Novel protein

Overview
NameNovel protein
Smed IDSMED30004519
Length (bp)931
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Novel protein (SMED30004519) t-SNE clustered cells

Violin plots show distribution of expression levels for Novel protein (SMED30004519) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Novel protein (SMED30004519) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Novel protein (SMED30004519) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004519

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004519SMESG000039682.1 SmedASXL_005287SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30004519SMESG000039682.1 dd_Smed_v4_2676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004519SMESG000039682.1 dd_Smed_v4_2676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004519SMESG000039682.1 dd_Smed_v4_2676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004519SMESG000039682.1 dd_Smed_v4_2676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004519SMESG000039682.1 dd_Smed_v4_2676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30004519SMESG000039682.1 dd_Smed_v4_2676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30004519SMESG000039682.1 dd_Smed_v4_2676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004519SMESG000039682.1 Contig49525newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004519SMESG000039682.1 Contig49525uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30004519SMESG000039682.1 dd_Smed_v6_2676_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30004519SMESG000039682.1 dd_Smed_v4_2676_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30004519SMESG000039682.1 dd_Smed_v4_2676_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Novel protein vs. Ensembl Human
Match: CFAP97D1 (CFAP97 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:37241])

HSP 1 Score: 93.2041 bits (230), Expect = 1.791e-22
Identity = 49/140 (35.00%), Postives = 85/140 (60.71%), Query Frame = 1
Query:   82 QSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAY 501
            QS   + K D  +Y +H  +++   P +DT+ P  + +  LKL K++ E++++  IE +N+ L +K++   R   +VD  N Y SKSLNRE + REL+R+  ENQ I++R++++KP Y  +  E +W  +  YI + + Y
Sbjct:   19 QSTTFRKKLDFGHYVSHKNRIQIAKPTVDTKPPVAHTNHILKLSKLQGEQKKINKIEYENKQLCQKIANAHRGPAKVDCWNEYFSKSLNRETRNRELVRITMENQGILKRLVDRKPHYDRRASEIDWQNSRRYIRNTTRY 158          
BLAST of Novel protein vs. Ensembl Human
Match: CFAP97D2 (CFAP97 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:53789])

HSP 1 Score: 76.6406 bits (187), Expect = 2.119e-16
Identity = 54/113 (47.79%), Postives = 79/113 (69.91%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQR--YYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRV 381
            MH +     PC S+ L   W  R   Y  H +K++   P++DTRAP T+ H+HLKLK++++EEERL +IERDNR+LLEK++ +MRT G+ D+ NN   +SL+R K+++EL RV
Sbjct:    1 MHGAPRLTFPCASEYL---WHAREKAYQDHRRKVQSAQPLVDTRAPLTFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRGQTDSKNNSKHRSLHRGKREQELRRV 110          
BLAST of Novel protein vs. Ensembl Human
Match: CFAP97D2 (CFAP97 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:53789])

HSP 1 Score: 64.3142 bits (155), Expect = 1.351e-12
Identity = 46/95 (48.42%), Postives = 66/95 (69.47%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQR--YYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNN 327
            MH +     PC S+ L   W  R   Y  H +K++   P++DTRAP T+ H+HLKLK++++EEERL +IERDNR+LLEK++ +MRT G+ D+ NN
Sbjct:    1 MHGAPRLTFPCASEYL---WHAREKAYQDHRRKVQSAQPLVDTRAPLTFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRGQTDSKNN 92          
BLAST of Novel protein vs. Ensembl Human
Match: CFAP97D2 (CFAP97 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:53789])

HSP 1 Score: 64.3142 bits (155), Expect = 1.485e-12
Identity = 46/95 (48.42%), Postives = 66/95 (69.47%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQR--YYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNN 327
            MH +     PC S+ L   W  R   Y  H +K++   P++DTRAP T+ H+HLKLK++++EEERL +IERDNR+LLEK++ +MRT G+ D+ NN
Sbjct:    1 MHGAPRLTFPCASEYL---WHAREKAYQDHRRKVQSAQPLVDTRAPLTFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRGQTDSKNN 92          
BLAST of Novel protein vs. Ensembl Fly
Match: CG14551 (gene:FBgn0039408 transcript:FBtr0337058)

HSP 1 Score: 53.9138 bits (128), Expect = 2.244e-8
Identity = 34/77 (44.16%), Postives = 48/77 (62.34%), Query Frame = 1
Query:   88 KLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDN 318
            KLLQ  W+Q  Y  H +K+    P IDT +P+ + H+  K KK ++E ER   IER+N  LL+K+  IMRT  R++N
Sbjct:    7 KLLQQPWEQLRYAQHREKVMSARPAIDTHSPRAHEHVQRKWKKQQVERERQQQIERENLRLLQKLGDIMRT-KRINN 82          
BLAST of Novel protein vs. Ensembl Fly
Match: CG14551 (gene:FBgn0039408 transcript:FBtr0084971)

HSP 1 Score: 53.9138 bits (128), Expect = 2.244e-8
Identity = 34/77 (44.16%), Postives = 48/77 (62.34%), Query Frame = 1
Query:   88 KLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDN 318
            KLLQ  W+Q  Y  H +K+    P IDT +P+ + H+  K KK ++E ER   IER+N  LL+K+  IMRT  R++N
Sbjct:    7 KLLQQPWEQLRYAQHREKVMSARPAIDTHSPRAHEHVQRKWKKQQVERERQQQIERENLRLLQKLGDIMRT-KRINN 82          
BLAST of Novel protein vs. Ensembl Zebrafish
Match: si:ch211-284k5.2 (si:ch211-284k5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-514])

HSP 1 Score: 128.257 bits (321), Expect = 1.126e-35
Identity = 69/152 (45.39%), Postives = 96/152 (63.16%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYP 504
            M+KSY  +KP  +K LQ KWDQ  Y  H  K+KE  PV+DT+  +T  H+  KLKK++M+EERL +IERDNR+L  +++ I R+ G VD+ N+    SLN EK++  LL+V  EN  I +RI  QK  Y  + WE +W +     D I+ YP
Sbjct:    1 MYKSYQPLKPATNKFLQQKWDQTQYQEHRNKVKEASPVVDTKGIQTPAHVQHKLKKVQMQEERLSIIERDNRLLSSRLNIISRSKGIVDHWNHSSRCSLNAEKRRENLLQVTNENLAIYQRITTQKSDYRRELWESDWEKVERRRDDIARYP 152          
BLAST of Novel protein vs. Ensembl Zebrafish
Match: si:ch211-284k5.2 (si:ch211-284k5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-514])

HSP 1 Score: 128.257 bits (321), Expect = 1.158e-35
Identity = 69/152 (45.39%), Postives = 96/152 (63.16%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYP 504
            M+KSY  +KP  +K LQ KWDQ  Y  H  K+KE  PV+DT+  +T  H+  KLKK++M+EERL +IERDNR+L  +++ I R+ G VD+ N+    SLN EK++  LL+V  EN  I +RI  QK  Y  + WE +W +     D I+ YP
Sbjct:    1 MYKSYQPLKPATNKFLQQKWDQTQYQEHRNKVKEASPVVDTKGIQTPAHVQHKLKKVQMQEERLSIIERDNRLLSSRLNIISRSKGIVDHWNHSSRCSLNAEKRRENLLQVTNENLAIYQRITTQKSDYRRELWESDWEKVERRRDDIARYP 152          
BLAST of Novel protein vs. Ensembl Zebrafish
Match: si:dkey-83m22.7 (si:dkey-83m22.7 [Source:ZFIN;Acc:ZDB-GENE-070912-603])

HSP 1 Score: 103.605 bits (257), Expect = 1.677e-26
Identity = 53/103 (51.46%), Postives = 69/103 (66.99%), Query Frame = 1
Query:   52 HKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKK 360
            H++Y  V PC +K LQ +WD+  Y  H  K+K   P I+T  PKTY H+ +KLKK ++EEER+  I+R+N +LL KMS IM+T G VD  N YV KSL  EKK
Sbjct:    3 HQAYQPVVPCVNKYLQYRWDKNCYEIHRDKVKSAKPTINTSPPKTYSHLLVKLKKSQLEEERVSKIKRENEMLLHKMSHIMQTKGGVDCKNIYVKKSLGSEKK 105          
BLAST of Novel protein vs. Ensembl Xenopus
Match: cfap97d1 (CFAP97 domain containing 1 [Source:NCBI gene;Acc:394955])

HSP 1 Score: 190.66 bits (483), Expect = 8.994e-58
Identity = 85/157 (54.14%), Postives = 120/157 (76.43%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWWL 519
            MH+SY  + PC +K LQ KWD+ YY+ H KK++   PV+DT +P TY+H++ K+KK+++EEERL +IERDN +LL+KMS IMRT GRVDN N Y +KSLN+EK+ RELLR+++ENQ I++RI + +PQY V+ W E+W +  +Y+D I+ YP  WW 
Sbjct:    1 MHRSYQPILPCGNKYLQQKWDKTYYDEHKKKVQSAKPVVDTNSPHTYVHLNTKMKKLKLEEERLAVIERDNHLLLQKMSAIMRTKGRVDNKNEYEAKSLNKEKRYRELLRLSKENQTILDRITKCEPQYQVEKWHEDWVKAEKYMDSIARYPRGWWC 157          
BLAST of Novel protein vs. Ensembl Xenopus
Match: cfap97d1 (CFAP97 domain containing 1 [Source:NCBI gene;Acc:394955])

HSP 1 Score: 125.176 bits (313), Expect = 2.708e-33
Identity = 57/101 (56.44%), Postives = 79/101 (78.22%), Query Frame = 1
Query:  217 IRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWWL 519
            +++EEERL +IERDN +LL+KMS IMRT GRVDN N Y +KSLN+EK+ RELLR+++ENQ I++RI + +PQY V+ W E+W +  +Y+D I+ YP  WW 
Sbjct:    8 LQLEEERLAVIERDNHLLLQKMSAIMRTKGRVDNKNEYEAKSLNKEKRYRELLRLSKENQTILDRITKCEPQYQVEKWHEDWVKAEKYMDSIARYPRGWWC 108          
BLAST of Novel protein vs. Ensembl Xenopus
Match: cfap97d1 (CFAP97 domain containing 1 [Source:NCBI gene;Acc:394955])

HSP 1 Score: 124.79 bits (312), Expect = 3.640e-33
Identity = 57/100 (57.00%), Postives = 78/100 (78.00%), Query Frame = 1
Query:  220 RMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWWL 519
            ++EEERL +IERDN +LL+KMS IMRT GRVDN N Y +KSLN+EK+ RELLR+++ENQ I++RI + +PQY V+ W E+W +  +Y+D I+ YP  WW 
Sbjct:    3 KLEEERLAVIERDNHLLLQKMSAIMRTKGRVDNKNEYEAKSLNKEKRYRELLRLSKENQTILDRITKCEPQYQVEKWHEDWVKAEKYMDSIARYPRGWWC 102          
BLAST of Novel protein vs. Ensembl Mouse
Match: Cfap97d1 (CFAP97 domain containing 1 [Source:MGI Symbol;Acc:MGI:1922687])

HSP 1 Score: 98.5969 bits (244), Expect = 1.103e-24
Identity = 53/140 (37.86%), Postives = 84/140 (60.00%), Query Frame = 1
Query:   82 QSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAY 501
            QS   + K D  +Y  H  +++ + P +DT+ P  + H  LKL KI+ E++R+  IE +NR L +K++   R   +VD  N Y+SKSLNRE + REL+R+  ENQ I+ R+ ++KP Y  +  E +W  +  YI + + Y
Sbjct:   19 QSTTFRKKLDFGHYILHKNRVQIVKPAVDTKPPMAHTHYILKLSKIQGEQKRIDKIEYENRQLCQKIANAYRGPAKVDCWNEYLSKSLNRESRNRELVRITMENQGILRRLSDRKPNYDRRSSEMDWQNSRRYIRNTTRY 158          
BLAST of Novel protein vs. Ensembl Mouse
Match: Cfap97d2 (CFAP97 domain containing 2 [Source:MGI Symbol;Acc:MGI:2685952])

HSP 1 Score: 92.0485 bits (227), Expect = 3.654e-22
Identity = 47/137 (34.31%), Postives = 84/137 (61.31%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEEN 459
            MH+      P  ++ LQ  W++ Y + H KK++   P++DT  P+ Y H+ LK KK++MEEERL +I+R+N +LL++++  M+T G+ D  NN+  +  +RE+     ++V ++NQ   ER+   +P+Y  +   E+
Sbjct:    1 MHRVPRLTTPWANRDLQRAWEKTYQD-HRKKVQNAQPLVDTHPPQIYSHLCLKFKKLKMEEERLSIIDRNNYLLLQRVASAMKTRGQTDGRNNFTQRRKSREQ---AFMKVQKQNQVFPERLRSSEPRYRAQRRRED 133          
BLAST of Novel protein vs. Ensembl Mouse
Match: Cfap97d2 (CFAP97 domain containing 2 [Source:MGI Symbol;Acc:MGI:2685952])

HSP 1 Score: 78.9518 bits (193), Expect = 4.805e-18
Identity = 37/97 (38.14%), Postives = 63/97 (64.95%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSK 339
            MH+      P  ++ LQ  W++ Y + H KK++   P++DT  P+ Y H+ LK KK++MEEERL +I+R+N +LL++++  M+T G+ D  NN+  +
Sbjct:    1 MHRVPRLTTPWANRDLQRAWEKTYQD-HRKKVQNAQPLVDTHPPQIYSHLCLKFKKLKMEEERLSIIDRNNYLLLQRVASAMKTRGQTDGRNNFTQR 96          
BLAST of Novel protein vs. Ensembl Mouse
Match: Cfap97d1 (CFAP97 domain containing 1 [Source:MGI Symbol;Acc:MGI:1922687])

HSP 1 Score: 78.9518 bits (193), Expect = 5.714e-18
Identity = 43/106 (40.57%), Postives = 66/106 (62.26%), Query Frame = 1
Query:  184 TYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAY 501
             + H  LKL KI+ E++R+  IE +NR L +K++   R   +VD  N Y+SKSLNRE + REL+R+  ENQ I+ R+ ++KP Y  +  E +W  +  YI + + Y
Sbjct:    2 AHTHYILKLSKIQGEQKRIDKIEYENRQLCQKIANAYRGPAKVDCWNEYLSKSLNRESRNRELVRITMENQGILRRLSDRKPNYDRRSSEMDWQNSRRYIRNTTRY 107          
BLAST of Novel protein vs. UniProt/SwissProt
Match: sp|Q9DAN9|CF97D_MOUSE (Uncharacterized protein CFAP97D1 OS=Mus musculus OX=10090 GN=Cfap97d1 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 7.715e-24
Identity = 53/140 (37.86%), Postives = 84/140 (60.00%), Query Frame = 1
Query:   82 QSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAY 501
            QS   + K D  +Y  H  +++ + P +DT+ P  + H  LKL KI+ E++R+  IE +NR L +K++   R   +VD  N Y+SKSLNRE + REL+R+  ENQ I+ R+ ++KP Y  +  E +W  +  YI + + Y
Sbjct:   19 QSTTFRKKLDFGHYILHKNRVQIVKPAVDTKPPMAHTHYILKLSKIQGEQKRIDKIEYENRQLCQKIANAYRGPAKVDCWNEYLSKSLNRESRNRELVRITMENQGILRRLSDRKPNYDRRSSEMDWQNSRRYIRNTTRY 158          
BLAST of Novel protein vs. UniProt/SwissProt
Match: sp|B2RV13|CF97D_HUMAN (Uncharacterized protein CFAP97D1 OS=Homo sapiens OX=9606 GN=CFAP97D1 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 8.602e-22
Identity = 49/140 (35.00%), Postives = 85/140 (60.71%), Query Frame = 1
Query:   82 QSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAY 501
            QS   + K D  +Y +H  +++   P +DT+ P  + +  LKL K++ E++++  IE +N+ L +K++   R   +VD  N Y SKSLNRE + REL+R+  ENQ I++R++++KP Y  +  E +W  +  YI + + Y
Sbjct:   19 QSTTFRKKLDFGHYVSHKNRIQIAKPTVDTKPPVAHTNHILKLSKLQGEQKKINKIEYENKQLCQKIANAHRGPAKVDCWNEYFSKSLNRETRNRELVRITMENQGILKRLVDRKPHYDRRASEIDWQNSRRYIRNTTRY 158          
BLAST of Novel protein vs. UniProt/SwissProt
Match: sp|G3UW36|C97D2_MOUSE (Uncharacterized protein CFAP97D2 OS=Mus musculus OX=10090 GN=Cfap97d2 PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.361e-17
Identity = 37/97 (38.14%), Postives = 63/97 (64.95%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSK 339
            MH+      P  ++ LQ  W++ Y + H KK++   P++DT  P+ Y H+ LK KK++MEEERL +I+R+N +LL++++  M+T G+ D  NN+  +
Sbjct:    1 MHRVPRLTTPWANRDLQRAWEKTYQD-HRKKVQNAQPLVDTHPPQIYSHLCLKFKKLKMEEERLSIIDRNNYLLLQRVASAMKTRGQTDGRNNFTQR 96          
BLAST of Novel protein vs. UniProt/SwissProt
Match: sp|A0A1B0GU71|C97D2_HUMAN (Uncharacterized protein CFAP97D2 OS=Homo sapiens OX=9606 GN=CFAP97D2 PE=3 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 7.134e-12
Identity = 46/95 (48.42%), Postives = 66/95 (69.47%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQR--YYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNN 327
            MH +     PC S+ L   W  R   Y  H +K++   P++DTRAP T+ H+HLKLK++++EEERL +IERDNR+LLEK++ +MRT G+ D+ NN
Sbjct:    1 MHGAPRLTFPCASEYL---WHAREKAYQDHRRKVQSAQPLVDTRAPLTFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRGQTDSKNN 92          
BLAST of Novel protein vs. TrEMBL
Match: V3YZY6 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_76553 PE=4 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.909e-60
Identity = 91/154 (59.09%), Postives = 123/154 (79.87%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSN 510
            MHKSY  + P  ++LLQ KWD  YYN H +K++++  ++DT+AP TYMH+HLKLKK ++EEERL  IERDNRILLEKM+ IMRT GR+DN N+YV +SLNREK+QRELLRVA++NQEI+ RI  ++P+YS K W ++W QN +++D IS +P +
Sbjct:    6 MHKSYNNILPTSNRLLQQKWDTTYYNEHRRKVRDVKSMVDTKAPPTYMHLHLKLKKFQLEEERLTTIERDNRILLEKMAYIMRTRGRIDNKNDYVYQSLNREKRQRELLRVAKDNQEILRRITARQPEYSAKKWNDDWQQNQKFMDSISHFPQD 159          
BLAST of Novel protein vs. TrEMBL
Match: A0A1I8GMV3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014779g2 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.570e-59
Identity = 90/155 (58.06%), Postives = 125/155 (80.65%), Query Frame = 1
Query:   52 HKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWW 516
            H+ YY+V PCQ++LLQM++D+  Y  H ++LK +  ++DT+ P+TY+H+HLK KK+++EEERL +IERDNRILLEKMS IMRTGGR+DN NNY++KSLNR K+QRELLRV REN+ +MERI+++    S  DW+++W  NL Y+D+IS +P  WW
Sbjct:    4 HRYYYSVLPCQNRLLQMQYDEAAYKRHREELKRVKAMVDTKPPQTYIHLHLKPKKLQLEEERLAIIERDNRILLEKMSMIMRTGGRIDNVNNYMTKSLNRSKRQRELLRVTRENKAMMERILQKSMGPSELDWKKDWQMNLSYMDNISRFPKGWW 158          
BLAST of Novel protein vs. TrEMBL
Match: A0A1I8G1F3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007383g1 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.776e-59
Identity = 89/155 (57.42%), Postives = 125/155 (80.65%), Query Frame = 1
Query:   52 HKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWW 516
            H+ YY+V PCQ++LLQM++D+  Y  H ++LK +  ++DT+ P+TY+H+HLK KK+++EEERL +IERDNRILLEKMS IMRTGGR+DN NNY++KSLNR ++QRELLRV REN+ +MERI+++    S  DW+++W  NL Y+D+IS +P  WW
Sbjct:    4 HRYYYSVLPCQNRLLQMQYDEAAYKRHREELKRVKAMVDTKPPQTYIHLHLKPKKLQLEEERLAIIERDNRILLEKMSMIMRTGGRIDNVNNYMTKSLNRSRRQRELLRVTRENKAMMERILQKSMGPSELDWKKDWQMNLSYMDNISRFPKGWW 158          
BLAST of Novel protein vs. TrEMBL
Match: A0A1I8GWK3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011540g1 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 4.030e-59
Identity = 89/155 (57.42%), Postives = 125/155 (80.65%), Query Frame = 1
Query:   52 HKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWW 516
            H+ YY+V PCQ++LLQM++D+  Y  H ++LK +  ++DT+ P+TY+H+HLK KK+++EEERL +IERDNRILLEKMS IMRTGGR+DN NNY++KSLNR ++QRELLRV REN+ +MERI+++    S  DW+++W  NL Y+D+IS +P  WW
Sbjct:    4 HRYYYSVLPCQNRLLQMQYDEAAYKRHREELKRVKAMVDTKPPQTYIHLHLKPKKLQLEEERLAIIERDNRILLEKMSMIMRTGGRIDNVNNYMTKSLNRSRRQRELLRVTRENKAMMERILQKSMGPSELDWKKDWQMNLSYMDNISRFPKGWW 158          
BLAST of Novel protein vs. TrEMBL
Match: H2ZJS4 (Uncharacterized protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.977e-56
Identity = 87/156 (55.77%), Postives = 121/156 (77.56%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWW 516
            MH+SY  + P  +KLLQ KWD   YN H ++++    ++DTRAP+TY+HMHLKLKK+++EEE++  IERDNRILLEKMS +MRT GRVDN N+Y  +SLNREK+Q+ELLRV RENQ+I+ RI  ++P+YS + WE+ W +  +++++I  YP NWW
Sbjct:    1 MHRSYQPILPSHNKLLQQKWDDTNYNDHRRRVRSAKSMVDTRAPQTYVHMHLKLKKLQLEEEKMSTIERDNRILLEKMSLVMRTRGRVDNRNDYDYRSLNREKRQKELLRVTRENQQILARITMREPEYSHRKWEQEWQEAEKFMNNIGRYPQNWW 156          
BLAST of Novel protein vs. Ensembl Cavefish
Match: si:ch211-284k5.2 (si:ch211-284k5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-514])

HSP 1 Score: 122.865 bits (307), Expect = 9.719e-34
Identity = 59/152 (38.82%), Postives = 100/152 (65.79%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYP 504
            MHK+Y  +KP  +K LQ KWDQ  +  H +K+K+  P+++T+  +T  H+ +KLKK+++++ER  +I+RDN++L  +++ I R+ G VD+ N+Y  +SLN E++++EL +V  EN  I  RI  ++ +Y    WE+NW +     D I+ YP
Sbjct:    1 MHKAYQPLKPATNKYLQKKWDQTRFEMHRQKVKDAKPIVNTKGMQTPSHVQMKLKKVQVQDERQAIIDRDNQLLASRLTGIERSKGLVDHRNDYPERSLNSERRRKELQQVTHENLAIYHRITARESEYRRGLWEDNWERVERRRDDIARYP 152          
BLAST of Novel protein vs. Ensembl Cavefish
Match: si:dkey-83m22.7 (si:dkey-83m22.7 [Source:ZFIN;Acc:ZDB-GENE-070912-603])

HSP 1 Score: 83.9593 bits (206), Expect = 1.940e-19
Identity = 41/97 (42.27%), Postives = 63/97 (64.95%), Query Frame = 1
Query:   52 HKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIR-MEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSK 339
            H++Y  + PC +K LQ KWD+  Y  H  +++     I+T  PK Y H+ +K KK + +EE+RL  I+R+N +LL+K++ IM+T GR D  N+YV K
Sbjct:    3 HQAYQPLLPCANKYLQYKWDKSCYETHRNRVQTAKATINTTPPKVYSHLLVKGKKQKQLEEDRLSTIQRENHMLLDKINHIMKTTGRTDCKNDYVQK 99          
BLAST of Novel protein vs. Ensembl Nematostella
Match: EDO45251 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTE0])

HSP 1 Score: 178.333 bits (451), Expect = 2.642e-55
Identity = 84/156 (53.85%), Postives = 114/156 (73.08%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWW 516
            MH++Y  + P  +KLL+ +WD   Y+ H +K++    VID +AP+TYMH+HLKLKK+++EEER   IERDNRILLEKMS  MRT GRVDN N+Y  KSLN+ K+QRELLRV  ENQ I++RI  ++P Y+   WE+ W  N  Y+D+I+ YP +W+
Sbjct:    1 MHRAYQPITPANNKLLKQRWDMSRYDTHRRKVQSAAAVIDNKAPQTYMHLHLKLKKLQVEEERNATIERDNRILLEKMSYTMRTKGRVDNRNDYEHKSLNKTKRQRELLRVTHENQAILKRIASKEPHYNHLQWEDEWQINETYMDNIAKYPKDWY 156          
BLAST of Novel protein vs. Planmine SMEST
Match: SMESG000039682.1 (SMESG000039682.1)

HSP 1 Score: 367.851 bits (943), Expect = 4.361e-129
Identity = 239/239 (100.00%), Postives = 239/239 (100.00%), Query Frame = 1
Query:   49 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWWLNKTEPAPEPKPERAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGRKSKNEEQTEAG 765
            MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWWLNKTEPAPEPKPERASSQPPSESKRSRSPKNESKDDSVKSKPKKHKKKEEIIPKETETAETKEESDKESIGRKSKNEEQTEAG
Sbjct:    1 MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWWLNKTEPAPEPKPERASSQPPSESKRSRSPKNESKDDSVKSKPKKHKKKEEIIPKETETAETKEESDKESIGRKSKNEEQTEAG 239          
BLAST of Novel protein vs. Planmine SMEST
Match: SMESG000039682.1 (SMESG000039682.1)

HSP 1 Score: 330.487 bits (846), Expect = 1.254e-114
Identity = 222/222 (100.00%), Postives = 222/222 (100.00%), Query Frame = 1
Query:  100 MKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWWLNKTEPAPEPKPERAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGRKSKNEEQTEAG 765
            MKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWWLNKTEPAPEPKPERASSQPPSESKRSRSPKNESKDDSVKSKPKKHKKKEEIIPKETETAETKEESDKESIGRKSKNEEQTEAG
Sbjct:    1 MKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHMHLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLNREKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISAYPSNWWLNKTEPAPEPKPERASSQPPSESKRSRSPKNESKDDSVKSKPKKHKKKEEIIPKETETAETKEESDKESIGRKSKNEEQTEAG 222          
The following BLAST results are available for this feature:
BLAST of Novel protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CFAP97D11.791e-2235.00CFAP97 domain containing 1 [Source:HGNC Symbol;Acc... [more]
CFAP97D22.119e-1647.79CFAP97 domain containing 2 [Source:HGNC Symbol;Acc... [more]
CFAP97D21.351e-1248.42CFAP97 domain containing 2 [Source:HGNC Symbol;Acc... [more]
CFAP97D21.485e-1248.42CFAP97 domain containing 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Novel protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Novel protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG145512.244e-844.16gene:FBgn0039408 transcript:FBtr0337058[more]
CG145512.244e-844.16gene:FBgn0039408 transcript:FBtr0084971[more]
back to top
BLAST of Novel protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-284k5.21.126e-3545.39si:ch211-284k5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-... [more]
si:ch211-284k5.21.158e-3545.39si:ch211-284k5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-... [more]
si:dkey-83m22.71.677e-2651.46si:dkey-83m22.7 [Source:ZFIN;Acc:ZDB-GENE-070912-6... [more]
back to top
BLAST of Novel protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfap97d18.994e-5854.14CFAP97 domain containing 1 [Source:NCBI gene;Acc:3... [more]
cfap97d12.708e-3356.44CFAP97 domain containing 1 [Source:NCBI gene;Acc:3... [more]
cfap97d13.640e-3357.00CFAP97 domain containing 1 [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of Novel protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cfap97d11.103e-2437.86CFAP97 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Cfap97d23.654e-2234.31CFAP97 domain containing 2 [Source:MGI Symbol;Acc:... [more]
Cfap97d24.805e-1838.14CFAP97 domain containing 2 [Source:MGI Symbol;Acc:... [more]
Cfap97d15.714e-1840.57CFAP97 domain containing 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Novel protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9DAN9|CF97D_MOUSE7.715e-2437.86Uncharacterized protein CFAP97D1 OS=Mus musculus O... [more]
sp|B2RV13|CF97D_HUMAN8.602e-2235.00Uncharacterized protein CFAP97D1 OS=Homo sapiens O... [more]
sp|G3UW36|C97D2_MOUSE3.361e-1738.14Uncharacterized protein CFAP97D2 OS=Mus musculus O... [more]
sp|A0A1B0GU71|C97D2_HUMAN7.134e-1248.42Uncharacterized protein CFAP97D2 OS=Homo sapiens O... [more]
back to top
BLAST of Novel protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3YZY61.909e-6059.09Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A1I8GMV31.570e-5958.06Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G1F33.776e-5957.42Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GWK34.030e-5957.42Uncharacterized protein OS=Macrostomum lignano OX=... [more]
H2ZJS41.977e-5655.77Uncharacterized protein OS=Ciona savignyi OX=51511... [more]
back to top
BLAST of Novel protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-284k5.29.719e-3438.82si:ch211-284k5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-... [more]
si:dkey-83m22.71.940e-1942.27si:dkey-83m22.7 [Source:ZFIN;Acc:ZDB-GENE-070912-6... [more]
back to top
BLAST of Novel protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Novel protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Novel protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO452512.642e-5553.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Novel protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Novel protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000039682.14.361e-129100.00SMESG000039682.1[more]
SMESG000039682.11.254e-114100.00SMESG000039682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004519 ID=SMED30004519|Name=Novel protein|organism=Schmidtea mediterranea sexual|type=transcript|length=931bp
TCATTAGCTTAGCAACACTATTATCGTATATTTTTAAATAATTAAAATAT
GCATAAATCCTATTACACAGTTAAACCTTGTCAAAGCAAATTACTACAAA
TGAAATGGGATCAGAGATATTATAATGCACATCTGAAAAAATTGAAAGAA
ATTTATCCAGTTATTGATACAAGAGCTCCTAAAACTTACATGCATATGCA
TTTAAAGTTGAAAAAAATTCGGATGGAAGAAGAAAGATTATTTTTAATAG
AACGCGATAATCGAATTCTTTTAGAGAAAATGTCCCAAATAATGCGAACC
GGTGGTCGAGTGGATAATCACAACAATTACGTCAGTAAAAGTTTAAATCG
TGAGAAAAAACAACGAGAGTTATTGAGAGTTGCTCGAGAAAACCAAGAAA
TAATGGAAAGAATCATCGAGCAGAAACCGCAGTACAGTGTGAAAGATTGG
GAAGAAAACTGGAATCAGAATCTCGAATATATTGATCACATTTCCGCATA
TCCTAGCAACTGGTGGCTCAATAAAACAGAACCAGCTCCAGAACCGAAAC
CTGAGCGAGCATCATCGCAGCCGCCGTCGGAATCAAAACGCAGTCGATCA
CCGAAAAACGAAAGCAAAGATGATTCAGTGAAATCCAAACCAAAAAAGCA
CAAGAAAAAAGAAGAAATTATTCCAAAAGAAACCGAAACTGCCGAGACAA
AAGAAGAATCAGATAAAGAATCGATTGGAAGGAAATCAAAAAATGAAGAA
CAAACCGAAGCTGGATAAAATTTACACATTTTCTTCATCGATTTACTGCT
GGCATTGAGATTATCGACTTTTATTTTGCTGCTGCTGCTGCTGCTTGAGG
TGCGTTAACATTCTGGCAATCTGTGTGATAGATATCCCTCACGTTTTGGG
ATTTAGATTAAATATATATTTTATTCCTCTT
back to top

protein sequence of SMED30004519-orf-1

>SMED30004519-orf-1 ID=SMED30004519-orf-1|Name=SMED30004519-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MHKSYYTVKPCQSKLLQMKWDQRYYNAHLKKLKEIYPVIDTRAPKTYMHM
HLKLKKIRMEEERLFLIERDNRILLEKMSQIMRTGGRVDNHNNYVSKSLN
REKKQRELLRVARENQEIMERIIEQKPQYSVKDWEENWNQNLEYIDHISA
YPSNWWLNKTEPAPEPKPERASSQPPSESKRSRSPKNESKDDSVKSKPKK
HKKKEEIIPKETETAETKEESDKESIGRKSKNEEQTEAG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038791Cfap97/Hemingway
IPR029488Hmw/CFAP97D1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 101..121
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 161..239
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 181..239
NoneNo IPR availablePANTHERPTHR23035:SF2coord: 1..234
IPR029488Hemingway/CFAP97D1PFAMPF13879KIAA1430coord: 28..122
e-value: 2.0E-24
score: 86.3
IPR038791Cilia- and flagella-associated protein 97PANTHERPTHR23035UNCHARACTERIZEDcoord: 1..234