Protein yippee-like

Overview
NameProtein yippee-like
Smed IDSMED30004523
Length (bp)897
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein yippee-like (SMED30004523) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein yippee-like (SMED30004523) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein yippee-like (SMED30004523) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein yippee-like (SMED30004523) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004523

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30004523SMESG000011702.1 dd_Smed_v4_5855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004523SMESG000011702.1 dd_Smed_v6_5855_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30004523SMESG000011702.1 dd_Smed_v4_5855_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein yippee-like vs. Ensembl Human
Match: YPEL3 (yippee like 3 [Source:HGNC Symbol;Acc:HGNC:18327])

HSP 1 Score: 176.792 bits (447), Expect = 2.021e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Human
Match: YPEL3 (yippee like 3 [Source:HGNC Symbol;Acc:HGNC:18327])

HSP 1 Score: 176.792 bits (447), Expect = 2.021e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Human
Match: YPEL3 (yippee like 3 [Source:HGNC Symbol;Acc:HGNC:18327])

HSP 1 Score: 176.792 bits (447), Expect = 2.021e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Human
Match: YPEL3 (yippee like 3 [Source:HGNC Symbol;Acc:HGNC:18327])

HSP 1 Score: 176.792 bits (447), Expect = 7.008e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:   46 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 157          
BLAST of Protein yippee-like vs. Ensembl Human
Match: YPEL2 (yippee like 2 [Source:HGNC Symbol;Acc:HGNC:18326])

HSP 1 Score: 174.866 bits (442), Expect = 1.278e-54
Identity = 84/115 (73.04%), Postives = 93/115 (80.87%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL    S +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGK+IIE+AH+IKD  WD
Sbjct:    8 KTFQAYL---PSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKYIIELAHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Celegans
Match: F37A8.5 (Protein yippee-like F37A8.5 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3G6])

HSP 1 Score: 166.392 bits (420), Expect = 1.735e-51
Identity = 80/120 (66.67%), Postives = 93/120 (77.50%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWDNVQPS 475
            KTF+ YL    + +  YSC HCRA+LA H  LISKSFQGSQG+AYLF++VVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGKFIIE+AH++KD  WD    S
Sbjct:   21 KTFQHYL---PAGDRCYSCIHCRANLAAHAELISKSFQGSQGKAYLFNAVVNVGCGPAEERVLLTGLHAVADIYCEICKTTLGWKYEHAFESSQKYKEGKFIIELAHMVKDNGWDEQNDS 137          
BLAST of Protein yippee-like vs. Ensembl Celegans
Match: B0546.4 (Protein yippee-like B0546.4 [Source:UniProtKB/Swiss-Prot;Acc:O44440])

HSP 1 Score: 80.8777 bits (198), Expect = 1.012e-18
Identity = 43/105 (40.95%), Postives = 54/105 (51.43%), Query Frame = 2
Query:  131 YLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIK 445
            + G   +   +Y C  C  +L     L SK+F GS G A LF    NV  G+ E R + TG H+V D+ C  C   LGW YE A   SQ YKE + IIE A+  K
Sbjct:    5 FAGICGARGSLYGCVVCNTYLTCSKELTSKAFTGSTGPATLFKRAWNVVYGRCEHRKMTTGWHTVRDVFCVTCNQKLGWMYEMAVSESQTYKETQVIIENANFEK 109          
BLAST of Protein yippee-like vs. Ensembl Celegans
Match: B0546.3 (pep chromosome:WBcel235:IV:3379355:3382834:-1 gene:WBGene00015250.1 transcript:B0546.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0546.3)

HSP 1 Score: 85.1149 bits (209), Expect = 1.873e-18
Identity = 43/113 (38.05%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  161 VYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD-------NVQPSC 478
            ++ C +C  +LA   +L+S SF G+ G+A+LF +V NV  G+   R +LTG H V D+ C+ CR  LGW YE A   ++KYKEG  I+E  ++ +   +        N+QP  
Sbjct:   14 MFFCTNCDTYLADKGHLVSTSFTGTTGQAFLFKNVTNVKFGESVVRNMLTGAHFVRDVFCQSCRAQLGWMYELAPNDNEKYKEGSVILERMNITEREAFSKISQMNGNLQPDA 126          
BLAST of Protein yippee-like vs. Ensembl Celegans
Match: B0546.4 (Protein yippee-like B0546.4 [Source:UniProtKB/Swiss-Prot;Acc:O44440])

HSP 1 Score: 80.4925 bits (197), Expect = 2.381e-18
Identity = 46/112 (41.07%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIK 445
            M + F    G + S   +Y C  C  +L     L SK+F GS G A LF    NV  G+ E R + TG H+V D+ C  C   LGW YE A   SQ YKE + IIE A+  K
Sbjct:    1 MGRQFAGICGARGS---LYGCVVCNTYLTCSKELTSKAFTGSTGPATLFKRAWNVVYGRCEHRKMTTGWHTVRDVFCVTCNQKLGWMYEMAVSESQTYKETQVIIENANFEK 109          
BLAST of Protein yippee-like vs. Ensembl Fly
Match: CG15309 (gene:FBgn0030183 transcript:FBtr0332899)

HSP 1 Score: 183.341 bits (464), Expect = 2.481e-58
Identity = 87/117 (74.36%), Postives = 97/117 (82.91%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+ YL    S N  YSC HCRAHLA HD LISKSFQGSQG AYLF+SVVNVA G+ E+RVLLTGLH+VADI CECC+T LGWKYE A+E SQKYKEGKFIIE+AH+IK+  WD
Sbjct:    1 MVKTFQAYL---PSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114          
BLAST of Protein yippee-like vs. Ensembl Fly
Match: CG15309 (gene:FBgn0030183 transcript:FBtr0112974)

HSP 1 Score: 183.341 bits (464), Expect = 2.481e-58
Identity = 87/117 (74.36%), Postives = 97/117 (82.91%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+ YL    S N  YSC HCRAHLA HD LISKSFQGSQG AYLF+SVVNVA G+ E+RVLLTGLH+VADI CECC+T LGWKYE A+E SQKYKEGKFIIE+AH+IK+  WD
Sbjct:    1 MVKTFQAYL---PSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114          
BLAST of Protein yippee-like vs. Ensembl Fly
Match: CG15309 (gene:FBgn0030183 transcript:FBtr0071487)

HSP 1 Score: 183.341 bits (464), Expect = 2.481e-58
Identity = 87/117 (74.36%), Postives = 97/117 (82.91%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+ YL    S N  YSC HCRAHLA HD LISKSFQGSQG AYLF+SVVNVA G+ E+RVLLTGLH+VADI CECC+T LGWKYE A+E SQKYKEGKFIIE+AH+IK+  WD
Sbjct:    1 MVKTFQAYL---PSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114          
BLAST of Protein yippee-like vs. Ensembl Fly
Match: CG15309 (gene:FBgn0030183 transcript:FBtr0332900)

HSP 1 Score: 183.341 bits (464), Expect = 2.481e-58
Identity = 87/117 (74.36%), Postives = 97/117 (82.91%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+ YL    S N  YSC HCRAHLA HD LISKSFQGSQG AYLF+SVVNVA G+ E+RVLLTGLH+VADI CECC+T LGWKYE A+E SQKYKEGKFIIE+AH+IK+  WD
Sbjct:    1 MVKTFQAYL---PSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114          
BLAST of Protein yippee-like vs. Ensembl Fly
Match: CG15309 (gene:FBgn0030183 transcript:FBtr0332898)

HSP 1 Score: 183.341 bits (464), Expect = 2.481e-58
Identity = 87/117 (74.36%), Postives = 97/117 (82.91%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+ YL    S N  YSC HCRAHLA HD LISKSFQGSQG AYLF+SVVNVA G+ E+RVLLTGLH+VADI CECC+T LGWKYE A+E SQKYKEGKFIIE+AH+IK+  WD
Sbjct:    1 MVKTFQAYL---PSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114          
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Match: ypel2b (yippee-like 2b [Source:ZFIN;Acc:ZDB-GENE-110419-2])

HSP 1 Score: 174.866 bits (442), Expect = 7.137e-55
Identity = 84/115 (73.04%), Postives = 93/115 (80.87%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL    + +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGKFIIE+AH+IKD  WD
Sbjct:    8 KTFQAYL---PNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Match: ypel2b (yippee-like 2b [Source:ZFIN;Acc:ZDB-GENE-110419-2])

HSP 1 Score: 174.866 bits (442), Expect = 7.137e-55
Identity = 84/115 (73.04%), Postives = 93/115 (80.87%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL    + +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGKFIIE+AH+IKD  WD
Sbjct:    8 KTFQAYL---PNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Match: ypel2b (yippee-like 2b [Source:ZFIN;Acc:ZDB-GENE-110419-2])

HSP 1 Score: 174.866 bits (442), Expect = 7.137e-55
Identity = 84/115 (73.04%), Postives = 93/115 (80.87%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL    + +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGKFIIE+AH+IKD  WD
Sbjct:    8 KTFQAYL---PNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Match: ypel3 (yippee-like 3 [Source:NCBI gene;Acc:368214])

HSP 1 Score: 174.481 bits (441), Expect = 9.160e-55
Identity = 84/116 (72.41%), Postives = 94/116 (81.03%), Query Frame = 2
Query:  113 VKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
             KTF+ YL    S +  YSC HCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+R+LLTGLH+VADI CE C T LGWKYEQAFE SQKYKEGKFIIE++H+IKD  WD
Sbjct:    7 AKTFQAYL---DSCHRRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKFIIELSHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Match: ypel3 (yippee-like 3 [Source:NCBI gene;Acc:368214])

HSP 1 Score: 174.481 bits (441), Expect = 9.160e-55
Identity = 84/116 (72.41%), Postives = 94/116 (81.03%), Query Frame = 2
Query:  113 VKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
             KTF+ YL    S +  YSC HCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+R+LLTGLH+VADI CE C T LGWKYEQAFE SQKYKEGKFIIE++H+IKD  WD
Sbjct:    7 AKTFQAYL---DSCHRRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKFIIELSHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Xenopus
Match: ypel1 (yippee like 1 [Source:NCBI gene;Acc:549459])

HSP 1 Score: 172.94 bits (437), Expect = 5.174e-54
Identity = 83/115 (72.17%), Postives = 93/115 (80.87%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL    + +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGKFIIE+AH+IKD  W+
Sbjct:    8 KTFQAYL---PNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE 119          
BLAST of Protein yippee-like vs. Ensembl Xenopus
Match: YPEL2 (yippee like 2 [Source:HGNC Symbol;Acc:HGNC:18326])

HSP 1 Score: 146.747 bits (369), Expect = 1.081e-43
Identity = 70/115 (60.87%), Postives = 83/115 (72.17%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL    S +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKY  +   SQK+K G ++ E  H ++ + W 
Sbjct:    8 KTFQAYL---PSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYFHSINTSQKFKTGGYLFENVHRVRKSGWS 119          
BLAST of Protein yippee-like vs. Ensembl Xenopus
Match: YPEL2 (yippee like 2 [Source:HGNC Symbol;Acc:HGNC:18326])

HSP 1 Score: 127.102 bits (318), Expect = 3.544e-36
Identity = 63/89 (70.79%), Postives = 69/89 (77.53%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQA 382
            KTF+ YL    S +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKY  A
Sbjct:    8 KTFQAYL---PSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYPYA 93          
BLAST of Protein yippee-like vs. Ensembl Xenopus
Match: bmp5 (bone morphogenetic protein 5 [Source:Xenbase;Acc:XB-GENE-479371])

HSP 1 Score: 100.908 bits (250), Expect = 4.379e-26
Identity = 49/117 (41.88%), Postives = 72/117 (61.54%), Query Frame = 2
Query:  125 KVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWDNVQPS 475
            +++L D      ++SCA+C   L     LIS  F G+ GRA+LF+ VVN+   + +DRV+LTG H V D+ C+ C + LGW YE A E SQ+YKEG+ I+E A + +   ++   PS
Sbjct:    3 RIFL-DHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPS 118          
BLAST of Protein yippee-like vs. Ensembl Mouse
Match: Ypel3 (yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340])

HSP 1 Score: 176.792 bits (447), Expect = 1.388e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Mouse
Match: Ypel3 (yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340])

HSP 1 Score: 176.792 bits (447), Expect = 1.388e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Mouse
Match: Ypel3 (yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340])

HSP 1 Score: 176.792 bits (447), Expect = 1.388e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Mouse
Match: Ypel3 (yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340])

HSP 1 Score: 176.792 bits (447), Expect = 1.388e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Mouse
Match: Ypel2 (yippee like 2 [Source:MGI Symbol;Acc:MGI:1925114])

HSP 1 Score: 174.866 bits (442), Expect = 8.773e-55
Identity = 84/115 (73.04%), Postives = 93/115 (80.87%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL    S +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGK+IIE+AH+IKD  WD
Sbjct:    8 KTFQAYL---PSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKYIIELAHMIKDNGWD 119          
BLAST of Protein yippee-like vs. UniProt/SwissProt
Match: sp|Q9W2X7|YPL1_DROME (Protein yippee-like CG15309 OS=Drosophila melanogaster OX=7227 GN=CG15309 PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 2.487e-57
Identity = 87/117 (74.36%), Postives = 97/117 (82.91%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+ YL    S N  YSC HCRAHLA HD LISKSFQGSQG AYLF+SVVNVA G+ E+RVLLTGLH+VADI CECC+T LGWKYE A+E SQKYKEGKFIIE+AH+IK+  WD
Sbjct:    1 MVKTFQAYL---PSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114          
BLAST of Protein yippee-like vs. UniProt/SwissProt
Match: sp|P61237|YPEL3_MOUSE (Protein yippee-like 3 OS=Mus musculus OX=10090 GN=Ypel3 PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.706e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. UniProt/SwissProt
Match: sp|P61236|YPEL3_HUMAN (Protein yippee-like 3 OS=Homo sapiens OX=9606 GN=YPEL3 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.706e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. UniProt/SwissProt
Match: sp|Q65Z57|YPEL3_CHLAE (Protein yippee-like 3 OS=Chlorocebus aethiops OX=9534 GN=YPEL3 PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.706e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. UniProt/SwissProt
Match: sp|A6QPH8|YPEL3_BOVIN (Protein yippee-like 3 OS=Bos taurus OX=9913 GN=YPEL3 PE=3 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 9.706e-55
Identity = 85/115 (73.91%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL D       YSCAHCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYEQAFE SQKYKEGK+IIE+ H+IKD  WD
Sbjct:    8 KTFQAYLDDCHRR---YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119          
BLAST of Protein yippee-like vs. TrEMBL
Match: A0A0V0J4R2 (Protein yippee-like OS=Schistocephalus solidus OX=70667 GN=YPEL2 PE=3 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 8.082e-59
Identity = 97/141 (68.79%), Postives = 109/141 (77.30%), Query Frame = 2
Query:  110 MVKTFKVYLGDKS------------------SNNPV------YSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+VYL   S                  +++PV      YSC HCRAHLA+H +LISKSFQGSQGRAYLF++VVNV+SGKPEDR+LLTGLHSVADI CECCRTVLGWKYEQAFEPSQKYKEGK+IIE+AHLIKD  WD
Sbjct:    1 MVKTFQVYLDVNSGGTSRCASSSSTSSTGGGADSPVILDERTYSCVHCRAHLARHQDLISKSFQGSQGRAYLFENVVNVSSGKPEDRLLLTGLHSVADIYCECCRTVLGWKYEQAFEPSQKYKEGKYIIELAHLIKDNGWD 141          
BLAST of Protein yippee-like vs. TrEMBL
Match: G4V8Z0 (Protein yippee-like OS=Schistosoma mansoni OX=6183 GN=Smp_200020 PE=3 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 2.152e-57
Identity = 92/137 (67.15%), Postives = 106/137 (77.37%), Query Frame = 2
Query:  110 MVKTFKVYLGDKS------------------SNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWDNV 466
            MVKTF+VYLG +                   +++  YSC HCRAHLA+H +LISKSFQGSQGRAYLFD+VVNV+ GKPE+R+LLTGLHSVADI C+CC TVLGWKYEQAFE SQKYKEGK+IIE+AHLIKD  WD V
Sbjct:    1 MVKTFQVYLGAQGNSSTRSNSSNSSCSNSSDTDDRTYSCVHCRAHLARHQDLISKSFQGSQGRAYLFDTVVNVSCGKPEERLLLTGLHSVADIYCDCCHTVLGWKYEQAFESSQKYKEGKYIIELAHLIKDNGWDWV 137          
BLAST of Protein yippee-like vs. TrEMBL
Match: A0A504YTP1 (Protein yippee-like OS=Fasciola gigantica OX=46835 GN=FGIG_10802 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 4.757e-57
Identity = 91/134 (67.91%), Postives = 104/134 (77.61%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSS-----------------NNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+VYLG +                   ++  YSC HCRAHLA+H +LISKSFQGSQGRAYLFD+VVNV+ GKPE+R+LLTGLHSVADI CECC TVLGWKYEQA+E SQKYKEGK+IIE+AHLIKD  WD
Sbjct:    1 MVKTFQVYLGAQGGSSSRSASSNSSCSNSSEDDRTYSCVHCRAHLARHQDLISKSFQGSQGRAYLFDTVVNVSCGKPEERLLLTGLHSVADIFCECCHTVLGWKYEQAYESSQKYKEGKYIIELAHLIKDNGWD 134          
BLAST of Protein yippee-like vs. TrEMBL
Match: A0A4E0RLN8 (Protein yippee-like OS=Fasciola hepatica OX=6192 GN=D915_001678 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 4.757e-57
Identity = 91/134 (67.91%), Postives = 104/134 (77.61%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSS-----------------NNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+VYLG +                   ++  YSC HCRAHLA+H +LISKSFQGSQGRAYLFD+VVNV+ GKPE+R+LLTGLHSVADI CECC TVLGWKYEQA+E SQKYKEGK+IIE+AHLIKD  WD
Sbjct:    1 MVKTFQVYLGAQGGSSSRSASSNSSCSNSSEDDRTYSCVHCRAHLARHQDLISKSFQGSQGRAYLFDTVVNVSCGKPEERLLLTGLHSVADIFCECCHTVLGWKYEQAYESSQKYKEGKYIIELAHLIKDNGWD 134          
BLAST of Protein yippee-like vs. TrEMBL
Match: A0A5J4NG53 (Protein yippee-like OS=Paragonimus westermani OX=34504 GN=DEA37_0004345 PE=3 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 4.841e-57
Identity = 91/134 (67.91%), Postives = 105/134 (78.36%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSSN-----------------NPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+VYLG + +N                 +  YSC HCRAHLA+H +LISKSFQGSQGRAYLFD+VVNV+ GKPE+R+LLTGLHSVADI C+CC TVLGWKYEQA+E SQKYKEGK+IIE+AHLIKD  WD
Sbjct:   14 MVKTFQVYLGAQGTNSSRSASSNSSCSTGSDDDRTYSCVHCRAHLARHQDLISKSFQGSQGRAYLFDTVVNVSCGKPEERLLLTGLHSVADIFCDCCHTVLGWKYEQAYEISQKYKEGKYIIELAHLIKDNGWD 147          
BLAST of Protein yippee-like vs. Ensembl Cavefish
Match: ENSAMXT00000017245.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:35436515:35459142:-1 gene:ENSAMXG00000016749.2 transcript:ENSAMXT00000017245.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 1.056e-54
Identity = 84/115 (73.04%), Postives = 93/115 (80.87%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL +    +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGKFIIE+AH+IKD  WD
Sbjct:   33 KTFQAYLPN---CHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWD 144          
BLAST of Protein yippee-like vs. Ensembl Cavefish
Match: ypel2b (protein yippee-like 1 [Source:NCBI gene;Acc:103022942])

HSP 1 Score: 173.711 bits (439), Expect = 1.440e-54
Identity = 83/115 (72.17%), Postives = 93/115 (80.87%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL    + +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGKFIIE+AH+IKD  W+
Sbjct:    8 KTFQAYL---PTCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE 119          
BLAST of Protein yippee-like vs. Ensembl Cavefish
Match: ypel3 (protein yippee-like 3 [Source:NCBI gene;Acc:103040367])

HSP 1 Score: 173.711 bits (439), Expect = 2.930e-54
Identity = 83/116 (71.55%), Postives = 94/116 (81.03%), Query Frame = 2
Query:  113 VKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
             KTF+ YL    S +  YSC HCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+R+LLTGLH+VADI CE C T LGWKYEQAFE SQKYKEGK+IIE++H+IKD  WD
Sbjct:   29 AKTFQAYL---DSCHRRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKYIIELSHMIKDNGWD 141          
BLAST of Protein yippee-like vs. Ensembl Cavefish
Match: ypel3 (protein yippee-like 3 [Source:NCBI gene;Acc:103040367])

HSP 1 Score: 173.711 bits (439), Expect = 4.649e-54
Identity = 83/115 (72.17%), Postives = 94/115 (81.74%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL    S +  YSC HCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+R+LLTGLH+VADI CE C T LGWKYEQAFE SQKYKEGK+IIE++H+IKD  WD
Sbjct:   36 KTFQAYL---DSCHRRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKYIIELSHMIKDNGWD 147          
BLAST of Protein yippee-like vs. Ensembl Cavefish
Match: ypel1 (yippee like 1 [Source:NCBI gene;Acc:103042592])

HSP 1 Score: 173.326 bits (438), Expect = 3.041e-53
Identity = 83/115 (72.17%), Postives = 93/115 (80.87%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL +    +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGKFIIE+AH+IKD  W+
Sbjct:   88 KTFQAYLPN---CHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE 199          
BLAST of Protein yippee-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003901.1 (pep scaffold:Pmarinus_7.0:GL476703:5356:9476:-1 gene:ENSPMAG00000003573.1 transcript:ENSPMAT00000003901.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.227 bits (269), Expect = 1.074e-29
Identity = 55/96 (57.29%), Postives = 67/96 (69.79%), Query Frame = 2
Query:  173 AHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            AHC     +HD+LI+      +G+  +    VNV  G  E+R+LLTGLH+VADI CE C T LGWKYE AFE SQKYKEGK+IIEVAH+IKD  W+
Sbjct:   28 AHC-PRCNRHDSLIASETAIGKGKK-VKGLRVNVGCGPAEERLLLTGLHAVADIYCENCNTTLGWKYEHAFESSQKYKEGKYIIEVAHMIKDNGWE 121          
BLAST of Protein yippee-like vs. Ensembl Sea Lamprey
Match: ypel5 (yippee-like 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1220])

HSP 1 Score: 100.138 bits (248), Expect = 1.178e-26
Identity = 47/117 (40.17%), Postives = 73/117 (62.39%), Query Frame = 2
Query:  125 KVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWDNVQPS 475
            +++L D      ++SCA+C   L     LIS  F G+ GRA+LF+ VVN++  + +DRV+LTG H V D+ C+ C + LGW YE A E +Q+YKEG+ I+E A + +   ++   P+
Sbjct:    3 RIFL-DHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLSFSEVQDRVMLTGRHMVRDVSCKNCNSKLGWMYEFATEDNQRYKEGRVILERALVRESEGFEEHVPA 118          
BLAST of Protein yippee-like vs. Ensembl Yeast
Match: MOH1 (Protein of unknown function, essential for stationary phase survival; not required for growth on nonfermentable carbon sources; possibly linked with vacuolar transport [Source:SGD;Acc:S000000145])

HSP 1 Score: 96.6709 bits (239), Expect = 2.266e-25
Identity = 45/96 (46.88%), Postives = 62/96 (64.58%), Query Frame = 2
Query:  164 YSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDT 451
            Y C HC+ HL+    +IS+ ++G  G AYL + VVNV  GK E R +LTG + V DI C  C+  +GWKY Q+    Q+YKEGKFI+E+ ++ K T
Sbjct:   43 YGCRHCKTHLSSSFQIISRDYRGRTGTAYLMNKVVNVVEGKVEQRRMLTGDYLVCDILCHWCKRNVGWKYLQSSNDDQQYKEGKFILELKNICKCT 138          
BLAST of Protein yippee-like vs. Ensembl Nematostella
Match: EDO47518 (Protein yippee-like [Source:UniProtKB/TrEMBL;Acc:A7RM06])

HSP 1 Score: 177.563 bits (449), Expect = 1.952e-56
Identity = 84/117 (71.79%), Postives = 95/117 (81.20%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            MVKTF+ YL D    +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+ VVNV  G  E+RVLLTGLH+V+DI CECC+T LGWKYE AFE SQKYKEGK+IIE+AH+IKD  W+
Sbjct:    1 MVKTFQAYLLD---CHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNKVVNVGCGPAEERVLLTGLHAVSDIFCECCKTTLGWKYEHAFEISQKYKEGKYIIEMAHMIKDNGWE 114          
BLAST of Protein yippee-like vs. Ensembl Nematostella
Match: EDO44220 (Protein yippee-like [Source:UniProtKB/TrEMBL;Acc:A7RW79])

HSP 1 Score: 101.679 bits (252), Expect = 4.752e-27
Identity = 48/103 (46.60%), Postives = 67/103 (65.05%), Query Frame = 2
Query:  125 KVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVA 433
            +++L D    + +YSCA+C   L     LIS  F G+ GRA+LF  VVN++  + +DRV+LTG H V D+ C+ C T LGW YE A E +Q+YKEG+ I+E A
Sbjct:    3 RIFL-DHPGGSKLYSCANCDTVLTNRSELISMRFTGATGRAFLFHKVVNLSYSEVQDRVMLTGRHMVRDVSCKNCDTKLGWMYEYATEENQRYKEGRVILERA 104          
BLAST of Protein yippee-like vs. Ensembl Medaka
Match: ypelc (yippee-like c [Source:NCBI gene;Acc:100529170])

HSP 1 Score: 174.481 bits (441), Expect = 8.883e-55
Identity = 84/115 (73.04%), Postives = 93/115 (80.87%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            KTF+ YL    S +  YSC HCRAHLA HD LISKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGKFIIE+AH+IKD  W+
Sbjct:    8 KTFQAYL---PSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE 119          
BLAST of Protein yippee-like vs. Ensembl Medaka
Match: ypela (yippee-like a [Source:NCBI gene;Acc:100049286])

HSP 1 Score: 173.326 bits (438), Expect = 2.489e-54
Identity = 83/116 (71.55%), Postives = 94/116 (81.03%), Query Frame = 2
Query:  113 VKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
             KTF+ YL    S +  YSC HCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+R+LLTGLH+VADI CE C T LGWKYEQAFE SQKYKEGK+IIE++H+IKD  WD
Sbjct:    7 AKTFQAYL---DSCHRRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKYIIELSHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Medaka
Match: ypela (yippee-like a [Source:NCBI gene;Acc:100049286])

HSP 1 Score: 173.326 bits (438), Expect = 2.489e-54
Identity = 83/116 (71.55%), Postives = 94/116 (81.03%), Query Frame = 2
Query:  113 VKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
             KTF+ YL    S +  YSC HCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+R+LLTGLH+VADI CE C T LGWKYEQAFE SQKYKEGK+IIE++H+IKD  WD
Sbjct:    7 AKTFQAYL---DSCHRRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKYIIELSHMIKDNGWD 119          
BLAST of Protein yippee-like vs. Ensembl Medaka
Match: ypela (yippee-like a [Source:NCBI gene;Acc:100049286])

HSP 1 Score: 167.933 bits (424), Expect = 3.741e-52
Identity = 84/119 (70.59%), Postives = 95/119 (79.83%), Query Frame = 2
Query:  116 KTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWDNVQP 472
            KTF+ YL    S +  YSC HCRAHLA HD+LISKSFQGSQGRAYLF+SVVNV  G  E+R+LLTGLH+VADI CE C T LGWKYEQAFE SQKYKEGK+IIE++H+IK    DNVQ 
Sbjct:    8 KTFQAYL---DSCHRRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKYIIELSHMIK----DNVQK 119          
BLAST of Protein yippee-like vs. Ensembl Medaka
Match: ENSORLT00000042156.1 (pep primary_assembly:ASM223467v1:13:22360072:22372810:1 gene:ENSORLG00000029645.1 transcript:ENSORLT00000042156.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.198 bits (352), Expect = 6.571e-41
Identity = 65/84 (77.38%), Postives = 72/84 (85.71%), Query Frame = 2
Query:  209 LISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
             +SKSFQGSQGRAYLF+SVVNV  G  E+RVLLTGLH+VADI CE C+T LGWKYE AFE SQKYKEGKFIIE+AH+IKD  WD
Sbjct:   76 FLSKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWD 159          
BLAST of Protein yippee-like vs. Planmine SMEST
Match: SMESG000011702.1 (SMESG000011702.1)

HSP 1 Score: 319.316 bits (817), Expect = 3.756e-111
Identity = 177/177 (100.00%), Postives = 177/177 (100.00%), Query Frame = 2
Query:  110 MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWDNVQPSCSYQCSSPTYSCEINSMFXXXXXXXXXXXXFTAXXXXXXXXXXXKHHLPSPGRSD 640
            MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWDNVQPSCSYQCSSPTYSCEINSMFSSPLSLSPISPPFTASENESTNNENTKHHLPSPGRSD
Sbjct:    1 MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWDNVQPSCSYQCSSPTYSCEINSMFSSPLSLSPISPPFTASENESTNNENTKHHLPSPGRSD 177          
BLAST of Protein yippee-like vs. Planmine SMEST
Match: SMESG000069906.1 (SMESG000069906.1)

HSP 1 Score: 165.622 bits (418), Expect = 6.246e-48
Identity = 74/101 (73.27%), Postives = 88/101 (87.13%), Query Frame = 2
Query:  158 PVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIEVAHLIKDTNWD 460
            P+YSC HCRA+LA H +LISKSFQGSQGRAYLF++VVNV S   E+R+LLTGLH VADI CECC  +LGWKYE+AFEP+Q+YKEGK+IIE+A+LIKD  WD
Sbjct:   18 PIYSCIHCRANLAHHRDLISKSFQGSQGRAYLFNNVVNVGSLVAEERMLLTGLHYVADIYCECCSFILGWKYERAFEPNQRYKEGKYIIELANLIKDNCWD 118          
BLAST of Protein yippee-like vs. Planmine SMEST
Match: SMESG000074324.1 (SMESG000074324.1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.136e-24
Identity = 49/102 (48.04%), Postives = 63/102 (61.76%), Query Frame = 2
Query:  122 FKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIE 427
            F  +LG K     +  C  C   L+  D +IS  F G+ GRA+LF+ VVN+ S + EDRV+LTG H V D+ C  C   LGW YEQA + SQ+YKEGK I+E
Sbjct:    5 FIEHLGGKR----IIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILE 102          
BLAST of Protein yippee-like vs. Planmine SMEST
Match: SMESG000074331.1 (SMESG000074331.1)

HSP 1 Score: 92.4337 bits (228), Expect = 4.185e-23
Identity = 47/102 (46.08%), Postives = 62/102 (60.78%), Query Frame = 2
Query:  122 FKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIE 427
            F  +LG K     +  C  C   L+  D +IS  F G  GRA+LF+ VVN+ S + +DR++LTG H V D+ C  C   LGW YEQA + SQ+YKEGK I+E
Sbjct:    5 FIEHLGGKR----IIQCQACDTPLSNKDEIISTRFSGVTGRAFLFNKVVNIYSTELQDRLMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILE 102          
The following BLAST results are available for this feature:
BLAST of Protein yippee-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YPEL32.021e-5573.91yippee like 3 [Source:HGNC Symbol;Acc:HGNC:18327][more]
YPEL32.021e-5573.91yippee like 3 [Source:HGNC Symbol;Acc:HGNC:18327][more]
YPEL32.021e-5573.91yippee like 3 [Source:HGNC Symbol;Acc:HGNC:18327][more]
YPEL37.008e-5573.91yippee like 3 [Source:HGNC Symbol;Acc:HGNC:18327][more]
YPEL21.278e-5473.04yippee like 2 [Source:HGNC Symbol;Acc:HGNC:18326][more]
back to top
BLAST of Protein yippee-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
F37A8.51.735e-5166.67Protein yippee-like F37A8.5 [Source:UniProtKB/Swi... [more]
B0546.41.012e-1840.95Protein yippee-like B0546.4 [Source:UniProtKB/Swi... [more]
B0546.31.873e-1838.05pep chromosome:WBcel235:IV:3379355:3382834:-1 gene... [more]
B0546.42.381e-1841.07Protein yippee-like B0546.4 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG153092.481e-5874.36gene:FBgn0030183 transcript:FBtr0332899[more]
CG153092.481e-5874.36gene:FBgn0030183 transcript:FBtr0112974[more]
CG153092.481e-5874.36gene:FBgn0030183 transcript:FBtr0071487[more]
CG153092.481e-5874.36gene:FBgn0030183 transcript:FBtr0332900[more]
CG153092.481e-5874.36gene:FBgn0030183 transcript:FBtr0332898[more]
back to top
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ypel2b7.137e-5573.04yippee-like 2b [Source:ZFIN;Acc:ZDB-GENE-110419-2][more]
ypel2b7.137e-5573.04yippee-like 2b [Source:ZFIN;Acc:ZDB-GENE-110419-2][more]
ypel2b7.137e-5573.04yippee-like 2b [Source:ZFIN;Acc:ZDB-GENE-110419-2][more]
ypel39.160e-5572.41yippee-like 3 [Source:NCBI gene;Acc:368214][more]
ypel39.160e-5572.41yippee-like 3 [Source:NCBI gene;Acc:368214][more]
back to top
BLAST of Protein yippee-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ypel15.174e-5472.17yippee like 1 [Source:NCBI gene;Acc:549459][more]
YPEL21.081e-4360.87yippee like 2 [Source:HGNC Symbol;Acc:HGNC:18326][more]
YPEL23.544e-3670.79yippee like 2 [Source:HGNC Symbol;Acc:HGNC:18326][more]
bmp54.379e-2641.88bone morphogenetic protein 5 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ypel31.388e-5573.91yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340][more]
Ypel31.388e-5573.91yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340][more]
Ypel31.388e-5573.91yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340][more]
Ypel31.388e-5573.91yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340][more]
Ypel28.773e-5573.04yippee like 2 [Source:MGI Symbol;Acc:MGI:1925114][more]
back to top
BLAST of Protein yippee-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W2X7|YPL1_DROME2.487e-5774.36Protein yippee-like CG15309 OS=Drosophila melanoga... [more]
sp|P61237|YPEL3_MOUSE9.706e-5573.91Protein yippee-like 3 OS=Mus musculus OX=10090 GN=... [more]
sp|P61236|YPEL3_HUMAN9.706e-5573.91Protein yippee-like 3 OS=Homo sapiens OX=9606 GN=Y... [more]
sp|Q65Z57|YPEL3_CHLAE9.706e-5573.91Protein yippee-like 3 OS=Chlorocebus aethiops OX=9... [more]
sp|A6QPH8|YPEL3_BOVIN9.706e-5573.91Protein yippee-like 3 OS=Bos taurus OX=9913 GN=YPE... [more]
back to top
BLAST of Protein yippee-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J4R28.082e-5968.79Protein yippee-like OS=Schistocephalus solidus OX=... [more]
G4V8Z02.152e-5767.15Protein yippee-like OS=Schistosoma mansoni OX=6183... [more]
A0A504YTP14.757e-5767.91Protein yippee-like OS=Fasciola gigantica OX=46835... [more]
A0A4E0RLN84.757e-5767.91Protein yippee-like OS=Fasciola hepatica OX=6192 G... [more]
A0A5J4NG534.841e-5767.91Protein yippee-like OS=Paragonimus westermani OX=3... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000017245.21.056e-5473.04pep primary_assembly:Astyanax_mexicanus-2.0:20:354... [more]
ypel2b1.440e-5472.17protein yippee-like 1 [Source:NCBI gene;Acc:103022... [more]
ypel32.930e-5471.55protein yippee-like 3 [Source:NCBI gene;Acc:103040... [more]
ypel34.649e-5472.17protein yippee-like 3 [Source:NCBI gene;Acc:103040... [more]
ypel13.041e-5372.17yippee like 1 [Source:NCBI gene;Acc:103042592][more]
back to top
BLAST of Protein yippee-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003901.11.074e-2957.29pep scaffold:Pmarinus_7.0:GL476703:5356:9476:-1 ge... [more]
ypel51.178e-2640.17yippee-like 5 [Source:ZFIN;Acc:ZDB-GENE-040426-122... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MOH12.266e-2546.88Protein of unknown function, essential for station... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO475181.952e-5671.79Protein yippee-like [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO442204.752e-2746.60Protein yippee-like [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ypelc8.883e-5573.04yippee-like c [Source:NCBI gene;Acc:100529170][more]
ypela2.489e-5471.55yippee-like a [Source:NCBI gene;Acc:100049286][more]
ypela2.489e-5471.55yippee-like a [Source:NCBI gene;Acc:100049286][more]
ypela3.741e-5270.59yippee-like a [Source:NCBI gene;Acc:100049286][more]
ENSORLT00000042156.16.571e-4177.38pep primary_assembly:ASM223467v1:13:22360072:22372... [more]
back to top
BLAST of Protein yippee-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000011702.13.756e-111100.00SMESG000011702.1[more]
SMESG000069906.16.246e-4873.27SMESG000069906.1[more]
SMESG000074324.12.136e-2448.04SMESG000074324.1[more]
SMESG000074331.14.185e-2346.08SMESG000074331.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004523 ID=SMED30004523|Name=Protein yippee-like|organism=Schmidtea mediterranea sexual|type=transcript|length=897bp
ATTTATATTAAAGTCAGCTGACGACGAGTAAGGCCATATGTTGTTTTTGA
TTTTACTAAGATAGTTTGAAGATATTTAATTTTACTTTTCTTTCTAACAT
TATTTTATTATGGTAAAAACATTCAAAGTCTATTTGGGAGATAAATCTAG
TAATAATCCAGTTTATAGTTGTGCACATTGCCGTGCACATTTAGCAAAAC
ATGATAACCTAATATCAAAATCATTTCAAGGAAGTCAAGGCCGTGCATAT
CTTTTTGACTCTGTCGTTAATGTTGCCTCAGGAAAACCAGAAGATAGAGT
TTTATTAACTGGTCTACACAGTGTTGCCGATATCAAATGTGAATGTTGTC
GCACTGTTCTCGGTTGGAAATACGAGCAAGCGTTTGAACCAAGTCAGAAA
TATAAAGAAGGTAAATTCATAATAGAAGTCGCTCATTTAATCAAAGACAC
AAATTGGGATAACGTGCAACCCAGTTGTAGTTATCAATGCAGCTCTCCGA
CATATTCCTGTGAAATTAATTCAATGTTTTCTTCGCCTCTATCATTATCG
CCTATTTCTCCGCCTTTTACTGCCTCAGAAAACGAATCTACAAATAACGA
AAACACAAAACATCATTTGCCTTCTCCTGGAAGATCTGATTAATTTTTGG
TTTTCGCTTTCACGTTTCTCTATCTCTATAAATTAATTTGTAAAATATTT
GATTTATTCACTGTTTTATTAATCGTGTAGAAATAGTTTTGTTTCTATAT
CTATCTCTCACTATCTCTCTCTTTTGTTGTTCTGACGCTACCTCGTTGCG
ATTTTGACAGATAAATATATGTTATCAAAAGAAATATGCCAGAATCATTA
ACTGTGAACTTTGCGATCTTGTAAATTATAATTATTATTATTATTAT
back to top

protein sequence of SMED30004523-orf-1

>SMED30004523-orf-1 ID=SMED30004523-orf-1|Name=SMED30004523-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=178bp
MVKTFKVYLGDKSSNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFD
SVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKE
GKFIIEVAHLIKDTNWDNVQPSCSYQCSSPTYSCEINSMFSSPLSLSPIS
PPFTASENESTNNENTKHHLPSPGRSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039058Yippee_fam
IPR034751Yippee
IPR004910Yippee/Mis18/Cereblon
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004910Yippee/Mis18/CereblonPFAMPF03226Yippee-Mis18coord: 18..112
e-value: 1.7E-13
score: 50.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 151..177
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 151..169
NoneNo IPR availablePANTHERPTHR13848:SF6PROTEIN YIPPEE-LIKE 3coord: 3..114
IPR039058Yippee familyPANTHERPTHR13848FAMILY NOT NAMEDcoord: 3..114
IPR034751Yippee domainPROSITEPS51792YIPPEEcoord: 17..114
score: 49.697