2542
            N MK   ++  NC  V+GN+ IT +  N + SFL SI+E+TG++    N    + L  L++IRG   +   E +++L V+ N    G++ L+ L L +   IL+  + +  N   L +   ++W  I+           + S++   +E G +  CH SC+       CWG  S +CQI+   V    + +S+CF        +CCH EC GGC GPL+T C  CK+FNN G+CV +CP+ L++N    +   N   K+ + + CV +CP  + ++   CV  C +       +    C PC  G+CPK C       ++ V  +NI            NCT   G++      IEGD  NG P     +  + L+    ++EI   L I   S    L  L  F NL +I+  T     +K    L + +   L  LG + L++V +G+V I  N KLCY D++    I+++         + +  N    +C  E   C  LC    GCWGP    CV C+++  +    C+ +C    G    +    T   +C  CH+QC       TC GPGA +C   C N K   +C   CPQ   G+          +  C+ CH +CT+         CTGP     V    +    Q  T    G I+     F+V +LT ++
Sbjct:   50 NQMK---SMYTNCNIVMGNLEITMMEHNRDYSFLQSIKEVTGYVLFAVNQFSRLPLDQLRVIRGNTLY---EDQYALAVMLNYQKNGQHGLQELGLTQLTEILRGGVKIIQN-KFLSYAPQVNWQDIVK----------NGSAHIMIEENGPIKPCHESCK----DVPCWGPGSDKCQILTHTVCAP-QCNSRCF---GTNPNECCHTECAGGCRGPLDTDCFACKNFNNLGSCVPQCPQALIYNKHAFRMEPNPDAKYQYGSFCVSECPANFLVDGSSCVSSCPSDKKEVEKDGVKRCDPC-GGLCPKACHGTGSPGRETVDAHNID--------SFMNCTKIQGSLHFLITGIEGDEYNGIPP----LNPEKLKIFKTVEEITDYLSIQ--SWPDSLSNLSVFSNLRVIQGRTLYKGVSKRGYSLMVMKIKSLSSLGFRSLQKVNDGVVYITGNKKLCYQDTVNWTRIVNNRPRQKRQKFVEVKENRPSKECVEEGHVCDPLCSAD-GCWGPGPDQCVSCKNY--SRGGTCVPDCMFLSGV---QREFVTSTKECQLCHSQCQIQEGRTTCTGPGAHECV-ACANLKDGPHCVSSCPQGVMGEEGIVFKYSDKNRNCEQCHINCTE--------GCTGPALENCVGASTRAISRQATTGIVLGLIAFIFVSFSVMTLTFLY 677          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: ENSORLT00000004469.2 (melanoma receptor tyrosine-protein kinase [Source:NCBI gene;Acc:101169984])

HSP 1 Score: 234.572 bits (597), Expect = 2.498e-62
Identity = 195/633 (30.81%), Postives = 289/633 (45.66%), Query Frame = 2
Query:  644 NCTHVIGNVIIT-GITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENM---------LKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLV--HNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNE----TCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETT-NNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCL--SSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGD--------GSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRK 2461
            NC+ V+ N+ IT  + N++LSFL SI+E+ G++ +  N V ++ L NL++IRG+N  +Y   KF+L+V+SN    N+         L+ L L +   IL   + V NNP +L     I W  I+ K +   ++   +      +          C P      CW      CQ     V        +C      K   CC++ C  GC GPL T CL CK+FN+ G C + CP   +  H   + ++N   K++F  TCV  CP  Y +    CV  C    TY V E     C  C  G CPK C    V +  N   +N   +    NCT  +G+I+    S  GD       NI  +  K LE    +KEI G L I    +   + +L  F NLEIIR  +   NK+     +   D+L +LGL+ LKE+  G V + +N  LCY+ ++ N S L  ++  I     D     + C + C  K GCWGP    C+ C++F    K  C+  C+   G    +      E  C +CH +CL  +   TC+GPG DQC+  C ++K   +C   CP     D           +  C+ CHQ+C++         C+GP    G++GC +
Sbjct:   69 NCSVVLENLEITYTLENQDLSFLQSIQEVGGYVLIAMNDVATVPLVNLRLIRGQN--LYD--KFALLVMSNYHSNNITGAPRYTSGLRQLQLSRLTEILNGGVKVTNNP-LLCNMEKIQWWDIVDKARNFSVLLKFDDYKRDCER---------CDPGCVNDSCWAAGPDHCQKFTKLVCAEQCGPGRC---SGPKPLDCCNQHCAAGCTGPLATDCLACKNFNDDGICKDSCPPLNLYNHKSQQVVENPNAKYSFGATCVKACPHNYVVTEGSCVRACSPN-TYEVEENGVQRCKRC-EGPCPKACDGVGVGRLTNTIAVNSSNIESFRNCTKINGDIVFLKSSFSGDQH----YNIPPMDPKKLEYFRTVKEITGHLLIQTWPEN--MTSLSVFENLEIIRGRSLFVNKY--SFVVVGADNLHWLGLRSLKELSAGNVRLKDNKLLCYSKAM-NWSYLFRDKTQIV----DQTPPNQTCDQQCSSK-GCWGPGTNMCLSCQYF--NRKQHCVERCNLLQG----EPREVEVEGSCVECHPECLVMTGTQTCHGPGPDQCS-QCAHFKDGSHCVRMCPHGVLDDENMLIWKYADQNGQCQLCHQNCSQ--------GCSGP----GLSGCSR 649          

HSP 2 Score: 90.5077 bits (223), Expect = 9.305e-18
Identity = 87/414 (21.01%), Postives = 157/414 (37.92%), Query Frame = 2
Query: 2687 HEYQFGAICLPCHPLC------SQCSDGTIESCHRCKSHRRGKECVHNCY-----EDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTY 3895
             E +    C+ CHP C        C     + C +C   + G  CV  C      +++ +    ++    C  CH+ C +GC+G        C R   + +S         +      +FV   +V V+ Q +K                                  +KR   +L            S  AP+   L  + E +     +L  G F  + KG W  +  N                    V + V IKVL E +    N++ L +  ++ S D P   R++ + + +  +L  QL   G L+++++Q+   +    +L W  Q+A G  Y++   +++ D+   N+ +++P  I I+D GL+KL     +      GK+ I W   E+     ++ +S V +Y
Sbjct:  558 REVEVEGSCVECHPECLVMTGTQTCHGPGPDQCSQCAHFKDGSHCVRMCPHGVLDDENMLIWKYADQNGQCQLCHQNCSQGCSGP---GLSGCSRTTTH-SSLAVGVVSGLLVAVIVLLFV---LVYVRRQRIK----------------------------------KKRTLRRLLQEKELVEPLTPSGQAPNQALLRILKETEFKKVRVLGSGAFGTVFKGLWVPEGEN--------------------VRIPVAIKVLREATSPKANQEVLDEAYVMASVDHPHVCRLLGICLTSSVQLVTQLMPYGCLLDYVRQHKDRICAQWLLNWCVQIAKGMNYLEERHLVHRDLAARNVLLKNPNHIKITDFGLAKLLTADEKEYHADGGKVPIKWMALESILQWTYTHQSDVWSY 910          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000044602.1 (SMESG000044602.1)

HSP 1 Score: 2482.6 bits (6433), Expect = 0.000e+0
Identity = 1244/1266 (98.26%), Postives = 1254/1266 (99.05%), Query Frame = 2
Query:  401 KPNPNHHKEINGNDSLVKINVSNFDRQASEFNLKTNNASSDSFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIESCHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCNSDHDTRPNLRKLKQSIEMIMKNPCSFIILQINRDMSERQITVVNGLHSQIIYHVESSESKLQNEDLITTFNNHLEVPDESLRNPTSHHEDIVNNLILN 4198
            KPNPNHHKEINGN SLVKINVSNFDRQASEFNLKTN  SSDSFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNK CTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNI+WNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGS APWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCE+RKCSKLCHPKYGCWGPLGMFCVKCR+FQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYG GADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMSLLKLYSNNSSLKMVLENW+DRQANHEYQFGAICLPCHPLCSQCSDGTIESC RCK HRRGKECVHNCYEDDYISK+SSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQEL  IQNSWYIAAVGGSVVSVLAVGIVWKCIC+SLNKRKRYDLKLKF NGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLG+FCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPD+LVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTC+RMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCNSDHD RPNLRKLKQSIEMIMKNPCSFIILQINRDMSERQITVVNGLHSQIIY+VESSESKLQNEDLITTFNNHLEVPDESLRNPTSHHEDIVNNLILN
Sbjct:   18 KPNPNHHKEINGNYSLVKINVSNFDRQASEFNLKTNYGSSDSFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKKCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNINWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSNAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCESRKCSKLCHPKYGCWGPLGMFCVKCRNFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGTGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMSLLKLYSNNSSLKMVLENWVDRQANHEYQFGAICLPCHPLCSQCSDGTIESCRRCKYHRRGKECVHNCYEDDYISKHSSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELTLIQNSWYIAAVGGSVVSVLAVGIVWKCICVSLNKRKRYDLKLKFPNGFSTVDIESDFAPSSTKLLPIAEGQPANEHILDLGRFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDKLVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCSRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCNSDHDARPNLRKLKQSIEMIMKNPCSFIILQINRDMSERQITVVNGLHSQIIYNVESSESKLQNEDLITTFNNHLEVPDESLRNPTSHHEDIVNNLILN 1283          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000044603.1 (SMESG000044603.1)

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 484/1205 (40.17%), Postives = 700/1205 (58.09%), Query Frame = 2
Query:  539 DSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSS-NFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIESCHRCKSHRRGKECVHNCYEDDYISKN-SSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVD--IESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCN-------------------------------------------------SDHDTRPNLRKLKQSIEMIMKNPCSFIILQ 3994
            D    H   C S     D+    N+Y  +  N +KNC+++IG+V+I  ITNEN+SFLNSIE+I+G+L +FSN+VESISL  LK+IRGENP + + +KFSL+V  N    +ML+ ++ P  QVIL+HN+   NNP + Y    I+WNS++ + Q + IVE +       SK   +LSCH SCQ H+ K +CWGNSS  CQ INDC  +TC  S+KC++   LK E+CCHEECVGGC GP  +QCL CK+FNN G CVE CP +  H+G+K+I+N L K  F+  CVDKCP K+F E+  CV +C    TYAVN+TC+PCPNG CPK C  +D++ +  I Y++RK+L RLENCTVY GNI+IN  S+EGD  +   K   GI+ +DL+KL NL+EIYG L I+V   + W  +L + +NL IIRAE   +    G+ I  N  L +LGL+ LKEVRNG + I +N +LC++++LTNKSILH        NGK G C  +KC   C  + GCWGP    CVKC+ F I E   C+S CS +PGYFYN  +       CS+CH++CL    TC+G   ++C  GC NYK+ + C +KCP  +Y D   +  C  CH +CT EN  + +  C GP + +G  GC  CN++ + +N S  + +    + L C+ +S+ C  G++K  +DF S   +       +   S   +LE WI+   NH+    ++C PCHP CS+C  G+   C  CK  R   +C+  C ++ +I+ N ++  ES C KCHEEC EGC GST YDC +CK  KIY+N S T+FFCNS CGD  ++F  SE++C     L   + + YI   G + + +  V I+   I  S N+ K++  KL     F   D    S   P+   LL I E Q   + I+  G F I+ KG W    +  +   S  K  + KI  D  + LNV +K+L++ SD ++N++ L++ K++ S D P  LRI+ V + A+ +L  Q    GSL+EF+++N S++  I++L+WA Q+ASG  Y++ +GII+ D+   N+ I+SP ++ I+D GL+K+ +   +  + K G++ I W   E   ++ FSSKS V +Y                                                     D D RP+  +L+++ EM+  NP  ++++Q
Sbjct:   67 DKRYRHGKVCKSTQTQIDV--SKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYN----SMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNSKIDEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKTEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGTFLRALNGKKGNCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKN--CYPCHTNCT-ENSQNKESMCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKV------NAAMQSTMKILEKWIEIGTNHDLPIASVCFPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGS-TQFFCNSTCGDRIQLFQTSEIICT--DHLIYSRFNMYIYIGGPAGIVICFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ 1253          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000044603.1 (SMESG000044603.1)

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 484/1205 (40.17%), Postives = 700/1205 (58.09%), Query Frame = 2
Query:  539 DSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSS-NFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIESCHRCKSHRRGKECVHNCYEDDYISKN-SSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGF--STVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCN-------------------------------------------------SDHDTRPNLRKLKQSIEMIMKNPCSFIILQ 3994
            D    H   C S     D+    N+Y  +  N +KNC+++IG+V+I  ITNEN+SFLNSIE+I+G+L +FSN+VESISL  LK+IRGENP + + +KFSL+V  N    +ML+ ++ P  QVIL+HN+   NNP + Y    I+WNS++ + Q + IVE +       SK   +LSCH SCQ H+ K +CWGNSS  CQ INDC  +TC  S+KC++   LK E+CCHEECVGGC GP  +QCL CK+FNN G CVE CP +  H+G+K+I+N L K  F+  CVDKCP K+F E+  CV +C    TYAVN+TC+PCPNG CPK C  +D++ +  I Y++RK+L RLENCTVY GNI+IN  S+EGD  +   K   GI+ +DL+KL NL+EIYG L I+V   + W  +L + +NL IIRAE   +    G+ I  N  L +LGL+ LKEVRNG + I +N +LC++++LTNKSILH        NGK G C  +KC   C  + GCWGP    CVKC+ F I E   C+S CS +PGYFYN  +       CS+CH++CL    TC+G   ++C  GC NYK+ + C +KCP  +Y D   +  C  CH +CT EN  + +  C GP + +G  GC  CN++ + +N S  + +    + L C+ +S+ C  G++K  +DF S   +       +   S   +LE WI+   NH+    ++C PCHP CS+C  G+   C  CK  R   +C+  C ++ +I+ N ++  ES C KCHEEC EGC GST YDC +CK  KIY+N S T+FFCNS CGD  ++F  SE++C     L   + + YI   G + + +  V I+   I  S N+ K++  KL     F  S     S   P+   LL I E Q   + I+  G F I+ KG W    +  +   S  K  + KI  D  + LNV +K+L++ SD ++N++ L++ K++ S D P  LRI+ V + A+ +L  Q    GSL+EF+++N S++  I++L+WA Q+ASG  Y++ +GII+ D+   N+ I+SP ++ I+D GL+K+ +   +  + K G++ I W   E   ++ FSSKS V +Y                                                     D D RP+  +L+++ EM+  NP  ++++Q
Sbjct:   70 DKRYRHGKVCKSTQTQIDV--SKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYN----SMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNSKIDEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKTEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGTFLRALNGKKGNCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKN--CYPCHTNCT-ENSQNKESMCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKV------NAAMQSTMKILEKWIEIGTNHDLPIASVCFPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGS-TQFFCNSTCGDRIQLFQTSEIICT--DHLIYSRFNMYIYIGGPAGIVICFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ 1256          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000044603.1 (SMESG000044603.1)

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 484/1205 (40.17%), Postives = 700/1205 (58.09%), Query Frame = 2
Query:  539 DSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSS-NFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIESCHRCKSHRRGKECVHNCYEDDYISKN-SSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVD--IESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCN-------------------------------------------------SDHDTRPNLRKLKQSIEMIMKNPCSFIILQ 3994
            D    H   C S     D+    N+Y  +  N +KNC+++IG+V+I  ITNEN+SFLNSIE+I+G+L +FSN+VESISL  LK+IRGENP + + +KFSL+V  N    +ML+ ++ P  QVIL+HN+   NNP + Y    I+WNS++ + Q + IVE +       SK   +LSCH SCQ H+ K +CWGNSS  CQ INDC  +TC  S+KC++   LK E+CCHEECVGGC GP  +QCL CK+FNN G CVE CP +  H+G+K+I+N L K  F+  CVDKCP K+F E+  CV +C    TYAVN+TC+PCPNG CPK C  +D++ +  I Y++RK+L RLENCTVY GNI+IN  S+EGD  +   K   GI+ +DL+KL NL+EIYG L I+V   + W  +L + +NL IIRAE   +    G+ I  N  L +LGL+ LKEVRNG + I +N +LC++++LTNKSILH        NGK G C  +KC   C  + GCWGP    CVKC+ F I E   C+S CS +PGYFYN  +       CS+CH++CL    TC+G   ++C  GC NYK+ + C +KCP  +Y D   +  C  CH +CT EN  + +  C GP + +G  GC  CN++ + +N S  + +    + L C+ +S+ C  G++K  +DF S   +       +   S   +LE WI+   NH+    ++C PCHP CS+C  G+   C  CK  R   +C+  C ++ +I+ N ++  ES C KCHEEC EGC GST YDC +CK  KIY+N S T+FFCNS CGD  ++F  SE++C     L   + + YI   G + + +  V I+   I  S N+ K++  KL     F   D    S   P+   LL I E Q   + I+  G F I+ KG W    +  +   S  K  + KI  D  + LNV +K+L++ SD ++N++ L++ K++ S D P  LRI+ V + A+ +L  Q    GSL+EF+++N S++  I++L+WA Q+ASG  Y++ +GII+ D+   N+ I+SP ++ I+D GL+K+ +   +  + K G++ I W   E   ++ FSSKS V +Y                                                     D D RP+  +L+++ EM+  NP  ++++Q
Sbjct:   82 DKRYRHGKVCKSTQTQIDV--SKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYN----SMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNSKIDEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKTEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGTFLRALNGKKGNCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKN--CYPCHTNCT-ENSQNKESMCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKV------NAAMQSTMKILEKWIEIGTNHDLPIASVCFPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGS-TQFFCNSTCGDRIQLFQTSEIICT--DHLIYSRFNMYIYIGGPAGIVICFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ 1268          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000044603.1 (SMESG000044603.1)

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 484/1205 (40.17%), Postives = 700/1205 (58.09%), Query Frame = 2
Query:  539 DSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSS-NFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMXXXXXXXXXXXXXMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIESCHRCKSHRRGKECVHNCYEDDYISKN-SSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYXXXXXXXXXXXXXXXXXWKCICMSLNKRKRYDLKLKFSNGFSTVD--IESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCN-------------------------------------------------SDHDTRPNLRKLKQSIEMIMKNPCSFIILQ 3994
            D    H   C S     D+    N+Y  +  N +KNC+++IG+V+I  ITNEN+SFLNSIE+I+G+L +FSN+VESISL  LK+IRGENP + + +KFSL+V  N    +ML+ ++ P  QVIL+HN+   NNP + Y    I+WNS++ + Q + IVE +       SK   +LSCH SCQ H+ K +CWGNSS  CQ INDC  +TC  S+KC++   LK E+CCHEECVGGC GP  +QCL CK+FNN G CVE CP +  H+G+K+I+N L K  F+  CVDKCP K+F E+  CV +C    TYAVN+TC+PCPNG CPK C  +D++ +  I Y++RK+L RLENCTVY GNI+IN  S+EGD  +   K   GI+ +DL+KL NL+EIYG L I+V   + W  +L + +NL IIRAE   +    G+ I  N  L +LGL+ LKEVRNG + I +N +LC++++LTNKSILH        NGK G C  +KC   C  + GCWGP    CVKC+ F I E   C+S CS +PGYFYN  +       CS+CH++CL    TC+G   ++C  GC NYK+ + C +KCP  +Y D   +  C  CH +CT EN  + +  C GP + +G  GC  CN++ + +N S  + +    + L C+ +S+ C  G++K  +DF S   +       +   S   +LE WI+   NH+    ++C PCHP CS+C  G+   C  CK  R   +C+  C ++ +I+ N ++  ES C KCHEEC EGC GST YDC +CK  KIY+N S T+FFCNS CGD  ++F  SE++C     L   + + YI   G + + +  V I+   I  S N+ K++  KL     F   D    S   P+   LL I E Q   + I+  G F I+ KG W    +  +   S  K  + KI  D  + LNV +K+L++ SD ++N++ L++ K++ S D P  LRI+ V + A+ +L  Q    GSL+EF+++N S++  I++L+WA Q+ASG  Y++ +GII+ D+   N+ I+SP ++ I+D GL+K+ +   +  + K G++ I W   E   ++ FSSKS V +Y                                                     D D RP+  +L+++ EM+  NP  ++++Q
Sbjct:   47 DKRYRHGKVCKSTQTQIDV--SKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYN----SMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNSKIDEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKTEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGTFLRALNGKKGNCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKN--CYPCHTNCT-ENSQNKESMCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKV------NAAMQSTMKILEKWIEIGTNHDLPIASVCFPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGS-TQFFCNSTCGDRIQLFQTSEIICT--DHLIYSRFNMYIYIGGPAGIVICFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ 1233          
The following BLAST results are available for this feature:
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERBB36.427e-6429.03erb-b2 receptor tyrosine kinase 3 [Source:HGNC Sym... [more]
ERBB33.351e-6329.03erb-b2 receptor tyrosine kinase 3 [Source:HGNC Sym... [more]
ERBB45.061e-6330.73erb-b2 receptor tyrosine kinase 4 [Source:HGNC Sym... [more]
EGFR7.619e-6230.21epidermal growth factor receptor [Source:HGNC Symb... [more]
ERBB48.470e-6231.47erb-b2 receptor tyrosine kinase 4 [Source:HGNC Sym... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-232.652e-5723.27Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-232.840e-5723.59Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-234.167e-5723.44Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-234.860e-5723.44Receptor tyrosine-protein kinase let-23 [Source:U... [more]
daf-24.063e-924.84Insulin-like receptor Insulin-like receptor subuni... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egfr1.384e-9726.80gene:FBgn0003731 transcript:FBtr0071654[more]
Egfr1.709e-9726.80gene:FBgn0003731 transcript:FBtr0071653[more]
CG107023.033e-1322.22gene:FBgn0032752 transcript:FBtr0303241[more]
CG107023.033e-1322.22gene:FBgn0032752 transcript:FBtr0081176[more]
CG107023.033e-1322.22gene:FBgn0032752 transcript:FBtr0081174[more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egfra4.512e-6931.77epidermal growth factor receptor a (erythroblastic... [more]
egfra8.653e-6930.93epidermal growth factor receptor a (erythroblastic... [more]
egfra7.941e-6831.03epidermal growth factor receptor a (erythroblastic... [more]
erbb4a3.061e-6631.70erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Ac... [more]
erbb4a9.466e-6631.72erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Ac... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERBB42.874e-5931.40erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB42.908e-5931.40erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB43.085e-5931.40erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB43.138e-5931.40erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB43.240e-5931.40erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Erbb49.699e-6331.19erb-b2 receptor tyrosine kinase 4 [Source:MGI Symb... [more]
Erbb34.841e-6229.08erb-b2 receptor tyrosine kinase 3 [Source:MGI Symb... [more]
Erbb41.518e-6131.31erb-b2 receptor tyrosine kinase 4 [Source:MGI Symb... [more]
Erbb41.788e-6131.31erb-b2 receptor tyrosine kinase 4 [Source:MGI Symb... [more]
Egfr8.492e-5929.86epidermal growth factor receptor [Source:MGI Symbo... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04412|EGFR_DROME3.685e-9226.63Epidermal growth factor receptor OS=Drosophila mel... [more]
sp|P0CY46|EGFR_APIME3.524e-8426.61Epidermal growth factor receptor OS=Apis mellifera... [more]
sp|P13388|XMRK_XIPMA2.753e-6531.38Melanoma receptor tyrosine-protein kinase OS=Xipho... [more]
sp|P21860|ERBB3_HUMAN1.609e-6229.03Receptor tyrosine-protein kinase erbB-3 OS=Homo sa... [more]
sp|Q5RB22|ERBB3_PONAB3.059e-6228.88Receptor tyrosine-protein kinase erbB-3 OS=Pongo a... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B1ACY80.000e+099.92Epidermal growth factor receptor Smed-egfr-6 OS=Sc... [more]
A0A1B1ACY90.000e+040.17Receptor protein-tyrosine kinase OS=Schmidtea medi... [more]
A0A1L8DJK41.459e-10626.77Receptor protein-tyrosine kinase OS=Nyssomyia neiv... [more]
A0A1L8DJK12.467e-10626.85Receptor protein-tyrosine kinase (Fragment) OS=Nys... [more]
A0A0U3TFJ48.229e-10628.30Receptor protein-tyrosine kinase OS=Leptinotarsa d... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erbb23.088e-6429.60erb-b2 receptor tyrosine kinase 2 [Source:NCBI gen... [more]
ENSAMXT00000051131.18.728e-6329.93epidermal growth factor receptor-like [Source:NCBI... [more]
ENSAMXT00000047506.19.738e-6329.93epidermal growth factor receptor-like [Source:NCBI... [more]
egfra4.949e-6229.98epidermal growth factor receptor-like [Source:NCBI... [more]
erbb4b1.165e-6129.73erb-b2 receptor tyrosine kinase 4b [Source:ZFIN;Ac... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010487.11.503e-5327.71pep scaffold:Pmarinus_7.0:GL501102:818:30108:-1 ge... [more]
ENSPMAT00000003172.14.134e-5029.42pep scaffold:Pmarinus_7.0:GL476855:1052:76454:1 ge... [more]
EGFR1.456e-4426.19epidermal growth factor receptor [Source:HGNC Symb... [more]
ENSPMAT00000002120.14.192e-2427.03pep scaffold:Pmarinus_7.0:GL478472:36400:43944:-1 ... [more]
ENSPMAT00000008321.17.337e-2327.48pep scaffold:Pmarinus_7.0:GL483972:456:13241:-1 ge... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO312981.526e-725.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409944.222e-725.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337316.395e-725.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337326.756e-725.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337368.160e-725.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erbb4a1.190e-6531.00receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
erbb4a1.523e-6531.09receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
erbb4a8.956e-6431.01receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
erbb3a6.431e-6329.14erb-b2 receptor tyrosine kinase 3 [Source:NCBI gen... [more]
ENSORLT00000004469.22.498e-6230.81melanoma receptor tyrosine-protein kinase [Source:... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044602.10.000e+098.26SMESG000044602.1[more]
SMESG000044603.10.000e+040.17SMESG000044603.1[more]
SMESG000044603.10.000e+040.17SMESG000044603.1[more]
SMESG000044603.10.000e+040.17SMESG000044603.1[more]
SMESG000044603.10.000e+040.17SMESG000044603.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004546 ID=SMED30004546|Name=Receptor protein-tyrosine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=4250bp
CTGCTGTCTGATTGGTCAATCGCATTATATTTAATAGTCCAAACATTTCT
TGTCAAAGTTCCATTCATCTTCTATTAAAACAATCTGAATAAAAACCGTT
TATGTAAAAAACCGATAATTTGTTTAAATCGCTATATTGGCAACGAATTA
ATTTAAACAAATCTCAATCTTGGAATCTCGAATATCTGAGGACTGATCAA
CTCTATTAGCATAATCAGCACATTATTCACCATTGGATCATCGCCGTCAA
TCATTTGTCAATTTGTATAATTACCTACGCAGATATCAGACGATTTCTCA
ACTCTCTCTATTGGTTGTTTAGCAAGTTTACCGAAGGAATATTTTTGACA
TGGGTTTGGTAATTCCCGCTCTGGTGTTGCTACTGTCCTTGAGGGCGATT
AAACCTAATCCAAATCACCATAAAGAGATCAACGGAAACGATTCTCTTGT
GAAAATCAATGTATCGAATTTTGATCGGCAGGCATCTGAGTTCAATTTGA
AAACGAATAATGCAAGTTCAGACTCTTTCCGCCGCGCCGACAGCCATTCC
GATCATCAAAACACATGTATAAGCAAATTAGTTTATGAAGATATCCGGGA
CAAACCGAATAATTATATGAAAGTCACTGCCAACCTCAACAAAAATTGCA
CTCATGTAATTGGGAATGTAATTATTACTGGTATCACTAATGAAAATTTG
AGTTTTTTGAATTCAATTGAAGAAATAACAGGATTTCTTTTCCTATTTTC
GAATTCGGTTGAGTCCATTTCTCTGAAAAATTTGAAAATAATTCGTGGGG
AAAATCCGTGGATTTACAGGGAGGTCAAATTTTCACTGGTTGTGGTCAGC
AATATTATTGGTGAAAACATGTTGAAATATTTGATCTTGCCCAAATTTCA
GGTGATCTTGCAGCACAATATTTTGGTATACAATAATCCTGGAATGCTTT
ATTTTAAAAACAATATTCACTGGAATTCAATATTGGGAAAACATCAATTT
TTAGAGATTGTGGAACCTCATAATTCTTCAAATTTTACTTCTAAAGAAAT
TGGGGACCTAAGCTGTCATTCGTCATGCCAACCTCACATGGGAAAGCGAT
TCTGTTGGGGAAATTCGTCAGGTCAATGTCAAATAATCAATGATTGCGTG
AGGAAAACCTGCAAACTATCCAGCAAATGTTTTCTATATGGCGAGTTGAA
AATAGAGCAATGTTGTCATGAAGAATGCGTTGGGGGTTGTTATGGACCCC
TTAATACCCAATGTCTTATTTGTAAACATTTCAATAATCAAGGAGCCTGT
GTTGAAAAATGTCCAAGAAAATTGGTTCATAATGGCGTCAAGCACATAAA
AAATCGGCTGGAAAAATTTACTTTTCATAATACTTGTGTTGATAAATGCC
CAGATAAATATTTTATTGAAAATGAAAAATGCGTTCCTAAATGTAAGAAC
GGAGCCACATATGCCGTAAATGAGACTTGTCTGCCATGCCCAAATGGGGT
TTGCCCTAAAGATTGTCTTATTAAGGATGTCGTACAGAATTACAATATTC
AGTACCTAAATAGAAAGATGTTGGCTCGTCTTGAAAATTGCACAGTTTAC
CATGGCAATATTATCATAAATACTTTGTCAATTGAGGGTGATATCGGAAA
TGGCTGGCCAAAAAATATCTATGGAATTCAAGGAAAAGATTTAGAAAAGC
TAACAAACCTCAAAGAAATATATGGGTCTCTAGAAATTAACGTTGGATCA
AAAGCACCTTGGCTGAAAACGTTGCTTTACTTTAGAAATCTTGAGATAAT
TAGGGCAGAAACAACAAATAACAAACATTTAACTGGCTTGTCAATTAATC
AGAATGATGATTTGGTGTTTCTTGGTTTGCAAGAATTAAAGGAAGTAAGA
AACGGAATAGTAGAAATCGTTAACAATCCAAAATTATGCTACACCGACAG
CCTCACAAATAAAAGCATCCTTCACAGCAATCAAATGAACATTTATAATA
ATGGTAAAGATGGAAAATGCGAAGCTCGAAAATGTAGCAAACTCTGTCAT
CCAAAATATGGCTGCTGGGGTCCTCTAGGAATGTTTTGTGTGAAATGCAG
ACATTTTCAAATTACAGAGAAAAATATGTGCATTTCAAATTGCTCTAAAC
AACCTGGTTACTTTTACAATAAGGAAAACCATCAAACTCATGAAATGCAA
TGCTCAAAATGTCACAACCAATGCCTATCTAGCAACATTACGTGCTACGG
ACCGGGGGCCGATCAGTGCACCTTTGGATGTGTTAACTATAAGTACAATG
ATTACTGTACGGAGAAATGTCCCCAGGATCATTATGGAGATGGGTCTACA
TCTAATATTTGCAAAGCCTGTCATCAATCGTGTACAAAGGAAAACTTATT
CTCATTCAAAAGAACCTGCACAGGACCAGGAAATCACATAGGTGTAAATG
GCTGTCGAAAATGCAATTATGTACAACTACTAACGAATGGATCTGAAGGT
TTTATTAGCAGATTTACAGTCCATTCACTCACATGTATTCATTCTTCAAA
TAACTGCTTGGATGGTTATTTCAAGATATCTCTAGATTTCCATTCACCGG
AAAACATTATGAGTTTATTAAAATTATATTCAAACAATTCTTCTCTCAAA
ATGGTATTAGAGAATTGGATTGACAGACAAGCAAACCATGAATATCAATT
TGGAGCTATTTGTCTCCCATGTCATCCACTATGTTCCCAATGTAGTGACG
GGACAATAGAGAGCTGCCACCGATGCAAATCTCATAGAAGGGGCAAGGAA
TGTGTTCATAATTGTTATGAAGATGATTATATTTCTAAAAATTCGTCAAA
CGCTGAAAGCCTTTGTTTAAAGTGTCATGAAGAATGTATGGAAGGTTGTA
CTGGATCTACGGAATATGACTGCAAACAATGCAAGAGAGTCAAAATATAT
TTAAATTCTTCAAAAACGAAGTTTTTTTGCAATTCAATATGTGGCGATAA
TTTTCGGATTTTCGTTAATTCGGAAATGGTTTGCGTTCAACCGCAAGAAC
TGAAGCCCATCCAAAACAGCTGGTACATTGCGGCTGTTGGAGGTTCCGTT
GTGAGTGTTTTGGCTGTAGGAATCGTTTGGAAATGTATTTGCATGTCGTT
GAATAAAAGGAAACGTTATGATTTAAAGCTAAAATTTTCAAATGGATTCA
GTACTGTAGATATTGAGAGTGACTTTGCACCCAGCAGCACGAAGCTGCTA
CCAATTGCAGAAGGTCAACCGGCAAATGAACATATTTTAGATTTAGGAAA
GTTTTGTATTATGGATAAAGGAACATGGACACAAAAATCCAATAATACAA
ACTGCAAAAAATCTTGTTTTAAAGAATGTCTTTTTAAGATTATACCAGAT
GAGTTGGTAGGACTGAATGTGACTATAAAGGTTCTATCTGAATGTTCAGA
TCTGGCAGATAACAAAGATTTTTTACAGAAATTGAAAATCATCACTTCTA
CAGACCCACCTTGGAATTTGAGGATTATTTTGGTGGTGGTTTGTGCTTAT
TCAGAACTATCAAAACAACTTACTACGACTGGAAGCTTGATAGAATTCCT
CAAACAAAACCCTTCAGTGGTCGAAGATATTAGTATTCTTTTGTGGGCCC
ATCAAGTCGCTAGTGGCTTTGGATATATAAAATATGAAGGAATAATTAAT
TATGACGTTGAAACAAGCAATATAAAGATCGAGTCTCCTTTACGGATTGC
GATATCAGATTCAGGATTATCAAAATTATCCAATACATGTAATCGAATGA
AAAAGATTAAAGAAGGCAAGCTTGGGATTATTTGGTCGTTGAAAGAAAAT
TGTAATGATCAAGGCTTTTCATCGAAGTCCTCCGTTATGACCTACAATTG
CAATTCTGATCACGATACAAGACCAAATTTAAGAAAATTAAAACAATCAA
TTGAAATGATAATGAAAAATCCTTGCAGTTTCATAATTCTCCAGATTAAT
AGAGATATGTCTGAAAGACAAATTACAGTAGTCAATGGGCTCCATTCTCA
GATTATTTATCATGTAGAATCATCCGAAAGTAAACTTCAAAATGAAGATC
TAATAACAACGTTTAATAACCACTTGGAAGTTCCTGATGAATCACTTCGA
AACCCCACAAGCCATCATGAAGATATCGTAAACAATTTAATTTTAAATTA
AAAAATCTCAATTTACAACCACATTTGTTTTGATTACAATTATTTTTTCA
back to top

protein sequence of SMED30004546-orf-1

>SMED30004546-orf-1 ID=SMED30004546-orf-1|Name=SMED30004546-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1284bp
MGLVIPALVLLLSLRAIKPNPNHHKEINGNDSLVKINVSNFDRQASEFNL
KTNNASSDSFRRADSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNC
THVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRG
ENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGML
YFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKR
FCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGP
LNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKC
PDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNI
QYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEK
LTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSIN
QNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYN
NGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSK
QPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYN
DYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVN
GCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSP
ENIMSLLKLYSNNSSLKMVLENWIDRQANHEYQFGAICLPCHPLCSQCSD
GTIESCHRCKSHRRGKECVHNCYEDDYISKNSSNAESLCLKCHEECMEGC
TGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQE
LKPIQNSWYIAAVGGSVVSVLAVGIVWKCICMSLNKRKRYDLKLKFSNGF
STVDIESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNT
NCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITS
TDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWA
HQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRM
KKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCNSDHDTRPNLRKLKQS
IEMIMKNPCSFIILQINRDMSERQITVVNGLHSQIIYHVESSESKLQNED
LITTFNNHLEVPDESLRNPTSHHEDIVNNLILN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036941Rcpt_L-dom_sf
IPR020635Tyr_kinase_cat_dom
IPR006212Furin_repeat
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000494Rcpt_L-dom
IPR006211Furin-like_Cys-rich_dom
IPR032778GF_recep_IV
IPR011009Kinase-like_dom_sf
IPR009030Growth_fac_rcpt_cys_sf
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004713protein tyrosine kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006212Furin-like repeatSMARTSM00261furin_3coord: 615..663
e-value: 1.1E-5
score: 34.9
coord: 836..887
e-value: 0.0016
score: 27.7
coord: 668..742
e-value: 0.55
score: 19.3
coord: 554..606
e-value: 6.3E-5
score: 32.4
coord: 785..828
e-value: 0.007
score: 25.6
coord: 285..327
e-value: 2.1E-8
score: 43.9
IPR006212Furin-like repeatCDDcd00064FUcoord: 620..672
e-value: 3.45882E-4
score: 37.4984
IPR006212Furin-like repeatCDDcd00064FUcoord: 566..612
e-value: 0.00143031
score: 35.9576
IPR006212Furin-like repeatCDDcd00064FUcoord: 288..322
e-value: 2.7903E-6
score: 43.6616
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 974..1231
e-value: 0.0032
score: -128.0
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 1021..1182
e-value: 1.2E-15
score: 57.5
IPR032778Growth factor receptor domain 4PFAMPF14843GF_recep_IVcoord: 562..681
e-value: 3.5E-14
score: 52.7
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 561..670
e-value: 1.7E-20
score: 74.9
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 1015..1205
e-value: 1.2E-10
score: 42.9
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 273..383
e-value: 3.5E-22
score: 80.4
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 1020..1177
NoneNo IPR availablePANTHERPTHR24416:SF91EPIDERMAL GROWTH FACTOR RECEPTORcoord: 1020..1177
coord: 96..590
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 96..590
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.531
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 381..575
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 94..255
IPR000494Receptor L-domainPFAMPF01030Recep_L_domaincoord: 413..538
e-value: 6.6E-17
score: 61.7
coord: 99..211
e-value: 7.9E-15
score: 55.0
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 68..272
e-value: 6.1E-37
score: 129.1
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 386..560
e-value: 3.0E-29
score: 104.0
IPR006211Furin-like cysteine-rich domainPFAMPF00757Furin-likecoord: 242..389
e-value: 1.0E-20
score: 74.2
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 238..389
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 785..1010
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 561..681
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 1019..1151