Dynein assembly factor with WDR repeat domains 1

Overview
NameDynein assembly factor with WDR repeat domains 1
Smed IDSMED30004518
Length (bp)1454
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein assembly factor with WDR repeat domains 1 (SMED30004518) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein assembly factor with WDR repeat domains 1 (SMED30004518) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein assembly factor with WDR repeat domains 1 (SMED30004518) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein assembly factor with WDR repeat domains 1 (SMED30004518) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004518

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004518SMESG000008529.1 SMESG000008519.1 SmedASXL_009373SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30004518SMESG000008529.1 SMESG000008519.1 dd_Smed_v4_4782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004518SMESG000008529.1 SMESG000008519.1 dd_Smed_v4_4782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004518SMESG000008529.1 SMESG000008519.1 dd_Smed_v4_4782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004518SMESG000008529.1 SMESG000008519.1 dd_Smed_v6_4782_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004518SMESG000008529.1 SMESG000008519.1 OX_Smed_1.0.21461ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30004518SMESG000008529.1 SMESG000008519.1 Contig22552newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004518SMESG000008529.1 SMESG000008519.1 Contig22552uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30004518SMESG000008529.1 SMESG000008519.1 dd_Smed_v4_4782_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Human
Match: DAW1 (dynein assembly factor with WD repeats 1 [Source:HGNC Symbol;Acc:HGNC:26383])

HSP 1 Score: 511.146 bits (1315), Expect = 1.257e-179
Identity = 245/419 (58.47%), Postives = 311/419 (74.22%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            MKLK  L+RY+PPGI+LEYE+ GE+KTK+ DLLDL   T+   +V+ I K E L+T  R + V  LI+ LQEKL    + T+ LFKVL+AHILPLTNV  NK+G  F+TGSYDRTCK+WDT+ G  L TLEGH+NVVY+IA+N P+ DKI TGSFDKT K+WS   G  YHTF+GHTAE+VC+ FNP STLV TG MDT A LWD+++G+ V  L+GH+AE+ISL F  +  G  +ITGSFDHTV++WD   GR+V+ LIGH AEIS+A FN+D + + T SMDK+ K+WD   G + + TL GH DE+LD  FD  GK +A+A AD T R++      K     +GHE E+SK++FNPQG  LL+ S+DK+AR W+  TG+ +QVLEGHTDEIFSCAFNY G+ +ITGSKDNTCRIW+
Sbjct:    1 MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRLQEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTS--GDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNG-KCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAAT-RKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWR 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Human
Match: DAW1 (dynein assembly factor with WD repeats 1 [Source:HGNC Symbol;Acc:HGNC:26383])

HSP 1 Score: 399.823 bits (1026), Expect = 1.418e-136
Identity = 193/332 (58.13%), Postives = 245/332 (73.80%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRL 1061
            MKLK  L+RY+PPGI+LEYE+ GE+KTK+ DLLDL   T+   +V+ I K E L+T  R + V  LI+ LQEKL    + T+ LFKVL+AHILPLTNV  NK+G  F+TGSYDRTCK+WDT+ G  L TLEGH+NVVY+IA+N P+ DKI TGSFDKT K+WS   G  YHTF+GHTAE+VC+ FNP STLV TG MDT A LWD+++G+ V  L+GH+AE+ISL F  +  G  +ITGSFDHTV++WD   GR+V+ LIGH AEIS+A FN+D + + T SMDK+ K+WD   G + + TL GH DE+LD  FD  GK +A+A AD+ V L
Sbjct:    1 MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRLQEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTS--GDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNG-KCVATLTGHDDEILDSCFDYTGKLIATASADDGVSL 329          

HSP 2 Score: 169.088 bits (427), Expect = 2.320e-47
Identity = 92/251 (36.65%), Postives = 135/251 (53.78%), Query Frame = 3
Query:  570 LYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDN---TCR 1313
            L+   K H   +  V  N S +   TG  D    LWD  SG+ ++ L+GH   V ++ F   + G  + TGSFD T  LW V  G+      GH AEI    FN   T VAT SMD + K+WD++ G  +++TL GH+ E++ ++F+  G ++ +   D+TV +WD  D  +   I  GH AE+S  +FN   +++L+ S DK+ + W+ T GK +  L GH DEI    F+Y G  I T S D+    CR
Sbjct:   84 LFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPY-GDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNG-EEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDA-DTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADDGVSLCR 331          

HSP 3 Score: 137.887 bits (346), Expect = 1.053e-35
Identity = 71/205 (34.63%), Postives = 116/205 (56.59%), Query Frame = 3
Query:  708 LQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFD-GTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L+ H   + ++   ++  G   ITGS+D T  LWD  +G  ++ L GH   + A  FN   G  +AT S DK+ K+W +  G +   T  GHT E++ ++F+     VA+   D T +LWD+++  +  +  +GH AE+  ++FN  G  +++ S D +   W+  TG+ + +L GH  EI S +FN+D S I+TGS D TC++W
Sbjct:   88 LKAHILPLTNVALNKS--GSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETG-KCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQN-GEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLW 288          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Human
Match: WDR5B (WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:17826])

HSP 1 Score: 154.066 bits (388), Expect = 4.329e-42
Identity = 100/334 (29.94%), Postives = 167/334 (50.00%), Query Frame = 3
Query:  225 LVTIKRRDTVIELI--KNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV----GKQVASAGADNTVRLWDV--KDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASA--DKSARTW 1193
            + T + RD   +L    +  +  +VP +  Y L   L  H   +++V F+ NG+   + S DR   +W    G    TL GH   +  +A++   S ++V+ S DKT K+W    G    T KGH+  V C  FNP S L+ +G  D    +W+V++GKC+  L  H+  V ++ F  +  G  +++GS+D    +WD  +G+ +  L+  D   +S   F+ +G Y+ TA++D ++K+WD   G R L T  GH +E   + F N     GK + S   DN V +W++  K+  +     +GH   V     +P   ++ SA+   DK+ + W
Sbjct:    1 MATKESRDAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSD-SSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCS--GSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRG-RCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQK---LQGHTDVVISAACHPTENLIASAALENDKTIKLW 326          

HSP 2 Score: 140.969 bits (354), Expect = 3.064e-37
Identity = 95/298 (31.88%), Postives = 149/298 (50.00%), Query Frame = 3
Query:  450 TLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLD-VTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFN---PQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS--KDNTCRIW 1319
            TL GH   V S+ ++ P  + + + S D+   +W A DG    T  GH  E+  V ++  S+ + +   D    LWDV SGKC+  L+GH+  V    F    N   +I+GSFD TV +W+V  G+ +  L  H   +SA  FN  G+ + + S D   +IWD   G + L TL    +  +  V F   GK + +A  DNT++LWD   +S+   +  + GH+ E   +  N     G  ++S S D     WN  T +++Q L+GHTD + S A +   + I + +   D T ++W
Sbjct:   36 TLVGHTEAVSSVKFS-PNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSN--LIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASG-QCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWD---YSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLW 326          

HSP 3 Score: 88.5817 bits (218), Expect = 1.050e-18
Identity = 44/119 (36.97%), Postives = 71/119 (59.66%), Query Frame = 3
Query:  966 TLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            TL GHT+ V  V F   G+ +AS+ AD  + +W   D      ++ GH  E+S V ++   + L+SAS DK+ + W+  +GK ++ L+GH++ +F C FN   + II+GS D T +IW+
Sbjct:   36 TLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLY-GHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWE 153          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Human
Match: WDR5 (WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12757])

HSP 1 Score: 151.369 bits (381), Expect = 5.338e-41
Identity = 95/311 (30.55%), Postives = 159/311 (51.13%), Query Frame = 3
Query:  294 PVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV----GKQVASAGADNTVRLWDV--KDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASA--DKSARTWNT 1199
            PV   Y L   L  H   +++V F+ NG+   + S D+  K+W    G    T+ GHK  +  +A++   S+ +V+ S DKT K+W  + G    T KGH+  V C  FNP S L+ +G  D    +WDV++GKC+  L  H+  V ++ F +  +G  +++ S+D    +WD  +G+ +  LI  D   +S   F+ +G Y+  A++D ++K+WD   G + L T  GH +E   + F N     GK + S   DN V +W++  K+  +     +GH   V     +P   ++ SA+   DK+ + W +
Sbjct:   30 PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSD-SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNR--DGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKG-KCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQK---LQGHTDVVISTACHPTENIIASAALENDKTIKLWKS 332          

HSP 2 Score: 149.058 bits (375), Expect = 3.089e-40
Identity = 96/299 (32.11%), Postives = 149/299 (49.83%), Query Frame = 3
Query:  447 FTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFN---PQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS--KDNTCRIWQ 1322
            FTL GH   V S+ ++ P  + + + S DK  K+W A DG    T  GH   +  V ++  S L+ +   D    +WDV SGKC+  L+GH+  V    F    N   +++GSFD +V +WDV  G+ +  L  H   +SA  FN DG+ + ++S D   +IWD   G      +      V  V F   GK + +A  DNT++LWD   +SK   +  + GH+ E   +  N     G  ++S S D     WN  T +++Q L+GHTD + S A +   + I + +   D T ++W+
Sbjct:   39 FTLAGHTKAVSSVKFS-PNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSN--LIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWD---YSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          

HSP 3 Score: 131.339 bits (329), Expect = 9.249e-34
Identity = 75/255 (29.41%), Postives = 124/255 (48.63%), Query Frame = 3
Query:  567 SLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYD---GSKIITGSKDNTCRIWQ 1322
            +L  T  GHT  V  V+F+P+   + +   D L  +W    GK    + GH   +  + +    N   L++ S D T+ +WDV +G+ +  L GH   +    FN     + + S D+S++IWD++ G + L TL  H+D V  V F+  G  + S+  D   R+WD         +       VS V F+P G  +L+A+ D + + W+ + GK ++   GH +E +    N+    G  I++GS+DN   IW 
Sbjct:   36 ALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN--LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTG-KCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWN 287          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Human
Match: SNRNP40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:HGNC Symbol;Acc:HGNC:30857])

HSP 1 Score: 149.443 bits (376), Expect = 4.433e-40
Identity = 92/301 (30.56%), Postives = 154/301 (51.16%), Query Frame = 3
Query:  426 TSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSA-NDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLI-TGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSF---IFKGH----EAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKD 1301
            +S+   +  L GH+  VY   ++ P    + +  FD+   +W+   D   Y T KGH+  V+ + +N   +++ +   D    +WD E+G+ V  L+GHT+ V S     A  G  L+ TGS D TV LWD+   +   Q   +  ++ A  FN     + +  +D  IK+WDLR   +  +T+ GH D V  ++  + G  + S   DNTVR+WDV+ F+       IF+G+    E  + + +++P G+ + + SAD+    W+TT+ +++  L GH   I   AF+ D   II+ S D
Sbjct:   53 SSLQAPIMLLSGHEGEVYCCKFH-PNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCY--PARRGPQLVCTGSDDGTVKLWDIRK-KAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQN-KLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSD 348          

HSP 2 Score: 140.198 bits (352), Expect = 1.023e-36
Identity = 79/257 (30.74%), Postives = 138/257 (53.70%), Query Frame = 3
Query:  582 FKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKC--VSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGT-YVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWN----TTTGKVIQVLEGHT----DEIFSCAFNYDGSKIITGSKDNTCRIW 1319
              GH  EV C +F+P+ + + + G D L +LW+V  G C   + L+GH+  V+ L +    +G  L + S D TV +WD   G RV +L GH + +++      G   V T S D ++K+WD+R  A        +T +VL VTF++   Q+ S G DN +++WD++  +K ++  +GH   V+ ++ + +G+ LLS + D + R W+        + +++ +G+       +  C+++ DGSKI  GS D    +W
Sbjct:   62 LSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVY-GDCDNYATLKGHSGAVMELHYNT--DGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKA--AIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQ-NKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVW 312          

HSP 3 Score: 114.39 bits (285), Expect = 1.753e-27
Identity = 76/294 (25.85%), Postives = 138/294 (46.94%), Query Frame = 3
Query:  324 VLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLF-TLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEV-VCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGAR-----DLFTLAGHTDE--VLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADK 1178
            +L  H   +    F+ NG    +  +DR   +W+       + TL+GH   V  + YN   S  + + S DKT  +W +  G      KGHT+ V  C        LV TG  D    LWD+     +   Q +T +V+++ F    +   +I+G  D+ + +WD+   +    + GH   ++    + +G+Y+ + +MD ++++WD+R  A       +F    H  E  +L  ++   G ++A+  AD  V +WD     +  +   GH   +++V F+P   +++SAS+DK
Sbjct:   61 LLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGS-MLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQ-NTYQVLAVTFNDTSD--QIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTS-RRILYKLPGHAGSINEVAFHPDEPIIISASSDK 349          

HSP 4 Score: 105.145 bits (261), Expect = 3.587e-24
Identity = 69/260 (26.54%), Postives = 123/260 (47.31%), Query Frame = 3
Query:  318 FKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVH----NGRRVSQLIGH----DAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVK 1073
            +  L+ H   +  + +N +G    + S D+T  VWD+  G  +  L+GH + V S          + TGS D T K+W     +   TF+ +T +V+ V FN +S  + +GG+D    +WD+   K    ++GH   V  L    +  G +L++ + D+TV +WDV       R V    G+    +  +    ++ DG+ +A  S D+ + +WD     R L+ L GH   + +V F      + SA +D  + + +++
Sbjct:  102 YATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQ-NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSL--SSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDT-TSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ 357          

HSP 5 Score: 81.2629 bits (199), Expect = 4.440e-16
Identity = 43/121 (35.54%), Postives = 66/121 (54.55%), Query Frame = 3
Query:  960 LFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKII-TGSKDNTCRIW 1319
            +  L+GH  EV    F   G  +ASAG D  + LW+V          KGH   V ++ +N  G++L SAS DK+   W++ TG+ ++ L+GHT  + SC     G +++ TGS D T ++W
Sbjct:   59 IMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLW 179          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 147.132 bits (370), Expect = 4.343e-38
Identity = 101/326 (30.98%), Postives = 160/326 (49.08%), Query Frame = 3
Query:  363 FNKNGDRFLTGSYDRTCKVWDTS--MGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPS-----FIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            F +  D+      D+  K W+ +  MG+ +  L GH++ V  I       D +VTGS D T K+W  + G + +T  GHT  V   Q +     + +G  D    +W    G  +  LQGHT+ V  +    A  G  L+TGS D T+ +WDV +GR ++ L GH A +      FDGT V +   D ++KIW+   G R + TL GH + V  + F++    V S   D ++R+W   DF++P       + +GH +  S +    +G +L+S +AD   R W+   G  + +L GH   I S  + +  + + T S D T ++W
Sbjct:  221 FERAADKSRYLRADKIEKNWNANPIMGSAV--LRGHEDHV--ITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCM----AMAGSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCV--QFDGTTVVSGGYDFTVKIWNAHTG-RCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVW---DFTRPEGQECVALLQGHTSLTSGMQL--RGNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAITSLQW-FGRNMVATSSDDGTVKLW 529          

HSP 2 Score: 120.939 bits (302), Expect = 4.784e-29
Identity = 75/204 (36.76%), Postives = 108/204 (52.94%), Query Frame = 3
Query:  375 GDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDV---ESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGA--RDLFTL 971
            G   +TGS D T +VWD   G  L TL GH   V  + ++      +V+G +D T K+W+A+ G    T  GH   V  + F    ++V +G +DT   +WD    E  +CV+ LQGHT    SL  G    G  L++ + D  V +WD+H G  V  L GH + I++  + F    VAT+S D ++K+WD+  GA  RDL TL
Sbjct:  348 GSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQFD---GTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHT----SLTSGMQLRGNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAITSLQW-FGRNMVATSSDDGTVKLWDIERGALIRDLVTL 543          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 146.747 bits (369), Expect = 5.488e-38
Identity = 101/326 (30.98%), Postives = 160/326 (49.08%), Query Frame = 3
Query:  363 FNKNGDRFLTGSYDRTCKVWDTS--MGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPS-----FIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            F +  D+      D+  K W+ +  MG+ +  L GH++ V  I       D +VTGS D T K+W  + G + +T  GHT  V   Q +     + +G  D    +W    G  +  LQGHT+ V  +    A  G  L+TGS D T+ +WDV +GR ++ L GH A +      FDGT V +   D ++KIW+   G R + TL GH + V  + F++    V S   D ++R+W   DF++P       + +GH +  S +    +G +L+S +AD   R W+   G  + +L GH   I S  + +  + + T S D T ++W
Sbjct:  219 FERAADKSRYLRADKIEKNWNANPIMGSAV--LRGHEDHV--ITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCM----AMAGSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCV--QFDGTTVVSGGYDFTVKIWNAHTG-RCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVW---DFTRPEGQECVALLQGHTSLTSGMQL--RGNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAITSLQW-FGRNMVATSSDDGTVKLW 527          

HSP 2 Score: 120.553 bits (301), Expect = 5.549e-29
Identity = 75/204 (36.76%), Postives = 108/204 (52.94%), Query Frame = 3
Query:  375 GDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDV---ESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGA--RDLFTL 971
            G   +TGS D T +VWD   G  L TL GH   V  + ++      +V+G +D T K+W+A+ G    T  GH   V  + F    ++V +G +DT   +WD    E  +CV+ LQGHT    SL  G    G  L++ + D  V +WD+H G  V  L GH + I++  + F    VAT+S D ++K+WD+  GA  RDL TL
Sbjct:  346 GSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQFD---GTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHT----SLTSGMQLRGNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAITSLQW-FGRNMVATSSDDGTVKLWDIERGALIRDLVTL 541          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 146.747 bits (369), Expect = 5.488e-38
Identity = 101/326 (30.98%), Postives = 160/326 (49.08%), Query Frame = 3
Query:  363 FNKNGDRFLTGSYDRTCKVWDTS--MGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPS-----FIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            F +  D+      D+  K W+ +  MG+ +  L GH++ V  I       D +VTGS D T K+W  + G + +T  GHT  V   Q +     + +G  D    +W    G  +  LQGHT+ V  +    A  G  L+TGS D T+ +WDV +GR ++ L GH A +      FDGT V +   D ++KIW+   G R + TL GH + V  + F++    V S   D ++R+W   DF++P       + +GH +  S +    +G +L+S +AD   R W+   G  + +L GH   I S  + +  + + T S D T ++W
Sbjct:  219 FERAADKSRYLRADKIEKNWNANPIMGSAV--LRGHEDHV--ITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCM----AMAGSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCV--QFDGTTVVSGGYDFTVKIWNAHTG-RCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVW---DFTRPEGQECVALLQGHTSLTSGMQL--RGNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAITSLQW-FGRNMVATSSDDGTVKLW 527          

HSP 2 Score: 120.553 bits (301), Expect = 5.549e-29
Identity = 75/204 (36.76%), Postives = 108/204 (52.94%), Query Frame = 3
Query:  375 GDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDV---ESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGA--RDLFTL 971
            G   +TGS D T +VWD   G  L TL GH   V  + ++      +V+G +D T K+W+A+ G    T  GH   V  + F    ++V +G +DT   +WD    E  +CV+ LQGHT    SL  G    G  L++ + D  V +WD+H G  V  L GH + I++  + F    VAT+S D ++K+WD+  GA  RDL TL
Sbjct:  346 GSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQFD---GTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHT----SLTSGMQLRGNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAITSLQW-FGRNMVATSSDDGTVKLWDIERGALIRDLVTL 541          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Celegans
Match: W07E6.2 (pep chromosome:WBcel235:II:480722:484386:-1 gene:WBGene00021074.1 transcript:W07E6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07E6.2)

HSP 1 Score: 136.346 bits (342), Expect = 6.662e-35
Identity = 108/428 (25.23%), Postives = 189/428 (44.16%), Query Frame = 3
Query:  180 TNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKV-PVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDG-SLYHTFKGHTAEVVCVQF-----NPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLI-TGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFD---------------------------------------GTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            T   E+VD I K+   +     +T ++L+   Q   +V PV +       +  H  P+ +  F+ +G    +GS D+T ++WD  +   L T + HK+ V  IA++ P + KI +   +    +W+A  G  +  T K H   +  + +     +P+  L+ + G D    +WD   G  V  L GHTA V  L++G    G+ LI +GS D TV +W   +G     + GH   I+    N D                                       G  + + S D ++ +W+ +   + +  + GH   V  V F    + +ASA  D +V+LW      K     +GH   V +V ++    +L+S SAD + + +   T  +   L GH DE+F+  ++ +G+K+++G KD   ++W+
Sbjct:   57 TEGAEIVDSIRKSLEEIDF---ETTLKLVYQPQAVFRVRPVTRCSA---SIPGHGEPVISAQFSPDGRGLASGSGDQTMRIWDIELELPLHTCKSHKSWVLCIAWS-PDATKIASACKNGEICIWNAKTGEQIGKTLKRHKQWITSLAWQPMHKDPTCRLLASCGKDGNIFIWDTVQGTVVRCLSGHTASVTCLRWG----GEGLIYSGSQDRTVKMWRADDGVMCRNMTGHAHWINTLALNTDYALRTSCFEPSKRCIKPDTVEECQKVAQTRYEAALEIAGGERLVSGSDDFTLFMWNPKETKQSINRMTGHMQLVNQVVFSPDTRYIASASFDKSVKLW-CGRTGKYLASLRGHVGPVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYYDLPGHGDEVFTVDWSPEGTKVVSGGKDKVLKLWR 472          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Celegans
Match: wdr-5.3 (WD repeat-containing protein wdr-5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q23256])

HSP 1 Score: 135.961 bits (341), Expect = 1.537e-34
Identity = 94/354 (26.55%), Postives = 160/354 (45.20%), Query Frame = 3
Query:  288 KVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVV--YSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDN----VGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITG--SKDNTCRIWQ 1322
            K P +  + L K +  H   ++ + F+  G    TGS D+  KVW+T   T L TL  H+  +  +S + N  F   I + S D T K++    G+   T +GHT  V C  FNP S+L+ + G D    +WD ++G CV  +  H+  + S+ +   H+G  + T S+D  + +WD  +G  +  L+  D A ++   F+ +G Y+ +A +D S+K+WD +  A+ L    GH ++     F N    +GK + S   D  + +W ++                                           T +++Q+LEGHT  + +   +   + I +G    DN  RIW+
Sbjct:  196 KKPENGEFSLVKTISGHTKSVSVIKFSYCGKYLGTGSADKQIKVWNTVDMTYLQTLASHQLGINDFSWSSNSQF---IASASDDTTVKIFDVISGACLRTMRGHTNYVFCCSFNPQSSLIASAGFDETVRVWDFKTGLCVKCIPAHSDPITSISYN--HDGNTMATSSYDGCIRVWDAASGSCLKTLVDTDHAPVTFVCFSPNGKYLLSAQLDSSLKLWDPKK-AKPLKYYNGHKNKKY-CLFANMSVPLGKHIISGSEDGRILVWSIQ-------------------------------------------TKQIVQILEGHTTPVLATDSHPTLNIIASGGLEPDNVIRIWR 499          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Fly
Match: CG7568 (gene:FBgn0039673 transcript:FBtr0330294)

HSP 1 Score: 363.999 bits (933), Expect = 1.487e-121
Identity = 193/470 (41.06%), Postives = 276/470 (58.72%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQ-RGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIEL--------------------------IKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLP---------------------FSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNP-SSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSF--IFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            M   +  +RY+PPG+ + Y+  +G  + + FDLLDL S+TN E + D I+  + L   +   +  +L                          ++ LQ+KL+ PV K + L K   +HILPLTNV+F+++G+R LTGSYDRTC V +T        L GH NVV+S+ +N P                     FSDKIVTGSFD TAK+WSA  G    TF GHTAE+V  +F+P     + T  +D  A ++DVE+   +  L  H AEVI+ +F +  +G+ L+TGSFDH+  +WDV +     QL GH AE+S  V+NF G+ +AT S+D + +IWD R   ++L+  A H+DEVLDV+FD  G+ +A+  +D T R+W ++  S+     +  GH  EVSKV F+P G +LL+ASAD +AR W T +G+  QVL GH  E+FSCA++Y G  I+T SKDN+CR W+
Sbjct:    1 MSATKIFLRYYPPGLAVNYKTTKGNERLRHFDLLDLDSKTNIEPLADRIL-LQTLAEAEEEQSPADLEKSPPPRPVSGSVARSQNAFSALKQALEKLQKKLREPVKKKFYLHKCHNSHILPLTNVSFDRSGERCLTGSYDRTCHVINTQTAQVEHILSGHDNVVFSVGFNFPHWLVYLQSGGSGNNLTTFSIIFSDKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNR--DGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVFSCAYSYAGDAILTASKDNSCRFWR 467          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Fly
Match: CG7568 (gene:FBgn0039673 transcript:FBtr0330295)

HSP 1 Score: 363.614 bits (932), Expect = 4.366e-121
Identity = 193/470 (41.06%), Postives = 276/470 (58.72%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQ-RGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIEL--------------------------IKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLP---------------------FSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNP-SSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSF--IFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            M   +  +RY+PPG+ + Y+  +G  + + FDLLDL S+TN E + D I+  + L   +   +  +L                          ++ LQ+KL+ PV K + L K   +HILPLTNV+F+++G+R LTGSYDRTC V +T        L GH NVV+S+ +N P                     FSDKIVTGSFD TAK+WSA  G    TF GHTAE+V  +F+P     + T  +D  A ++DVE+   +  L  H AEVI+ +F +  +G+ L+TGSFDH+  +WDV +     QL GH AE+S  V+NF G+ +AT S+D + +IWD R   ++L+  A H+DEVLDV+FD  G+ +A+  +D T R+W ++  S+     +  GH  EVSKV F+P G +LL+ASAD +AR W T +G+  QVL GH  E+FSCA++Y G  I+T SKDN+CR W+
Sbjct:    1 MSATKIFLRYYPPGLAVNYKTTKGNERLRHFDLLDLDSKTNIEPLADRIL-LQTLAEAEEEQSPADLEKSPPPRPVSGSVARSQNAFSALKQALEKLQKKLREPVKKKFYLHKCHNSHILPLTNVSFDRSGERCLTGSYDRTCHVINTQTAQVEHILSGHDNVVFSVGFNFPHWLVYLQSGGSGNNLTTFSIIFSDKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNR--DGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVFSCAYSYAGDAILTASKDNSCRFWR 467          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 145.976 bits (367), Expect = 4.741e-39
Identity = 96/312 (30.77%), Postives = 157/312 (50.32%), Query Frame = 3
Query:  297 VDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDK--IVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV----GKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASA--DKSARTWNTTT 1205
            V   Y L   L  H   ++ V F+ NG+   + S D+  K+W    G    T+ GHK  +  +A++   SD   +V+GS DKT K+W  + G    T KGH+  V C  FNP S L+ +G  D    +WDV +GKC+  L  H+  V ++ F +  +G  +++ S+D    +WD  +G+ +  LI  D   +S   F+ +G Y+  A++D ++K+WD   G + L T  GH +E   + F N     GK + S   DN V +W+++   +     +GH   V     +P   ++ SA+   DK+ + W + T
Sbjct:   58 VKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWS---SDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNR--DGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKG-KCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNMVYIWNLQS-KEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT 361          

HSP 2 Score: 140.969 bits (354), Expect = 2.514e-37
Identity = 93/303 (30.69%), Postives = 148/303 (48.84%), Query Frame = 3
Query:  438 TTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFN---PQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS---KDNTCRIWQ 1322
            T  FTL GH   V ++ ++ P  + + + S DK  K+W A DG    T  GH   +  V ++  S L+ +G  D    +W++ +GK +  L+GH+  V    F    N   +++GSFD +V +WDV  G+ +  L  H   +SA  FN DG+ + ++S D   +IWD   G      +      V  V F   GK + +A  DNT++LWD   +SK   +  + GH+ E   +  N     G  ++S S D     WN  + +V+Q L+GHTD +  C   +    II  +    D T ++W+
Sbjct:   63 TLKFTLAGHTKAVSAVKFS-PNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSN--LIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWD---YSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVL-CTACHPTENIIASAALENDKTIKLWK 358          

HSP 3 Score: 56.9954 bits (136), Expect = 1.463e-8
Identity = 30/84 (35.71%), Postives = 45/84 (53.57%), Query Frame = 3
Query: 1083 KPSFIFK----GHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            KP++  K    GH   VS V F+P G  L S+SADK  + W    GK  + + GH   I   A++ D   +++GS D T ++W+
Sbjct:   59 KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWE 142          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 145.976 bits (367), Expect = 4.741e-39
Identity = 96/312 (30.77%), Postives = 157/312 (50.32%), Query Frame = 3
Query:  297 VDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDK--IVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV----GKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASA--DKSARTWNTTT 1205
            V   Y L   L  H   ++ V F+ NG+   + S D+  K+W    G    T+ GHK  +  +A++   SD   +V+GS DKT K+W  + G    T KGH+  V C  FNP S L+ +G  D    +WDV +GKC+  L  H+  V ++ F +  +G  +++ S+D    +WD  +G+ +  LI  D   +S   F+ +G Y+  A++D ++K+WD   G + L T  GH +E   + F N     GK + S   DN V +W+++   +     +GH   V     +P   ++ SA+   DK+ + W + T
Sbjct:   58 VKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWS---SDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNR--DGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKG-KCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNMVYIWNLQS-KEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT 361          

HSP 2 Score: 140.969 bits (354), Expect = 2.514e-37
Identity = 93/303 (30.69%), Postives = 148/303 (48.84%), Query Frame = 3
Query:  438 TTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFN---PQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS---KDNTCRIWQ 1322
            T  FTL GH   V ++ ++ P  + + + S DK  K+W A DG    T  GH   +  V ++  S L+ +G  D    +W++ +GK +  L+GH+  V    F    N   +++GSFD +V +WDV  G+ +  L  H   +SA  FN DG+ + ++S D   +IWD   G      +      V  V F   GK + +A  DNT++LWD   +SK   +  + GH+ E   +  N     G  ++S S D     WN  + +V+Q L+GHTD +  C   +    II  +    D T ++W+
Sbjct:   63 TLKFTLAGHTKAVSAVKFS-PNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSN--LIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWD---YSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVL-CTACHPTENIIASAALENDKTIKLWK 358          

HSP 3 Score: 56.9954 bits (136), Expect = 1.463e-8
Identity = 30/84 (35.71%), Postives = 45/84 (53.57%), Query Frame = 3
Query: 1083 KPSFIFK----GHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            KP++  K    GH   VS V F+P G  L S+SADK  + W    GK  + + GH   I   A++ D   +++GS D T ++W+
Sbjct:   59 KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWE 142          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Fly
Match: Taf5 (gene:FBgn0010356 transcript:FBtr0088240)

HSP 1 Score: 144.436 bits (363), Expect = 1.068e-36
Identity = 82/260 (31.54%), Postives = 135/260 (51.92%), Query Frame = 3
Query:  225 LVTIKRRDTVIELIKNLQE-KLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDL----FTLAGHTDE 989
            L T+K  D++ EL K   +  +++  D++  + + L  H  P+    F    +  L+ S D T ++W     + + T  GH   V+ + +  P     V+ S+DKTA++W+ +       F GH ++V CVQF+P+S  V TG  D    LWD  +G+ V  + GH   V SL F     G++L +GS DH +I+WD+ NG  V+ L+ H + ++   F+ DGT +A A +D ++ +WD      D      T++ H DE
Sbjct:  411 LRTLKDADSLRELDKESADINVRMLDDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRF-APHGYYFVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMTGHKGSVSSLAFSAC--GRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLWDFHKVTEDYISNHITVSHHQDE 667          

HSP 2 Score: 121.709 bits (304), Expect = 5.035e-29
Identity = 77/224 (34.38%), Postives = 114/224 (50.89%), Query Frame = 3
Query:  396 SYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWD 1067
            S D   ++ D   G    +L GH   VY  A+  P  + +++ S D T ++WS    S   T++GH   V  V+F P      +   D  A LW  +S + +    GH ++V  +QF    N  ++ TGS D TV LWD   G+ V  + GH   +S+  F+  G Y+A+ S+D +I IWDL  G+  + TL  HT  V  +TF   G  +A+AG DN + LWD
Sbjct:  427 SADINVRMLDDRSGEVTRSLMGHTGPVYRCAF-APEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPHGYYFVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHP--NSNYVATGSSDRTVRLWDNMTGQSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSL-VTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLWD 646          

HSP 3 Score: 110.153 bits (274), Expect = 2.630e-25
Identity = 61/224 (27.23%), Postives = 112/224 (50.00%), Query Frame = 3
Query:  525 SFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWN 1196
            S D   +M     G +  +  GHT  V    F P   L+ +   D+   LW + +  CV   +GH   V  ++F  A +G + ++ S+D T  LW   + + +   +GH +++    F+ +  YVAT S D+++++WD  M  + +  + GH   V  + F   G+ +AS   D+ + +WD+ + S  + + + H + V+ +TF+  GTVL +A  D +   W+
Sbjct:  427 SADINVRMLDDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRF--APHGYYFVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWD-NMTGQSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLLR-HTSTVTTITFSRDGTVLAAAGLDNNLTLWD 646          

HSP 4 Score: 97.0561 bits (240), Expect = 5.713e-21
Identity = 64/252 (25.40%), Postives = 112/252 (44.44%), Query Frame = 3
Query:  564 GSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
             ++++T       V C + +  ST++  G  D+   +W +   K  +                A + + L   S D  V + D  +G     L+GH   +    F  +   + + S D +I++W L +    + T  GH   V DV F   G    S   D T RLW   D ++   +F GH ++V  V F+P    + + S+D++ R W+  TG+ ++++ GH   + S AF+  G  + +GS D+   IW
Sbjct:  367 SAVFYTVLNSHQGVTCAEISDDSTMLACGFGDSSVRIWSLTPAKLRT-------------LKDADSLRELDKESADINVRMLDDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSL-LTWSCVVTYRGHVYPVWDVRFAPHGYYFVSCSYDKTARLW-ATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIW 603          

HSP 5 Score: 88.1965 bits (217), Expect = 3.824e-18
Identity = 63/217 (29.03%), Postives = 96/217 (44.24%), Query Frame = 3
Query:  672 LWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSF-IFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            + D  SG+   +L GHT  V    F    N   L++ S D T+ LW +     V    GH   +    F   G Y  + S DK+ ++W      + L    GH  +V  V F      VA+  +D TVRLWD  + +  S  +  GH+  VS + F+  G  L S S D +   W+ + G ++  L  HT  + +  F+ DG+ +     DN   +W
Sbjct:  434 MLDDRSGEVTRSLMGHTGPVYRCAFAPEMNL--LLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPHGYYFVSCSYDKTARLWATD-SNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWD--NMTGQSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLW 645          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 496.893 bits (1278), Expect = 2.497e-174
Identity = 241/419 (57.52%), Postives = 304/419 (72.55%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            M+LKR  +RY+PPGI L+YE+ G+++TK  DLL+LT ET+ EE+V  I   E L+T    + V  LI  LQEK+    ++ + LF+ L+AHILPLTNV FNK+G  F+TGSYDRTCK+WDT+ G  L TLEGH+NVVY+IA+N P+ DK+ TGSFDKT K+WSA  G  ++TF+GHTAE+VC+ FNP STLV TG MDT A LWDVESG+ VS L GH AE+ISL F     G  L+TGSFDHT ILWDV +GR+V  L GH  EIS   FN+D + +ATAS+DKS K+WD   G + L TL GH DEVLDV F+  G+ +A+A AD T R++    F +     +GH+ E+SKV FN QG+ +L+AS DK++R W   TG  +QVLEGH+DEIFSCAFNY+G  IITGSKDNTCRIW 
Sbjct:    1 MRLKRMHIRYYPPGIFLDYEKGGQLRTKCIDLLNLTPETDVEELVLEIRAAEPLITSSCVEQVKLLICKLQEKVSQKDERKFYLFRALQAHILPLTNVAFNKSGSCFITGSYDRTCKIWDTASGEELHTLEGHRNVVYAIAFNNPYGDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNT--TGDRLVTGSFDHTAILWDVPSGRKVHVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAE-GGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTF-QCLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVWCVKTGACLQVLEGHSDEIFSCAFNYEGDTIITGSKDNTCRIWH 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 476.863 bits (1226), Expect = 2.476e-166
Identity = 232/410 (56.59%), Postives = 296/410 (72.20%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS 1295
            M+LKR  +RY+PPGI L+YE+ G+++TK  DLL+LT ET+ EE+V  I   E L+T    + V  LI  LQEK+    ++ + LF+ L+AHILPLTNV FNK+G  F+TGSYDRTCK+WDT+ G  L TLEGH+NVVY+IA+N P+ DK+ TGSFDKT K+WSA  G  ++TF+GHTAE+VC+ FNP STLV TG MDT A LWDVESG+ VS L GH AE+ISL F     G  L+TGSFDHT ILWDV +GR+V  L GH  EIS   FN+D + +ATAS+DKS K+WD   G + L TL GH DEVLDV F+  G+ +A+A AD T R++    F +     +GH+ E+SKV FN QG+ +L+AS DK++R W   TG  +QVLEGH+DEIFSCAFNY+G  IITG+
Sbjct:    1 MRLKRMHIRYYPPGIFLDYEKGGQLRTKCIDLLNLTPETDVEELVLEIRAAEPLITSSCVEQVKLLICKLQEKVSQKDERKFYLFRALQAHILPLTNVAFNKSGSCFITGSYDRTCKIWDTASGEELHTLEGHRNVVYAIAFNNPYGDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNT--TGDRLVTGSFDHTAILWDVPSGRKVHVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAE-GGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTF-QCLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVWCVKTGACLQVLEGHSDEIFSCAFNYEGDTIITGN 406          

HSP 2 Score: 166.392 bits (420), Expect = 5.689e-46
Identity = 89/250 (35.60%), Postives = 129/250 (51.60%), Query Frame = 3
Query:  570 LYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L+   + H   +  V FN S +   TG  D    +WD  SG+ +  L+GH   V ++ F   + G  + TGSFD T  LW    G+      GH AEI    FN   T VAT SMD + K+WD+  G  ++ TLAGH  E++ + F+  G ++ +   D+T  LWDV    +   +  GH  E+S V FN   +++ +AS DKS + W+   G+ +  L GH DE+    FNY G  I T S D T R++
Sbjct:   84 LFRALQAHILPLTNVAFNKSGSCFITGSYDRTCKIWDTASGEELHTLEGHRNVVYAIAFNNPY-GDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESG-EEVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWDVPS-GRKVHVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVF 330          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 150.214 bits (378), Expect = 6.970e-41
Identity = 97/302 (32.12%), Postives = 150/302 (49.67%), Query Frame = 3
Query:  438 TTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFN---PQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS--KDNTCRIWQ 1322
            T  FTL GH   V S+ ++ P  + + + S DK  K+W A DG    T  GH   +  V ++  S L+ +   D    +WDV SGKC+  L+GH+  V    F    N   +++GSFD +V +WDV  G+ +  L  H   +SA  FN DG+ + ++S D   +IWD   G      +      V  V F   GK + +A  DNT++LWD   +SK   +  + GH+ E   +  N     G  ++S S D     WN  T +++Q L+GHTD + S A +   + I + +   D T ++W+
Sbjct:   36 TLKFTLAGHTKAVSSVKFS-PSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSN--LIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWD---YSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          

HSP 2 Score: 148.673 bits (374), Expect = 3.247e-40
Identity = 94/311 (30.23%), Postives = 159/311 (51.13%), Query Frame = 3
Query:  294 PVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV----GKQVASAGADNTVRLWDV--KDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASA--DKSARTWNT 1199
            PV   Y L   L  H   +++V F+ +G+   + S D+  K+W    G    T+ GHK  +  +A++   S+ +V+ S DKT K+W  + G    T KGH+  V C  FNP S L+ +G  D    +WDV++GKC+  L  H+  V ++ F +  +G  +++ S+D    +WD  +G+ +  LI  D   +S   F+ +G Y+  A++D ++K+WD   G + L T  GH +E   + F N     GK + S   DN V +W++  K+  +     +GH   V     +P   ++ SA+   DK+ + W +
Sbjct:   30 PVKPNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSD-SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNR--DGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKG-KCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQK---LQGHTDVVISTACHPTENIIASAALENDKTIKLWKS 332          

HSP 3 Score: 92.4337 bits (228), Expect = 3.425e-20
Identity = 58/186 (31.18%), Postives = 91/186 (48.92%), Query Frame = 3
Query:  270 NLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSST---LVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSF---DHTVILW 809
            +  E +++   KT    K L AH  P++ V FN++G   ++ SYD  C++WDT+ G  L TL    N   S     P    I+  + D T K+W  + G    T+ GH  E  C+  N S T    + +G  D +  +W++++ + V  LQGHT  VIS      H  +++I  +    D T+ LW
Sbjct:  148 SFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVIST---ACHPTENIIASAALENDKTIKLW 330          

HSP 4 Score: 55.0694 bits (131), Expect = 7.569e-8
Identity = 30/83 (36.14%), Postives = 44/83 (53.01%), Query Frame = 3
Query: 1083 KPSFIFK----GHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            KP++  K    GH   VS V F+P G  L S+SADK  + W    GK  + + GH   I   A++ D + +++ S D T +IW
Sbjct:   32 KPNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIW 114          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Zebrafish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-090313-79])

HSP 1 Score: 147.902 bits (372), Expect = 1.940e-38
Identity = 93/288 (32.29%), Postives = 154/288 (53.47%), Query Frame = 3
Query:  375 GDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTF-DNVGKQVASAGADNTVRLWDVKDFSKPSFIFKG---HEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVL 1226
            G+R ++GS D T KVW    G  L TL GH   V+S        + I++GS D+T K+W+A  G   HT  GHT+ V C+  +     V +G  D    +WD+E+G+C+  L GH A V  +Q+    +G+ +++G++D  V +WD      +  L GH   + +    FDG +V + S+D SI++WD+  G   + TL GH      +   DN+   + S  AD+TV++WD+K   +     +G   H++ V+ + FN     ++++S D + + W+  TG+ I+ L
Sbjct:  228 GNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMR---DNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY----DGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETG-NCIHTLTGHQSLTSGMELKDNI---LVSGNADSTVKIWDIKT-GQCLQTLQGPHKHQSAVTCLQFNK--NFVITSSDDGTVKLWDLRTGEFIRNL 497          

HSP 2 Score: 139.043 bits (349), Expect = 3.437e-35
Identity = 90/291 (30.93%), Postives = 149/291 (51.20%), Query Frame = 3
Query:  453 LEGHKNVVYSIAYNLPFS-DKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEG-HTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L+GH + V +    L F  ++IV+GS D T K+WSA  G    T  GHT  V   Q      ++ +G  D    +W+ E+G+C+  L GHT+ V  +   +    K +++GS D T+ +WD+  G+ +  L+GH A +      +DG  V + + D  +K+WD       L TL GHT+ V  + FD  G  V S   D ++R+WDV +         GH++  S +    +  +L+S +AD + + W+  TG+ +Q L+G H  +       ++ + +IT S D T ++W
Sbjct:  213 LKGHDDHVITC---LQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE----KRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETET-CLHTLQGHTNRVYSLQFD--GIHVVSGSLDTSIRVWDV-ETGNCIHTLTGHQSLTSGMEL--KDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLW 486          

HSP 3 Score: 105.531 bits (262), Expect = 8.022e-24
Identity = 74/258 (28.68%), Postives = 118/258 (45.74%), Query Frame = 3
Query:  549 WSANDGSLYHTFKGHTAEVV-CVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            W   D       KGH   V+ C+QF      + +G  D    +W   +GKC+  L GHT  V S Q         +I+GS D T+ +W+   G  +  L GH + +     +     V + S D ++++WD+  G + L  L GH   V  V +D  G++V S   D  V++WD  +        +GH   V  + F+  G  ++S S D S R W+  TG  I  L GH  +  +       + +++G+ D+T +IW
Sbjct:  202 WRRGDLKSPKVLKGHDDHVITCLQF--CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQM----RDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRC--MHLHEKRVVSGSRDATLRVWDIETG-QCLHVLMGHVAAVRCVQYD--GRRVVSGAYDFMVKVWD-PETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLDTSIRVWDVETGNCIHTLTGH--QSLTSGMELKDNILVSGNADSTVKIW 443          

HSP 4 Score: 102.834 bits (255), Expect = 6.070e-23
Identity = 64/200 (32.00%), Postives = 103/200 (51.50%), Query Frame = 3
Query:  285 LKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQG---HTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAV 875
            L+V   +T     VL  H+  +  V ++  G R ++G+YD   KVWD    T L TL+GH N VYS+ ++      +V+GS D + ++W    G+  HT  GH +    ++      ++ +G  D+   +WD+++G+C+  LQG   H + V  LQF    N   +IT S D TV LWD+  G  +  L+  ++  S  V
Sbjct:  320 LRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD---GIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQF----NKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGV 508          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Zebrafish
Match: AL954386.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:564991])

HSP 1 Score: 147.902 bits (372), Expect = 2.420e-38
Identity = 93/288 (32.29%), Postives = 154/288 (53.47%), Query Frame = 3
Query:  375 GDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTF-DNVGKQVASAGADNTVRLWDVKDFSKPSFIFKG---HEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVL 1226
            G+R ++GS D T KVW    G  L TL GH   V+S        + I++GS D+T K+W+A  G   HT  GHT+ V C+  +     V +G  D    +WD+E+G+C+  L GH A V  +Q+    +G+ +++G++D  V +WD      +  L GH   + +    FDG +V + S+D SI++WD+  G   + TL GH      +   DN+   + S  AD+TV++WD+K   +     +G   H++ V+ + FN     ++++S D + + W+  TG+ I+ L
Sbjct:  230 GNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMR---DNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY----DGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETG-NCIHTLTGHQSLTSGMELKDNI---LVSGNADSTVKIWDIKT-GQCLQTLQGPHKHQSAVTCLQFNK--NFVITSSDDGTVKLWDLRTGEFIRNL 499          

HSP 2 Score: 138.658 bits (348), Expect = 4.098e-35
Identity = 90/291 (30.93%), Postives = 149/291 (51.20%), Query Frame = 3
Query:  453 LEGHKNVVYSIAYNLPFS-DKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEG-HTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L+GH + V +    L F  ++IV+GS D T K+WSA  G    T  GHT  V   Q      ++ +G  D    +W+ E+G+C+  L GHT+ V  +   +    K +++GS D T+ +WD+  G+ +  L+GH A +      +DG  V + + D  +K+WD       L TL GHT+ V  + FD  G  V S   D ++R+WDV +         GH++  S +    +  +L+S +AD + + W+  TG+ +Q L+G H  +       ++ + +IT S D T ++W
Sbjct:  215 LKGHDDHVITC---LQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE----KRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETET-CLHTLQGHTNRVYSLQFD--GIHVVSGSLDTSIRVWDV-ETGNCIHTLTGHQSLTSGMEL--KDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLW 488          

HSP 3 Score: 102.834 bits (255), Expect = 6.064e-23
Identity = 64/200 (32.00%), Postives = 103/200 (51.50%), Query Frame = 3
Query:  285 LKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQG---HTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAV 875
            L+V   +T     VL  H+  +  V ++  G R ++G+YD   KVWD    T L TL+GH N VYS+ ++      +V+GS D + ++W    G+  HT  GH +    ++      ++ +G  D+   +WD+++G+C+  LQG   H + V  LQF    N   +IT S D TV LWD+  G  +  L+  ++  S  V
Sbjct:  322 LRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD---GIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQF----NKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGV 510          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 252/419 (60.14%), Postives = 313/419 (74.70%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            M+LKRFL+RYFPPGIILEYE+ GE+KTKA DLL+L+  T+ + VV+ I K E L+T  R   V +LI  LQEK+     + + LFKVLRAHILPLTNV FNK+G  F+TGSYDRTCKVWDT+ G  L TLEGH+NVVY+I +N P+ DKI TGSFDKT K+WSA  G  YHTF+GHTAE+VC+ FNP STL+ TG MDT A LWD++SG+    L GH AE+ISL F     G  LITGSFDHTV +W++ +GRR   LIGH  EIS+A FN+D + +ATASMDKS K+WD  +  + + TL GH DEVLDVTFD+ G+ VA+A AD T R++      K     +GHE E+SK+ FN QG  +L+AS+DK++R WN  TG+ +QVL+GHTDEIFSCAFNY+G+ IITGSKDNTCRIW+
Sbjct:   21 MRLKRFLLRYFPPGIILEYEKGGELKTKAIDLLELSPTTDVDLVVEEIQKAEPLITASRTQQVKQLILRLQEKIGQQDSRQFYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNT--TGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWD-SLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASS-RKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITGSKDNTCRIWR 435          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 499.975 bits (1286), Expect = 7.934e-175
Identity = 245/417 (58.75%), Postives = 304/417 (72.90%), Query Frame = 3
Query:   75 KRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIIT--GSKDNTCRIW 1319
            KRFL+RYFPPGIILEYE+ GE+KTKA DLL+L+  T+ + VV+ I K E L+T  R   V +LI  LQEK+     + + LFKVLRAHILPLTNV FNK+G  F+TGSYDRTCKVWDT+ G  L TLEGH+NVVY+I +N P+ DKI TGSFDKT K+WSA  G  YHTF+GHTAE+VC+ FNP STL+ TG MDT A LWD++SG+    L GH AE+ISL F     G  LITGSFDHTV +W++ +GRR   LIGH  EIS+A FN+D + +ATASMDKS K+WD  +  + + TL GH DEVLDVTFD+ G+ VA+A AD T R++      K     +GHE E+SK+ FN QG  +L+AS+DK++R WN  TG+ +QVL+GHTDEIFSCAFNY+G+ IIT  GS    CR W
Sbjct:   28 KRFLLRYFPPGIILEYEKGGELKTKAIDLLELSPTTDVDLVVEEIQKAEPLITASRTQQVKQLILRLQEKIGQQDSRQFYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNT--TGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWD-SLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASS-RKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITEIGSSFFMCRAW 440          

HSP 2 Score: 110.538 bits (275), Expect = 1.120e-25
Identity = 58/162 (35.80%), Postives = 90/162 (55.56%), Query Frame = 3
Query:  840 LIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDN-VGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            L  H   ++   FN  G+   T S D++ K+WD   G  +L TL GH + V  + F+N  G ++A+   D T +LW  +   K    F+GH AE+  + FNPQ T++ + S D +A+ W+  +G+    L GH  EI S +FN  G ++ITGS D+T  +W+
Sbjct:  112 LRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASG-EELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAET-GKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWE 271          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 481.871 bits (1239), Expect = 5.097e-168
Identity = 241/423 (56.97%), Postives = 303/423 (71.63%), Query Frame = 3
Query:   66 MKLKRFLVRYFP---PGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIIT--GSKDNTCRIW 1319
            ++LK+ L + F    PGIILEYE+ GE+KTKA DLL+L+  T+ + VV+ I K E L+T  R   V +LI  LQEK+     + + LFKVLRAHILPLTNV FNK+G  F+TGSYDRTCKVWDT+ G  L TLEGH+NVVY+I +N P+ DKI TGSFDKT K+WSA  G  YHTF+GHTAE+VC+ FNP STL+ TG MDT A LWD++SG+    L GH AE+ISL F     G  LITGSFDHTV +W++ +GRR   LIGH  EIS+A FN+D + +ATASMDKS K+WD  +  + + TL GH DEVLDVTFD+ G+ VA+A AD T R++      K     +GHE E+SK+ FN QG  +L+AS+DK++R WN  TG+ +QVL+GHTDEIFSCAFNY+G+ IIT  GS    CR W
Sbjct:    7 IRLKQRLFQLFNFLFPGIILEYEKGGELKTKAIDLLELSPTTDVDLVVEEIQKAEPLITASRTQQVKQLILRLQEKIGQQDSRQFYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNT--TGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWD-SLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASS-RKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITEIGSSFFMCRAW 425          

HSP 2 Score: 110.538 bits (275), Expect = 9.499e-26
Identity = 58/162 (35.80%), Postives = 90/162 (55.56%), Query Frame = 3
Query:  840 LIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDN-VGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            L  H   ++   FN  G+   T S D++ K+WD   G  +L TL GH + V  + F+N  G ++A+   D T +LW  +   K    F+GH AE+  + FNPQ T++ + S D +A+ W+  +G+    L GH  EI S +FN  G ++ITGS D+T  +W+
Sbjct:   97 LRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASG-EELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAET-GKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWE 256          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 481.485 bits (1238), Expect = 6.126e-168
Identity = 240/423 (56.74%), Postives = 302/423 (71.39%), Query Frame = 3
Query:   66 MKLKRFLVRYFP---PGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIIT--GSKDNTCRIW 1319
             +L++ L + F    PGIILEYE+ GE+KTKA DLL+L+  T+ + VV+ I K E L+T  R   V +LI  LQEK+     + + LFKVLRAHILPLTNV FNK+G  F+TGSYDRTCKVWDT+ G  L TLEGH+NVVY+I +N P+ DKI TGSFDKT K+WSA  G  YHTF+GHTAE+VC+ FNP STL+ TG MDT A LWD++SG+    L GH AE+ISL F     G  LITGSFDHTV +W++ +GRR   LIGH  EIS+A FN+D + +ATASMDKS K+WD  +  + + TL GH DEVLDVTFD+ G+ VA+A AD T R++      K     +GHE E+SK+ FN QG  +L+AS+DK++R WN  TG+ +QVL+GHTDEIFSCAFNY+G+ IIT  GS    CR W
Sbjct:    1 FQLRKMLFQLFNFLFPGIILEYEKGGELKTKAIDLLELSPTTDVDLVVEEIQKAEPLITASRTQQVKQLILRLQEKIGQQDSRQFYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNT--TGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWD-SLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASS-RKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITEIGSSFFMCRAW 419          

HSP 2 Score: 110.153 bits (274), Expect = 1.207e-25
Identity = 58/162 (35.80%), Postives = 90/162 (55.56%), Query Frame = 3
Query:  840 LIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDN-VGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            L  H   ++   FN  G+   T S D++ K+WD   G  +L TL GH + V  + F+N  G ++A+   D T +LW  +   K    F+GH AE+  + FNPQ T++ + S D +A+ W+  +G+    L GH  EI S +FN  G ++ITGS D+T  +W+
Sbjct:   91 LRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASG-EELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAET-GKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWE 250          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 481.1 bits (1237), Expect = 9.766e-168
Identity = 238/414 (57.49%), Postives = 297/414 (71.74%), Query Frame = 3
Query:   84 LVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIIT--GSKDNTCRIW 1319
            L  +  PGIILEYE+ GE+KTKA DLL+L+  T+ + VV+ I K E L+T  R   V +LI  LQEK+     + + LFKVLRAHILPLTNV FNK+G  F+TGSYDRTCKVWDT+ G  L TLEGH+NVVY+I +N P+ DKI TGSFDKT K+WSA  G  YHTF+GHTAE+VC+ FNP STL+ TG MDT A LWD++SG+    L GH AE+ISL F     G  LITGSFDHTV +W++ +GRR   LIGH  EIS+A FN+D + +ATASMDKS K+WD  +  + + TL GH DEVLDVTFD+ G+ VA+A AD T R++      K     +GHE E+SK+ FN QG  +L+AS+DK++R WN  TG+ +QVL+GHTDEIFSCAFNY+G+ IIT  GS    CR W
Sbjct:   14 LFNFLFPGIILEYEKGGELKTKAIDLLELSPTTDVDLVVEEIQKAEPLITASRTQQVKQLILRLQEKIGQQDSRQFYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNT--TGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWD-SLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASS-RKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITEIGSSFFMCRAW 423          

HSP 2 Score: 110.538 bits (275), Expect = 1.103e-25
Identity = 58/162 (35.80%), Postives = 90/162 (55.56%), Query Frame = 3
Query:  840 LIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDN-VGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            L  H   ++   FN  G+   T S D++ K+WD   G  +L TL GH + V  + F+N  G ++A+   D T +LW  +   K    F+GH AE+  + FNPQ T++ + S D +A+ W+  +G+    L GH  EI S +FN  G ++ITGS D+T  +W+
Sbjct:   95 LRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASG-EELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAET-GKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWE 254          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Mouse
Match: Daw1 (dynein assembly factor with WDR repeat domains 1 [Source:MGI Symbol;Acc:MGI:1923089])

HSP 1 Score: 507.679 bits (1306), Expect = 1.428e-178
Identity = 243/419 (58.00%), Postives = 308/419 (73.51%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            MKLK  L+RY+PPGI+LEYE+ GE+KTK+ DLL+L+  T+   +V  I + E L+T  R   V  L++ LQEKL+   D  + LFKVLRAHILPLTNV  NK G  F+TGSYDRTCKVWDT+ G  L TLEGHKNVVY+IA+N P+ DKI TGSFDKT K+WSA  G  YHTF+GHTAE+VC+ FNP ST+V TG MDT A LWD+++G+ V  L GH AE+ISL F  +  G  +ITGSFDHTV++WD   GR+V  LIGH AEIS+A+FN+D + + T SMDK+  +WD   G + + TL GH DE+LD  FD  GK +A+A AD T R+++     K     +GHE E+SK++FNPQG  LL+ S+DK+AR W+  TG+ +QVLEGHTDEIFSCAFNY G+ +ITGSKDN+CRIW+
Sbjct:    1 MKLKSLLLRYYPPGIMLEYEKGGELKTKSIDLLELSPSTDVNTLVGEIQQAEPLITASRTKQVRLLVQRLQEKLRQHSDHNFYLFKVLRAHILPLTNVALNKAGSCFITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLSFNPQSTVVATGSMDTTAKLWDIQNGEEVVTLTGHLAEIISLSFDTS--GDRIITGSFDHTVVVWDASTGRKVHTLIGHCAEISSALFNWDCSLILTGSMDKTCMLWDATSG-KYVATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATT-RKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNSCRIWR 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Mouse
Match: Daw1 (dynein assembly factor with WDR repeat domains 1 [Source:MGI Symbol;Acc:MGI:1923089])

HSP 1 Score: 283.493 bits (724), Expect = 4.508e-92
Identity = 151/333 (45.35%), Postives = 198/333 (59.46%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLW 1064
            MKLK  L+RY+PPGI+LEYE+ GE+KTK+ DLL+L+  T+   +V  I + E L+T  R   V  L++ LQEKL+   D  + LFKVLRAHILPLTNV  NK G  F+TGSYDRTCKVWDT+ G  L TLEGHKNVVY+IA+N P+                        HT  GH AE+    FN   +L+ TG MD   MLWD  SGK V+ L GH  E++   F   + GK + T S D T  +++    + V++L GH+ EIS   FN  G  + T S DK+ +IWD++ G + L  L GHTDE+    F+  G  V +   DN+ R+W
Sbjct:    1 MKLKSLLLRYYPPGIMLEYEKGGELKTKSIDLLELSPSTDVNTLVGEIQQAEPLITASRTKQVRLLVQRLQEKLRQHSDHNFYLFKVLRAHILPLTNVALNKAGSCFITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYGK---------------------VHTLIGHCAEISSALFNWDCSLILTGSMDKTCMLWDATSGKYVATLTGHDDEILDSCFD--YTGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTG-QCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNSCRIW 309          

HSP 2 Score: 207.608 bits (527), Expect = 8.161e-63
Identity = 106/251 (42.23%), Postives = 148/251 (58.96%), Query Frame = 3
Query:  570 LYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            L+   + H   +  V  N + +   TG  D    +WD  SG+ +  L+GH   V ++ F   +                       +V  LIGH AEIS+A+FN+D + + T SMDK+  +WD   G + + TL GH DE+LD  FD  GK +A+A AD T R+++     K     +GHE E+SK++FNPQG  LL+ S+DK+AR W+  TG+ +QVLEGHTDEIFSCAFNY G+ +ITGSKDN+CRIW+
Sbjct:   84 LFKVLRAHILPLTNVALNKAGSCFITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYG----------------------KVHTLIGHCAEISSALFNWDCSLILTGSMDKTCMLWDATSG-KYVATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATT-RKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNSCRIWR 310          

HSP 3 Score: 57.3806 bits (137), Expect = 1.258e-8
Identity = 41/160 (25.62%), Postives = 69/160 (43.12%), Query Frame = 3
Query:  936 DLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLW------DVKDFSKPSF----IFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTD----------------------EIFSCAFNYDGSKIITGSKDNTCRIW 1319
            +L+  + DL  L+  TD    V      + + +A     VRL        ++  S  +F    + + H   ++ V  N  G+  ++ S D++ + W+T +G+ +  LEGH +                      EI S  FN+D S I+TGS D TC +W
Sbjct:   24 ELKTKSIDLLELSPSTDVNTLVGEIQQAEPLITASRTKQVRLLVQRLQEKLRQHSDHNFYLFKVLRAHILPLTNVALNKAGSCFITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYGKVHTLIGHCAEISSALFNWDCSLILTGSMDKTCMLW 183          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Mouse
Match: Daw1 (dynein assembly factor with WDR repeat domains 1 [Source:MGI Symbol;Acc:MGI:1923089])

HSP 1 Score: 275.018 bits (702), Expect = 3.919e-88
Identity = 152/340 (44.71%), Postives = 197/340 (57.94%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASA-------GADNTVRLW 1064
            MKLK  L+RY+PPGI+LEYE+ GE+KTK+ DLL+L+  T+   +V  I + E L+T  R   V  L++ LQEKL+   D  + LFKVLRAHILPLTNV  NK G  F+TGSYDRTCKVWDT+ G  L TLEGHKNVVY+IA+N P+                        HT  GH AE+    FN   +L+ TG MD   MLWD  SGK V+ L GH  E++   F   + GK + T S D T  +++    + V++L GH+ EIS   FN  G  + T S DK+ +IWD++ G + L  L GHTDE+    F+  G  V +A       G D    LW
Sbjct:    1 MKLKSLLLRYYPPGIMLEYEKGGELKTKSIDLLELSPSTDVNTLVGEIQQAEPLITASRTKQVRLLVQRLQEKLRQHSDHNFYLFKVLRAHILPLTNVALNKAGSCFITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYGK---------------------VHTLIGHCAEISSALFNWDCSLILTGSMDKTCMLWDATSGKYVATLTGHDDEILDSCFD--YTGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTG-QCLQVLEGHTDEIFSCAFNYKGNIVITARTTPAGYGVDPRALLW 316          

HSP 2 Score: 184.496 bits (467), Expect = 1.960e-53
Identity = 97/241 (40.25%), Postives = 137/241 (56.85%), Query Frame = 3
Query:  570 LYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITG 1292
            L+   + H   +  V  N + +   TG  D    +WD  SG+ +  L+GH   V ++ F   +                       +V  LIGH AEIS+A+FN+D + + T SMDK+  +WD   G + + TL GH DE+LD  FD  GK +A+A AD T R+++     K     +GHE E+SK++FNPQG  LL+ S+DK+AR W+  TG+ +QVLEGHTDEIFSCAFNY G+ +IT 
Sbjct:   84 LFKVLRAHILPLTNVALNKAGSCFITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYG----------------------KVHTLIGHCAEISSALFNWDCSLILTGSMDKTCMLWDATSG-KYVATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATT-RKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTGQCLQVLEGHTDEIFSCAFNYKGNIVITA 300          

HSP 3 Score: 98.9821 bits (245), Expect = 2.720e-22
Identity = 64/204 (31.37%), Postives = 92/204 (45.10%), Query Frame = 3
Query:  708 LQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L+ H   + ++   +A  G   ITGS+D T  +WD  +G  +  L GH   + A  FN     V                      TL GH  E+    F+     + +   D T  LWD     K      GH+ E+    F+  G ++ +ASAD +AR +N TT K +  LEGH  EI   +FN  G++++TGS D T RIW
Sbjct:   88 LRAHILPLTNVALNKA--GSCFITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYGKV---------------------HTLIGHCAEISSALFNWDCSLILTGSMDKTCMLWDATS-GKYVATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIW 267          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Mouse
Match: Wdr5b (WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:1916794])

HSP 1 Score: 151.754 bits (382), Expect = 2.388e-41
Identity = 98/336 (29.17%), Postives = 168/336 (50.00%), Query Frame = 3
Query:  210 MKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGH-DAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDE--VLDVTFDNVGKQ-VASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASA--DKSARTWNT 1199
            M TEHL   +R  +++   +  +E    P    Y L   L  H   +++V F+ NG+   + + D    +W    G    TL GH   +  +A++   S ++V+ S DKT K+W    G    T KGH+  V C  FNP S L+ +G  D    +W+V++GKC+  L  H+  + ++ F    NG  +++GS+D    +WD  +G+ +  L    +  +S   F+ +G Y+ TA++D ++K+WD   G R L T  GH +E   L  +F   G++ V S   DN V +W+++   +     +GH   V     +P   ++ SA+   DK+ + W++
Sbjct:    1 MATEHL-PAERAQSLLSAPRREEE----PQKPNYALRLTLAGHSAAISSVKFSPNGEWLASSAADALIIIWGAYDGNCKKTLYGHSLEISDVAWSSD-SSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNC--NGSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRG-RCLKTYTGHKNEKYCLFASFSVTGRKWVVSGSEDNMVYIWNLQT-KEIVQRLQGHTDVVISAACHPTKNIIASAALENDKTIKVWSS 326          

HSP 2 Score: 137.117 bits (344), Expect = 4.894e-36
Identity = 91/300 (30.33%), Postives = 154/300 (51.33%), Query Frame = 3
Query:  447 FTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLD-VTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKV--TFNPQGTV-LLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS--KDNTCRIWQ 1322
             TL GH   + S+ ++ P  + + + + D    +W A DG+   T  GH+ E+  V ++  S+ + +   D    +WD+ SGKC+  L+GH+  V    F    N   +++GSFD +V +W+V  G+ +  L  H   ISA  FN +G+ + + S D   +IWD   G + L TLA   +  +  V F   GK + +A  DNT++LWD   +S+   +  + GH+ E   +  +F+  G   ++S S D     WN  T +++Q L+GHTD + S A +   + I + +   D T ++W 
Sbjct:   33 LTLAGHSAAISSVKFS-PNGEWLASSAADALIIIWGAYDGNCKKTLYGHSLEISDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSN--LIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASG-QCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWD---YSRGRCLKTYTGHKNEKYCLFASFSVTGRKWVVSGSEDNMVYIWNLQTKEIVQRLQGHTDVVISAACHPTKNIIASAALENDKTIKVWS 325          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 151.369 bits (381), Expect = 3.665e-41
Identity = 95/311 (30.55%), Postives = 159/311 (51.13%), Query Frame = 3
Query:  294 PVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV----GKQVASAGADNTVRLWDV--KDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASA--DKSARTWNT 1199
            PV   Y L   L  H   +++V F+ NG+   + S D+  K+W    G    T+ GHK  +  +A++   S+ +V+ S DKT K+W  + G    T KGH+  V C  FNP S L+ +G  D    +WDV++GKC+  L  H+  V ++ F +  +G  +++ S+D    +WD  +G+ +  LI  D   +S   F+ +G Y+  A++D ++K+WD   G + L T  GH +E   + F N     GK + S   DN V +W++  K+  +     +GH   V     +P   ++ SA+   DK+ + W +
Sbjct:   30 PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSD-SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNR--DGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKG-KCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQK---LQGHTDVVISTACHPTENIIASAALENDKTIKLWKS 332          

HSP 2 Score: 149.058 bits (375), Expect = 2.121e-40
Identity = 96/299 (32.11%), Postives = 149/299 (49.83%), Query Frame = 3
Query:  447 FTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFN---PQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS--KDNTCRIWQ 1322
            FTL GH   V S+ ++ P  + + + S DK  K+W A DG    T  GH   +  V ++  S L+ +   D    +WDV SGKC+  L+GH+  V    F    N   +++GSFD +V +WDV  G+ +  L  H   +SA  FN DG+ + ++S D   +IWD   G      +      V  V F   GK + +A  DNT++LWD   +SK   +  + GH+ E   +  N     G  ++S S D     WN  T +++Q L+GHTD + S A +   + I + +   D T ++W+
Sbjct:   39 FTLAGHTKAVSSVKFS-PNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSN--LIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWD---YSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          

HSP 3 Score: 131.339 bits (329), Expect = 6.350e-34
Identity = 75/255 (29.41%), Postives = 124/255 (48.63%), Query Frame = 3
Query:  567 SLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYD---GSKIITGSKDNTCRIWQ 1322
            +L  T  GHT  V  V+F+P+   + +   D L  +W    GK    + GH   +  + +    N   L++ S D T+ +WDV +G+ +  L GH   +    FN     + + S D+S++IWD++ G + L TL  H+D V  V F+  G  + S+  D   R+WD         +       VS V F+P G  +L+A+ D + + W+ + GK ++   GH +E +    N+    G  I++GS+DN   IW 
Sbjct:   36 ALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN--LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTG-KCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWN 287          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. UniProt/SwissProt
Match: sp|Q6P2Y2|DAW1_XENTR (Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis OX=8364 GN=daw1 PE=2 SV=1)

HSP 1 Score: 525.783 bits (1353), Expect = 0.000e+0
Identity = 252/419 (60.14%), Postives = 314/419 (74.94%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            M+LKRFL+RYFPPGIILEYE+ GE+KTKA DLL+L+  T+ + VV+ I K E L+T  R   V +LI  LQEK+     + + LFKVLRAHILPLTNV FNK+G  F+TGSYDRTCKVWDT+ G  L TLEGH+NVVY+I +N P+ DKI TGSFDKT K+WSA  G  YHTF+GHTAE+VC+ FNP STL+ TG MDT A LWD++SG+    L GH AE+ISL F     G  LITGSFDHTV +W++ +GRR+  LIGH  EIS+A FN+D + +ATASMDKS K+WD  +  + + TL GH DEVLDVTFD+ G+ VA+A AD T R++      K     +GHE E+SK+ FN QG  +L+AS+DK++R WN  TG+ +QVL+GHTDEIFSCAFNY+G+ IITGSKDNTCRIW+
Sbjct:    1 MRLKRFLLRYFPPGIILEYEKGGELKTKAIDLLELSPTTDVDLVVEEIQKAEPLITASRTQQVKQLILRLQEKIGQQDSRQFYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNT--TGDRLITGSFDHTVSVWEIPSGRRIHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWD-SLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASS-RKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITGSKDNTCRIWR 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. UniProt/SwissProt
Match: sp|Q5FWQ6|DAW1_XENLA (Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis OX=8355 GN=daw1 PE=2 SV=1)

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 250/419 (59.67%), Postives = 313/419 (74.70%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            M+LKRFL+RYFPPGIILEYE+ GE+KTKA DLL+L+  T+ + VV  I K E L+T  R   V +LI  LQEK+     + + LFKVLRAHILPLTNV FNK+G  F+TGSYDRTCKVWDT+ G  L TLEGH+NVVY+I +N P+ DKI TGSFDKT K+WSA  G  YHTF+GHTAE+VC+ FNP STL+ TG MDT A LWD++SG+    L GH AE+ISL F     G  LITGSFDHTV +W++ +GRR+  LIGH  EIS+A FN+D + +ATASMDKS K+WD  +  + + TL GH DEVLDVTFD+ G+ VA+A AD T R++      K     +GHE E+SK+ FN QG  +++AS+DK++R W+  TG+ +QVL+GHTDEIFSCAFNY+G+ IITGSKDNTCRIW+
Sbjct:    1 MRLKRFLLRYFPPGIILEYEKGGELKTKAIDLLELSPTTDVDLVVGEIQKAEPLITASRTQQVKQLILRLQEKIGQQDSRQFYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLVFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNT--TGDRLITGSFDHTVSVWEIPSGRRIHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWD-SLNGKCVATLTGHDDEVLDVTFDSTGQLVATASADGTARVYSASS-RKCLAKLEGHEGEISKICFNAQGNRIVTASSDKTSRLWDPHTGECLQVLKGHTDEIFSCAFNYEGNTIITGSKDNTCRIWR 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. UniProt/SwissProt
Match: sp|Q8N136|DAW1_HUMAN (Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 6.037e-179
Identity = 245/419 (58.47%), Postives = 311/419 (74.22%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            MKLK  L+RY+PPGI+LEYE+ GE+KTK+ DLLDL   T+   +V+ I K E L+T  R + V  LI+ LQEKL    + T+ LFKVL+AHILPLTNV  NK+G  F+TGSYDRTCK+WDT+ G  L TLEGH+NVVY+IA+N P+ DKI TGSFDKT K+WS   G  YHTF+GHTAE+VC+ FNP STLV TG MDT A LWD+++G+ V  L+GH+AE+ISL F  +  G  +ITGSFDHTV++WD   GR+V+ LIGH AEIS+A FN+D + + T SMDK+ K+WD   G + + TL GH DE+LD  FD  GK +A+A AD T R++      K     +GHE E+SK++FNPQG  LL+ S+DK+AR W+  TG+ +QVLEGHTDEIFSCAFNY G+ +ITGSKDNTCRIW+
Sbjct:    1 MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRLQEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTS--GDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNG-KCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAAT-RKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWR 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. UniProt/SwissProt
Match: sp|Q0P593|DAW1_BOVIN (Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus OX=9913 GN=DAW1 PE=2 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 5.244e-178
Identity = 245/419 (58.47%), Postives = 307/419 (73.27%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            MKLK  L+RY+PPGI+LEYE+ G++KTK+ DLLDL   T+   +V+ I K E L+T  R D V  LI+ LQ KL    +  + LFKVLRAHILPLTNV  NK+G  F+TGSYDRTCK+WDT+ G  L TLEGH+NVVY+IA+N P+ DKI TGSFDKT K+WS   G  YHTF+GHTAE+VC+ FNP STLV TG MDT A LWD++SG+ V  L GH+AE+ISL F  +  G  +ITGSFDHTV +W+   GR+V  LIGH AEIS+AVFN+D + + T SMDK+ K+WD   G + + TL GH DE+LD  FD  GK +A+A AD T R++        + + +GHE E+SK++FNPQG  LL+ S+DK+AR W+  TG+ +QVLEGHTDEIFSCAFNY G  IITGSKDNTCRIW+
Sbjct:    1 MKLKSLLLRYYPPGIMLEYEKSGQLKTKSIDLLDLDPSTDVSALVEEIQKAEPLITASRSDQVKLLIQRLQNKLGQHSNHKFYLFKVLRAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELHTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQSGEEVFTLTGHSAEIISLSFNTS--GNRIITGSFDHTVTVWEADTGRKVYTLIGHCAEISSAVFNWDCSLILTGSMDKTCKLWDAVNG-KCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRECVTKL-EGHEGEISKISFNPQGNRLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGDIIITGSKDNTCRIWR 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. UniProt/SwissProt
Match: sp|Q5BK30|DAW1_RAT (Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus OX=10116 GN=Daw1 PE=2 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 6.245e-178
Identity = 243/419 (58.00%), Postives = 308/419 (73.51%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            MKLK  L+RY+PPGI+LEYE+ GE+KTK+ DLL+L+  T+   +V  I K E L+T  R   V  L++ LQEKL+   D  + LFKVLRAHILPLTNV  NK G  F+TGSYDRTCKVWDT+ G  L TLEGH+NVVY+IA+N P+ DKI TGSFDKT K+WSA  G  YHTF+GHTAE+VC+ FNP ST+V TG MDT A LWD++SG+ V  L GH AE+ISL F  +  G  +ITGSFDHTV++WD   GR+V  LIGH AEIS+A+F++D + + T SMDK+  +WD   G + + TL GH DE+LD  FD  GK +A+A AD T R+++     K     +GHE E+SK++FNPQG  LL+ S+DK+AR W+  TG+ +QVLEGHTDEIFSCAFNY G+ +ITGSKDN+CRIW+
Sbjct:    1 MKLKSLLLRYYPPGIMLEYEKGGELKTKSIDLLELSPSTDVNTLVGEIQKVEPLITASRTKQVRLLVQRLQEKLRQHCDHNFYLFKVLRAHILPLTNVALNKAGSCFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLSFNPQSTVVATGSMDTTAKLWDIQSGEEVVTLTGHLAEIISLSFDTS--GDRIITGSFDHTVVVWDASTGRKVHTLIGHCAEISSALFSWDCSLILTGSMDKTCMLWDATSG-KCVATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATT-RKCITKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNSCRIWR 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. TrEMBL
Match: A0A267EMF0 (WD_REPEATS_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030903g2 PE=4 SV=1)

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 271/419 (64.68%), Postives = 326/419 (77.80%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            MKLKRFL+RYFPPGIILEYEQ G++KTKA DLLDLT  +N + +++ I++ E L+T KR   + EL+  LQ+KL    D  + LFKVLRAHILPLTNV FNKNG  F+TGSYDRTCKVWDT  G   FTLEGH+NVVY+IA+NLP+SDKI TGSFDKTAK+WSA  G+L+HTF+GHTAE+V +QFNP+ST++GTG MDT A LWDVE+G  +  L GHTAEVI +QF Q   G  ++T SFDHTV LWD  +G+R  QL+ H AEISAAVFN+D T VATASMDK +K+WD+R G R + TL GH DEVLDV FD  G ++ASA AD T R WD++   +     +GHE EVSKV FNPQGT LL+ASADK+AR W+  TGK  Q LEGHTDEIFSCAFNY+G+ IITGSKDNTCR+W+
Sbjct:    1 MKLKRFLLRYFPPGIILEYEQGGQLKTKALDLLDLTPHSNVDSIIEEIVRKEPLITDKRVPQLRELVGKLQKKLAEVYDSQFSLFKVLRAHILPLTNVAFNKNGTEFITGSYDRTCKVWDTGSGEEKFTLEGHRNVVYAIAFNLPYSDKIGTGSFDKTAKLWSAERGTLHHTFRGHTAEIVTLQFNPTSTMLGTGSMDTQAKLWDVETGVELCTLNGHTAEVIGMQFSQ--QGSDVLTASFDHTVCLWDSRSGKRTQQLVSHTAEISAAVFNWDATLVATASMDKKVKVWDVRQG-RVMQTLGGHEDEVLDVAFDLPGHRLASASADATGRCWDIRGSFRLLCKLEGHEGEVSKVCFNPQGTRLLTASADKTARLWDCETGKQTQALEGHTDEIFSCAFNYEGNTIITGSKDNTCRVWK 416          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. TrEMBL
Match: W5MNV1 (Dynein assembly factor with WDR repeat domains 1 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 252/419 (60.14%), Postives = 317/419 (75.66%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            M+LKRFLVRY+PPGIILEYE+ GE+KTK+ DLLDL+ ET+  E+ + I KTE L+T  R + V +LI+ LQEKL    D+ + LFKVLRAHILPLTNV FNK+G  F+TGSYDRTCK+WDT+ G  L TLEGH+NVVY+IA+N P+ DKI TGSFDKT ++WSA  G  YHTF+GHTAE+VC+ FNP STLV TG MDT A LW++++G+  + L GH+AE+ISL F     G  +ITGSFDHT+ LWDV +GR +  LIGH  EIS+A FN+D +++AT SMDK+ K+WD   G + L TL GH DEVLDV FD  G+ +A+A AD   R++      K     +GHE E+SK+ FNPQG+ +L+ SADK+AR W+  TG+ +QVLEGHTDEIFSCAFNY+G  IITGSKDNTCRIW+
Sbjct:    1 MRLKRFLVRYYPPGIILEYEKGGELKTKSIDLLDLSPETDVAELTEEIKKTEPLITASRTEQVKQLIQRLQEKLGQQDDRRFYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKIWDTASGEELHTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCRLWSAETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWNIQTGEEAATLTGHSAEIISLSFNTV--GDKIITGSFDHTISLWDVQSGRLIHTLIGHRGEISSAQFNWDCSFIATGSMDKTCKVWDAVNG-KCLATLTGHEDEVLDVCFDYTGQLIATASADGNARVYSASS-QKCIAKLEGHEGEISKICFNPQGSRVLTGSADKTARLWDVNTGQCLQVLEGHTDEIFSCAFNYEGDTIITGSKDNTCRIWR 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. TrEMBL
Match: A0A1I8I200 (WD_REPEATS_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 258/405 (63.70%), Postives = 312/405 (77.04%), Query Frame = 3
Query:  108 IILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            IILEYEQ G++KTKA DLLDLT  +N + +++ I++ E L+T KR   + EL+  LQ+KL    D  + LFKVLRAHILPLTNV FNKNG  F+TGSYDRTCKVWDT  G   FTLEGH+NVVY+IA+NLP+SDKI TGSFDKTAK+WSA  G+L+HTF+GHTAE+V +QFNP+ST++GTG MDT A LWDVE+G  +  L GHTAEVI +QF Q   G  ++T SFDHTV LWD  +G+R  QL+ H AEISAAVFN+D T VATASMDK +K+WD+R G R + TL GH DEVLDV FD  G ++ASA AD T R WD++   +     +GHE EVSKV FNPQGT LL+ASADK+AR W+  TGK  Q LEGHTDEIFSCAFNY+G+ IITGSKDNTCR+W+
Sbjct:   81 IILEYEQGGQLKTKALDLLDLTPHSNVDSIIEEIVRKEPLITDKRVPQLRELVGKLQKKLAEVYDSQFSLFKVLRAHILPLTNVAFNKNGTEFITGSYDRTCKVWDTGSGEEKFTLEGHRNVVYAIAFNLPYSDKIGTGSFDKTAKLWSAERGTLHHTFRGHTAEIVTLQFNPTSTMLGTGSMDTQAKLWDVETGVELCTLNGHTAEVIGMQFSQ--QGSDVLTASFDHTVCLWDSRSGKRTQQLVSHTAEISAAVFNWDATLVATASMDKKVKVWDVRQG-RVMQTLGGHEDEVLDVAFDLPGHRLASASADATGRCWDIRGSFRLLCKLEGHEGEVSKVCFNPQGTRLLTASADKTARLWDCETGKQTQALEGHTDEIFSCAFNYEGNTIITGSKDNTCRVWK 482          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. TrEMBL
Match: A0A1I8HZY5 (WD_REPEATS_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 258/405 (63.70%), Postives = 312/405 (77.04%), Query Frame = 3
Query:  108 IILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            IILEYEQ G++KTKA DLLDLT  +N + +++ I++ E L+T KR   + EL+  LQ+KL    D  + LFKVLRAHILPLTNV FNKNG  F+TGSYDRTCKVWDT  G   FTLEGH+NVVY+IA+NLP+SDKI TGSFDKTAK+WSA  G+L+HTF+GHTAE+V +QFNP+ST++GTG MDT A LWDVE+G  +  L GHTAEVI +QF Q   G  ++T SFDHTV LWD  +G+R  QL+ H AEISAAVFN+D T VATASMDK +K+WD+R G R + TL GH DEVLDV FD  G ++ASA AD T R WD++   +     +GHE EVSKV FNPQGT LL+ASADK+AR W+  TGK  Q LEGHTDEIFSCAFNY+G+ IITGSKDNTCR+W+
Sbjct:    1 IILEYEQGGQLKTKALDLLDLTPHSNVDSIIEEIVRKEPLITDKRVPQLRELVGKLQKKLAEVYDSQFSLFKVLRAHILPLTNVAFNKNGTEFITGSYDRTCKVWDTGSGEEKFTLEGHRNVVYAIAFNLPYSDKIGTGSFDKTAKLWSAERGTLHHTFRGHTAEIVTLQFNPTSTMLGTGSMDTQAKLWDVETGVELCTLNGHTAEVIGMQFSQ--QGSDVLTASFDHTVCLWDSRSGKRTQQLVSHTAEISAAVFNWDATLVATASMDKKVKVWDVRQG-RVMQTLGGHEDEVLDVAFDLPGHRLASASADATGRCWDIRGSFRLLCKLEGHEGEVSKVCFNPQGTRLLTASADKTARLWDCETGKQTQALEGHTDEIFSCAFNYEGNTIITGSKDNTCRVWK 402          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. TrEMBL
Match: G4V7M5 (Putative wd-repeat protein OS=Schistosoma mansoni OX=6183 GN=Smp_080320 PE=4 SV=1)

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 253/424 (59.67%), Postives = 319/424 (75.24%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDV---KDFSKPSFI--FKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            MKLKRFL+RY+PPGIIL+YEQ G  KTK+ DLL+LT +++ EE++  +   E L+T KR+  V ELI+ L+ KL       +G +K+LRAHILPLTNV FNK+G  F+TGSYDRTCKVW T  G  ++TLEGH+NVVY+IA+NLPFSDKI TGSFDKTA++WSA  G  ++  +GHTAEVVC+QFNP+S L+ TG MDTLA LWDVE+G  +++L GHTAEVI+LQF Q  NG+ ++TGSFDHTV LWDV  G R   LIGH AE+SAA F +D   VATASMDK++++WD R G R L  L GH DEVLDVTFD  G+++ASA AD T R+W+V    +     F+    GHE EVSKV FN  G ++L+AS+DK+AR W+  TG++  +L GHTDE+FSCAFNY+   IITGSKDNTCRIW+
Sbjct:    1 MKLKRFLLRYYPPGIILDYEQGGATKTKSIDLLELTPDSDTEEILKELCMKEPLITEKRKIQVQELIERLKSKLCSSSKTKFGQYKILRAHILPLTNVAFNKSGSHFITGSYDRTCKVWQTETGFEVYTLEGHRNVVYAIAFNLPFSDKIATGSFDKTARLWSAETGECHYILQGHTAEVVCIQFNPTSNLIATGSMDTLAKLWDVETGSELASLNGHTAEVIALQFSQC-NGRLMLTGSFDHTVCLWDVRTGERTHHLIGHAAEVSAASFTYDTCLVATASMDKTVRVWDTRTG-RQLHLLTGHQDEVLDVTFDPSGRRLASASADGTARVWNVGISGETKGAKFLSTLIGHEGEVSKVCFNSPGNLVLTASSDKTARLWDVETGELKDILSGHTDEVFSCAFNYESDTIITGSKDNTCRIWK 422          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Cavefish
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:103035445])

HSP 1 Score: 517.309 bits (1331), Expect = 0.000e+0
Identity = 249/421 (59.14%), Postives = 312/421 (74.11%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFK--GHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            M+LK+  +RY+PPGIIL++E+ G+++TK+ DLLDLT E +  EV+  I + E L+T+ R + V  LIK LQ+KL  P D  + LFK L+AHILPLTNV FNK+G  F+TGSYDRTCK+WDT+ GT L TLEGHKNVVY++A+N P+ DKI TGSFDKT ++WS   G  ++TF+GHTAE+VC+ FNP STLV TG MDT   LWDVESG  VS L GH+AE+ISL F     G  L+TGSFDHTV +WDV +GR V  L GH  EIS+  FN+D + + TASMDK+ K+WD   G R L TL GH DEVLDV F+  G+ +A+A AD T R++D + F    F+ K  GHE E+SKV FNPQGT +L+ SADK+AR W+ ++G  +QVLEGHTDEIFSCAFNY G  IITGSKDNTCRIW+
Sbjct:    1 MRLKQLHIRYYPPGIILDFEKGGQLRTKSIDLLDLTPECDANEVLLEIRRLEPLITVSREEQVKFLIKKLQDKLSQPDDHKFDLFKTLQAHILPLTNVAFNKSGSSFITGSYDRTCKIWDTASGTELHTLEGHKNVVYAVAFNNPYGDKIATGSFDKTCRLWSVETGQCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTVKLWDVESGVEVSTLSGHSAEIISLSFNTV--GSRLVTGSFDHTVSVWDVPSGRLVHNLKGHRGEISSVNFNWDSSLIVTASMDKTCKVWDAE-GGRCLATLTGHNDEVLDVCFNFKGQLIATASADGTSRVYDAQTF---QFVCKLEGHEGEISKVCFNPQGTCVLTGSADKTARVWSVSSGSCLQVLEGHTDEIFSCAFNYYGDTIITGSKDNTCRIWR 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 152.14 bits (383), Expect = 1.404e-41
Identity = 97/312 (31.09%), Postives = 160/312 (51.28%), Query Frame = 3
Query:  291 VPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV----GKQVASAGADNTVRLWDV--KDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSAS--ADKSARTWNT 1199
             PV   Y L   L  H   +++V F+ NG+   + S D+  K+W +  G    +L GHK  +  +A++ P S+ +V+ S DKT K+W    G    T KGH+  V C  FNP S LV +G  D    +WDV++GKC+  L  H+  V ++ F +  +G  +++ S+D    +WD  +G+ +  LI  D   +S   F+ +G Y+  A++D ++K+WD   G + L T  GH +E   V F N     GK + S   D+ V +W++  K+  +     +GH   V     +P   ++ SA+   DK+ + W +
Sbjct:   26 APVKPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWS-PDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNR--DGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKG-KCLKTYTGHKNEKYCV-FANFSVTGGKWIVSGSEDHMVYIWNLQTKEIVQK---LQGHADVVIATACHPSENIIASAALENDKTIKLWKS 329          

HSP 2 Score: 144.05 bits (362), Expect = 1.121e-38
Identity = 92/302 (30.46%), Postives = 150/302 (49.67%), Query Frame = 3
Query:  438 TTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFN---PQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS--KDNTCRIWQ 1322
            T  FTL GH   + S+ ++ P  + + + S DK  K+W + DG    +  GH   +  V ++P S L+ +   D    +WD+ SGKC+  L+GH+  V    F    N   +++GSFD +V +WDV  G+ +  L  H   +SA  FN DG+ + ++S D   ++WD   G      +      V  V F   GK + +A  DNT++LWD   +SK   +  + GH+ E   V  N     G  ++S S D     WN  T +++Q L+GH D + + A +   + I + +   D T ++W+
Sbjct:   33 TLKFTLAGHTKAISSVKFS-PNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSN--LVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWD---YSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHMVYIWNLQTKEIVQKLQGHADVVIATACHPSENIIASAALENDKTIKLWK 328          

HSP 3 Score: 87.4261 bits (215), Expect = 1.260e-18
Identity = 56/186 (30.11%), Postives = 90/186 (48.39%), Query Frame = 3
Query:  270 NLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSST---LVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSF---DHTVILW 809
            +  E +++   KT    K L AH  P++ V FN++G   ++ SYD  C++WD++ G  L TL    N   S     P    I+  + D T K+W  + G    T+ GH  E  CV  N S T    + +G  D +  +W++++ + V  LQGH   VI+      H  +++I  +    D T+ LW
Sbjct:  145 SFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHMVYIWNLQTKEIVQKLQGHADVVIAT---ACHPSENIIASAALENDKTIKLW 327          

HSP 4 Score: 55.4546 bits (132), Expect = 5.632e-8
Identity = 30/83 (36.14%), Postives = 45/83 (54.22%), Query Frame = 3
Query: 1083 KPSFIFK----GHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            KP++  K    GH   +S V F+P G  L S+SADK  + W +  GK  + L GH   I   A++ D + +++ S D T +IW
Sbjct:   29 KPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIW 111          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 150.214 bits (378), Expect = 6.347e-41
Identity = 97/302 (32.12%), Postives = 150/302 (49.67%), Query Frame = 3
Query:  438 TTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFN---PQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS--KDNTCRIWQ 1322
            T  FTL GH   V S+ ++ P  + + + S DK  K+W A DG    T  GH   +  V ++  S L+ +   D    +WDV SGKC+  L+GH+  V    F    N   +++GSFD +V +WDV  G+ +  L  H   +SA  FN DG+ + ++S D   +IWD   G      +      V  V F   GK + +A  DNT++LWD   +SK   +  + GH+ E   +  N     G  ++S S D     WN  T +++Q L+GHTD + S A +   + I + +   D T ++W+
Sbjct:   36 TLKFTLAGHTKAVSSVKFS-PSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSN--LIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWD---YSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          

HSP 2 Score: 148.673 bits (374), Expect = 2.409e-40
Identity = 94/311 (30.23%), Postives = 159/311 (51.13%), Query Frame = 3
Query:  294 PVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV----GKQVASAGADNTVRLWDV--KDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASA--DKSARTWNT 1199
            PV   Y L   L  H   +++V F+ +G+   + S D+  K+W    G    T+ GHK  +  +A++   S+ +V+ S DKT K+W  + G    T KGH+  V C  FNP S L+ +G  D    +WDV++GKC+  L  H+  V ++ F +  +G  +++ S+D    +WD  +G+ +  LI  D   +S   F+ +G Y+  A++D ++K+WD   G + L T  GH +E   + F N     GK + S   DN V +W++  K+  +     +GH   V     +P   ++ SA+   DK+ + W +
Sbjct:   30 PVKPNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSD-SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNR--DGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKG-KCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQK---LQGHTDVVISTACHPTENIIASAALENDKTIKLWKS 332          

HSP 3 Score: 92.4337 bits (228), Expect = 2.769e-20
Identity = 58/186 (31.18%), Postives = 91/186 (48.92%), Query Frame = 3
Query:  270 NLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSST---LVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSF---DHTVILW 809
            +  E +++   KT    K L AH  P++ V FN++G   ++ SYD  C++WDT+ G  L TL    N   S     P    I+  + D T K+W  + G    T+ GH  E  C+  N S T    + +G  D +  +W++++ + V  LQGHT  VIS      H  +++I  +    D T+ LW
Sbjct:  148 SFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVIST---ACHPTENIIASAALENDKTIKLW 330          

HSP 4 Score: 55.0694 bits (131), Expect = 6.244e-8
Identity = 30/83 (36.14%), Postives = 44/83 (53.01%), Query Frame = 3
Query: 1083 KPSFIFK----GHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            KP++  K    GH   VS V F+P G  L S+SADK  + W    GK  + + GH   I   A++ D + +++ S D T +IW
Sbjct:   32 KPNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIW 114          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Cavefish
Match: ENSAMXT00000007962.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 147.902 bits (372), Expect = 6.301e-40
Identity = 101/329 (30.70%), Postives = 160/329 (48.63%), Query Frame = 3
Query:  291 VPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLL-------SASADKSARTWNTTTGKVIQVLEGHTDEIFS 1253
             PV   Y L   L  H   +++V F+ NG+   + S D+  K+W +  G    +L GHK  +  +A++ P S+ +V+ S DKT K+W    G    T KGH+  V C  FNP S LV +G  D    +WDV++GKC+  L  H+  V ++ F +  +G  +++ S+D    +WD  +G+ +  LI  D   +S   F+ +G Y+  A++D ++K+WD   G + L T  GH +E   V F N      + G    +   D+  FS     F   +  +  V+     T L+       S S D     WN  T +++Q L+GH   I S
Sbjct:   26 APVKPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWS-PDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNR--DGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKG-KCLKTYTGHKNEKYCV-FANFS---VTGGKVRRLLFLDLVTFSA---AFGRGQTVLFLVSVYSINTSLIDSIQWIVSGSEDHMVYIWNLQTKEIVQKLQGHAGRIPS 343          

HSP 2 Score: 119.398 bits (298), Expect = 1.478e-29
Identity = 68/232 (29.31%), Postives = 114/232 (49.14%), Query Frame = 3
Query:  567 SLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAF 1262
            +L  T  GHT  +  V+F+P+   + +   D L  +W    GK   +L GH   +  + +    N   L++ S D T+ +WD+ +G+ +  L GH   +    FN     V + S D+S++IWD++ G + L TL  H+D V  V F+  G  + S+  D   R+WD         +       VS V F+P G  +L+A+ D + + W+ + GK ++   GH +E + C F
Sbjct:   33 TLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSN--LLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTG-KCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY-CVF 260          

HSP 3 Score: 109.768 bits (273), Expect = 3.610e-26
Identity = 67/205 (32.68%), Postives = 109/205 (53.17%), Query Frame = 3
Query:  708 LQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVL-EGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L GHT  + S++F  + NG+ L + S D  + +W   +G+    L GH   IS   ++ D   + +AS DK++KIWD+  G + L TL GH++ V    F+     V S   D +VR+WDVK   K       H   VS V FN  G++++S+S D   R W++T+G+ ++ L +     +    F+ +G  I+  + DNT ++W
Sbjct:   38 LAGHTKAISSVKF--SPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSG-KCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKT-GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLW 238          

HSP 4 Score: 80.8777 bits (198), Expect = 2.928e-16
Identity = 58/204 (28.43%), Postives = 92/204 (45.10%), Query Frame = 3
Query:  270 NLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHT----AEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISA 869
            +  E +++   KT    K L AH  P++ V FN++G   ++ SYD  C++WD++ G  L TL    N   S     P    I+  + D T K+W  + G    T+ GH  E  CV  N S     TGG     +  D+ +       +G T      V S+      + + +++GS DH V +W++     V +L GH   I +
Sbjct:  145 SFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSV----TGGKVRRLLFLDLVTFSAAFG-RGQTVLFLVSVYSINTSLIDSIQWIVSGSEDHMVYIWNLQTKEIVQKLQGHAGRIPS 343          

HSP 5 Score: 55.8398 bits (133), Expect = 4.268e-8
Identity = 30/83 (36.14%), Postives = 45/83 (54.22%), Query Frame = 3
Query: 1083 KPSFIFK----GHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            KP++  K    GH   +S V F+P G  L S+SADK  + W +  GK  + L GH   I   A++ D + +++ S D T +IW
Sbjct:   29 KPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIW 111          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Cavefish
Match: ENSAMXT00000052579.1 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 147.902 bits (372), Expect = 6.301e-40
Identity = 101/329 (30.70%), Postives = 160/329 (48.63%), Query Frame = 3
Query:  291 VPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLL-------SASADKSARTWNTTTGKVIQVLEGHTDEIFS 1253
             PV   Y L   L  H   +++V F+ NG+   + S D+  K+W +  G    +L GHK  +  +A++ P S+ +V+ S DKT K+W    G    T KGH+  V C  FNP S LV +G  D    +WDV++GKC+  L  H+  V ++ F +  +G  +++ S+D    +WD  +G+ +  LI  D   +S   F+ +G Y+  A++D ++K+WD   G + L T  GH +E   V F N      + G    +   D+  FS     F   +  +  V+     T L+       S S D     WN  T +++Q L+GH   I S
Sbjct:   26 APVKPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWS-PDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNR--DGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKG-KCLKTYTGHKNEKYCV-FANFS---VTGGKVRRLLFLDLVTFSA---AFGRGQTVLFLVSVYSINTSLIDSIQWIVSGSEDHMVYIWNLQTKEIVQKLQGHAGRIPS 343          

HSP 2 Score: 119.398 bits (298), Expect = 1.478e-29
Identity = 68/232 (29.31%), Postives = 114/232 (49.14%), Query Frame = 3
Query:  567 SLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAF 1262
            +L  T  GHT  +  V+F+P+   + +   D L  +W    GK   +L GH   +  + +    N   L++ S D T+ +WD+ +G+ +  L GH   +    FN     V + S D+S++IWD++ G + L TL  H+D V  V F+  G  + S+  D   R+WD         +       VS V F+P G  +L+A+ D + + W+ + GK ++   GH +E + C F
Sbjct:   33 TLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSN--LLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTG-KCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY-CVF 260          

HSP 3 Score: 109.768 bits (273), Expect = 3.610e-26
Identity = 67/205 (32.68%), Postives = 109/205 (53.17%), Query Frame = 3
Query:  708 LQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVL-EGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L GHT  + S++F  + NG+ L + S D  + +W   +G+    L GH   IS   ++ D   + +AS DK++KIWD+  G + L TL GH++ V    F+     V S   D +VR+WDVK   K       H   VS V FN  G++++S+S D   R W++T+G+ ++ L +     +    F+ +G  I+  + DNT ++W
Sbjct:   38 LAGHTKAISSVKF--SPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSG-KCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKT-GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLW 238          

HSP 4 Score: 80.8777 bits (198), Expect = 2.928e-16
Identity = 58/204 (28.43%), Postives = 92/204 (45.10%), Query Frame = 3
Query:  270 NLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHT----AEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISA 869
            +  E +++   KT    K L AH  P++ V FN++G   ++ SYD  C++WD++ G  L TL    N   S     P    I+  + D T K+W  + G    T+ GH  E  CV  N S     TGG     +  D+ +       +G T      V S+      + + +++GS DH V +W++     V +L GH   I +
Sbjct:  145 SFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSV----TGGKVRRLLFLDLVTFSAAFG-RGQTVLFLVSVYSINTSLIDSIQWIVSGSEDHMVYIWNLQTKEIVQKLQGHAGRIPS 343          

HSP 5 Score: 55.8398 bits (133), Expect = 4.268e-8
Identity = 30/83 (36.14%), Postives = 45/83 (54.22%), Query Frame = 3
Query: 1083 KPSFIFK----GHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            KP++  K    GH   +S V F+P G  L S+SADK  + W +  GK  + L GH   I   A++ D + +++ S D T +IW
Sbjct:   29 KPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIW 111          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.443 bits (376), Expect = 1.246e-39
Identity = 93/288 (32.29%), Postives = 158/288 (54.86%), Query Frame = 3
Query:  375 GDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTF-DNVGKQVASAGADNTVRLWDVKDFSKPSFIFKG---HEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVL 1226
            G+R ++GS D T KVW    G  L TL GH   V+S        + IV+GS D+T K+W+A+ G   HT  GHT+ V C+  +     V +G  D    +WD+E+G+C+  L GH A V  +Q+    +G+ +++G++D+TV +WD  +   +  L GH   + +    FDG ++ + S+D SI++WD   G   L TL GH      +   DN+   + S  AD+TV++WD+K   +     +G   H++ V+ + F+ +  +++++S D + + W+  TG  ++ L
Sbjct:  244 GNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMR---GNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLH--GNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQY----DGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYS--LQFDGVHIVSGSLDTSIRVWDAETGT-CLHTLVGHQSLTSGMELRDNI---LVSGNADSTVKIWDIKT-GQCLQTLQGPNKHQSAVTCLQFSRK--LVVTSSDDGTVKLWDLRTGDFLRNL 513          

HSP 2 Score: 133.265 bits (334), Expect = 5.471e-34
Identity = 87/292 (29.79%), Postives = 148/292 (50.68%), Query Frame = 3
Query:  453 LEGHKNVVYSIAYNLPFS-DKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHT--DEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L+GH + V +    L F  ++IV+GS D T K+WSA  G    T  GHT  V   Q      ++ +G  D    +W+ ++G+CV  L GHT+ V  +      +G  +++GS D T+ +WD+  G+ +  L GH A +      +DG  V + + D ++K+WD       L TL GHT+ V  + FD V   + S   D ++R+WD +  +    +  GH++  S +    +  +L+S +AD + + W+  TG+ +Q L+G        +C   +    ++T S D T ++W
Sbjct:  229 LKGHDDHVITC---LQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMR--GNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHL----HGNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCV--QYDGRRVVSGAYDYTVKVWDPE-SETCLHTLQGHTNRVYSLQFDGV--HIVSGSLDTSIRVWDAETGTCLHTLV-GHQSLTSGMEL--RDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTC-LQFSRKLVVTSSDDGTVKLW 502          

HSP 3 Score: 120.939 bits (302), Expect = 9.573e-30
Identity = 78/231 (33.77%), Postives = 117/231 (50.65%), Query Frame = 3
Query:  372 NGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAA-VFNFDGTYVATASMDKSIKIWDLRMG--ARDLFTL--AGHTDEVLDVTFDNVGKQVASAGADN 1049
            +G+R ++GS D T +VWD   G  L  L GH   V  + Y+     ++V+G++D T K+W     +  HT +GHT  V  +QF+     + +G +DT   +WD E+G C+  L GH     SL  G       L++G+ D TV +WD+  G+ +  L G +   SA     F    V T+S D ++K+WDLR G   R+L +L   G    V  V   N  K V + G+ N
Sbjct:  323 HGNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQYD---GRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQFD--GVHIVSGSLDTSIRVWDAETGTCLHTLVGHQ----SLTSGMELRDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFSRKLVVTSSDDGTVKLWDLRTGDFLRNLVSLDSGGSGGVVWRVRCSNT-KLVCAVGSRN 543          

HSP 4 Score: 107.457 bits (267), Expect = 3.434e-25
Identity = 67/200 (33.50%), Postives = 106/200 (53.00%), Query Frame = 3
Query:  285 LKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQG---HTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAV 875
            L+V   +T     VL  H+  +  V ++  G R ++G+YD T KVWD    T L TL+GH N VYS+ ++      IV+GS D + ++W A  G+  HT  GH +    ++      ++ +G  D+   +WD+++G+C+  LQG   H + V  LQF +    K ++T S D TV LWD+  G  +  L+  D+  S  V
Sbjct:  336 LRVWDIETGQCLHVLAGHVAAVRCVQYD--GRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQFD---GVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTSGMELR--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFSR----KLVVTSSDDGTVKLWDLRTGDFLRNLVSLDSGGSGGV 524          

HSP 5 Score: 73.559 bits (179), Expect = 3.389e-14
Identity = 48/171 (28.07%), Postives = 78/171 (45.61%), Query Frame = 3
Query:  807 WDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            W     R    L GHD  +      F G  + + S D ++K+W    G + L TL GHT  V        G  + S   D T+++W+  D  +      GH + V  +  +  G  ++S S D + R W+  TG+ + VL GH   +      YDG ++++G+ D T ++W
Sbjct:  218 WRCGEIRAPKVLKGHDDHV-ITCLQFCGNRIVSGSDDNTLKVWSAVTG-KCLRTLVGHTGGVWSSQMR--GNIIVSGSTDRTLKVWNA-DTGQCVHTLYGHTSTVRCMHLH--GNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVR--CVQYDGRRVVSGAYDYTVKVW 379          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 140.198 bits (352), Expect = 9.565e-38
Identity = 81/256 (31.64%), Postives = 139/256 (54.30%), Query Frame = 3
Query:  588 GHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKC--VSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGT-YVATASMDKSIKIWDLRM-GARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWN----TTTGKVIQVLEGHT----DEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            GH  EV C +F+P+   + + G D   ++W+V  G C   ++L+GHT  ++ + +  + +G  + T S D TV LWD   G R+ +L GH + ++A      G   V TAS D ++K+WD R  G+   F    +T + L VTF++   Q+ S G DN +++WD++  +K  +  KGH   V+ ++ +P G+ LLS + D S R W+        + +++ +G+       +  C++++DGSK+  GS D    IW
Sbjct:   55 GHEGEVYCCKFHPNGNTLASAGFDRTILMWNVY-GDCDNYAHLKGHTGAILDIHY--STDGSTIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQ---NTYQCLSVTFNDTSDQILSGGIDNVIKVWDLRQ-NKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIW 303          

HSP 2 Score: 127.487 bits (319), Expect = 3.507e-33
Identity = 80/300 (26.67%), Postives = 149/300 (49.67%), Query Frame = 3
Query:  426 TSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSA-NDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFS---KPSFIFKGH----EAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKD 1301
            +S+   +  L GH+  VY   ++ P  + + +  FD+T  MW+   D   Y   KGHT  ++ + ++   + + T   D    LWD E+G+ +  L+GHT+  ++  F      + + T S D TV LWD      V     +  +  +  FN     + +  +D  IK+WDLR   + ++T+ GH D V  ++    G  + S   DN+VR+WD++ F+   +   IF+G+    E  + K +++  G+ + + SAD+    W+TT+ +++  L GH   +   AF+ +   +++ + D
Sbjct:   44 SSLLAPIMLLTGHEGEVYCCKFH-PNGNTLASAGFDRTILMWNVYGDCDNYAHLKGHTGAILDIHYSTDGSTIFTSSTDKTVGLWDSETGERIKRLKGHTS-FVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSF-QNTYQCLSVTFNDTSDQILSGGIDNVIKVWDLRQN-KLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDTTSRRILYKLPGHAGSVNDVAFHPEEPIVLSCAND 339          

HSP 3 Score: 115.161 bits (287), Expect = 1.085e-28
Identity = 82/313 (26.20%), Postives = 145/313 (46.33%), Query Frame = 3
Query:  276 QEKLKVPVDKTYGLFK---VLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFT-LEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEV-VCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGAR-----DLFTLAGHTDE--VLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADK 1178
            Q+ L V   ++  L     +L  H   +    F+ NG+   +  +DRT  +W+       +  L+GH   +  I Y+   S  I T S DKT  +W +  G      KGHT+ V  C        +V T   D    LWD      V + Q +T + +S+ F    +   +++G  D+ + +WD+   + +  + GH+  ++    + DG+Y+ + +MD S++IWD+R  A       +F    H  E  +L  ++ + G +V++  AD  V +WD     +  +   GH   V+ V F+P+  ++LS + DK
Sbjct:   33 QQLLAVGPPRSSSLLAPIMLLTGHEGEVYCCKFHPNGNTLASAGFDRTILMWNVYGDCDNYAHLKGHTGAILDIHYSTDGS-TIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQ-NTYQCLSVTFNDTSD--QILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDTTS-RRILYKLPGHAGSVNDVAFHPEEPIVLSCANDK 340          

HSP 4 Score: 102.834 bits (255), Expect = 1.997e-24
Identity = 66/257 (25.68%), Postives = 123/257 (47.86%), Query Frame = 3
Query:  327 LRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIG------HDAE--ISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVK 1073
            L+ H   + ++ ++ +G    T S D+T  +WD+  G  +  L+GH + V +          + T S D T K+W        H+F+ +T + + V FN +S  + +GG+D +  +WD+   K +  ++GH   V  L    + +G +L++ + D++V +WD+     + + +       H+ E  +    ++ DG+ V+  S D+ + IWD     R L+ L GH   V DV F      V S   D  + L +++
Sbjct:   96 LKGHTGAILDIHYSTDGSTIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQ-NTYQCLSVTFNDTSDQILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSL--SPDGSYLLSNAMDNSVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDT-TSRRILYKLPGHAGSVNDVAFHPEEPIVLSCANDKRLYLGEIQ 348          

HSP 5 Score: 101.679 bits (252), Expect = 5.354e-24
Identity = 66/206 (32.04%), Postives = 103/206 (50.00%), Query Frame = 3
Query:  708 LQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVH-NGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQ-VASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L GH  EV   +F    NG  L +  FD T+++W+V+ +    + L GH   I    ++ DG+ + T+S DK++ +WD   G R +  L GHT  V        G Q V +A  D TV+LWD +   K S     +  +   VTFN     +LS   D   + W+    K+I  ++GH D +   + + DGS +++ + DN+ RIW
Sbjct:   53 LTGHEGEVYCCKFHP--NGNTLASAGFDRTILMWNVYGDCDNYAHLKGHTGAILDIHYSTDGSTIFTSSTDKTVGLWDSETGER-IKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTR--KKGSVHSFQNTYQCLSVTFNDTSDQILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIW 253          

HSP 6 Score: 82.8037 bits (203), Expect = 1.397e-17
Identity = 61/231 (26.41%), Postives = 104/231 (45.02%), Query Frame = 3
Query:  300 DKTYGLF--------KVLRAHILPLTNVTF--NKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVES----GKCVSNLQG--HTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLR 944
            DKT GL+        K L+ H     N  F   +      T S D T K+WDT    ++ + +     + S+ +N   SD+I++G  D   K+W      L +T KGH   V  +  +P  + + +  MD    +WD+       +CV   QG  H  E   L+   +H+G  +  GS D  V +WD  + R + +L GH   ++   F+ +   V + + DK + + +++
Sbjct:  121 DKTVGLWDSETGERIKRLKGHT-SFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQNTYQCL-SVTFN-DTSDQILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDTTSRRILYKLPGHAGSVNDVAFHPEEPIVLSCANDKRLYLGEIQ 348          

HSP 7 Score: 52.373 bits (124), Expect = 1.168e-7
Identity = 34/103 (33.01%), Postives = 46/103 (44.66%), Query Frame = 3
Query: 1017 GKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQV--LEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            G+Q+ + G   +  L        P  +  GHE EV    F+P G  L SA  D++   WN   G       L+GHT  I    ++ DGS I T S D T  +W
Sbjct:   32 GQQLLAVGPPRSSSLL------APIMLLTGHEGEVYCCKFHPNGNTLASAGFDRTILMWN-VYGDCDNYAHLKGHTGAILDIHYSTDGSTIFTSSTDKTVGLW 127          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 138.658 bits (348), Expect = 3.914e-37
Identity = 86/311 (27.65%), Postives = 143/311 (45.98%), Query Frame = 3
Query:  447 FTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIW---------DLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGA----------DNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            + L GH++ V  + ++  FS  IV+ S D T K+W    G    T KGHT  V  + F+ S  ++ +   D    LWD +S +C+  + GH   V S+ F    NG HL++ S D T+ +W+V  G  V    GH   +     N DG+ +A+ S D+++++W         +LR     +  ++   D    V  +  G +    G           D T+++WD+           GH+  V  V F+P G  +LS + DK+ R W+    +  + L  H   + S  F+     +ITGS D + ++W+
Sbjct:   41 YALSGHRSPVTRVIFHPVFS-VIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAF--MPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDIST-GICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWE 347          

HSP 2 Score: 124.405 bits (311), Expect = 5.264e-32
Identity = 74/269 (27.51%), Postives = 128/269 (47.58%), Query Frame = 3
Query:  321 KVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQ--GHTAEVISLQFGQA----------------HNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVK 1073
            + L+ H   + +++F+ +G    + S D T K+WD      L T+ GH + V S+A+ +P  D +V+ S DKT KMW    G    TF GH   V  V+ N   +L+ +   D    +W   + +C + L+   H  E +S     A                  G +L++GS D T+ +WD+  G  V  L+GHD  +   +F+  G ++ + + DK++++WD +   R   +LA H   V  + F      V +   D +V++W+ +
Sbjct:   83 RTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAF-MPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYK-NKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWECR 349          

HSP 3 Score: 119.398 bits (298), Expect = 2.684e-30
Identity = 86/310 (27.74%), Postives = 136/310 (43.87%), Query Frame = 3
Query:  327 LRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFD--------------------GTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWN 1196
            L  H  P+T V F+      ++ S D T KVWD   G    TL+GH + V  I+++L     + + S D T K+W         T  GH   V  V F P+   + +   D    +W+V++G CV    GH   V  ++  Q  +G  + + S D TV +W        ++L  H+  +    +  D                    G Y+ + S DK+IK+WD+  G   + TL GH + V  V F   GK + S   D T+R+WD K+  +       HE  V+ + F+     +++ S D+S + W 
Sbjct:   43 LSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLS-GKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQ--DGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGIC-VITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKN-KRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWE 347          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004902.1 (pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 gene:ENSPMAG00000004437.1 transcript:ENSPMAT00000004902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 1.082e-36
Identity = 94/292 (32.19%), Postives = 149/292 (51.03%), Query Frame = 3
Query:  450 TLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKG-HEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            TL+ H+  V S+A + P  + IVT S D+  KMWS  +G +  T +GHT  +    FNP+ T + TGG D+   +WD   G CV  L+GH   V    +     G  + + S D++  +WDV++ R    L GH   +++  F    + + T+S DK++ +WD R G R      GH       TF+  G  V S  +   +++WDV+  +    +  G H A  ++++F+P G V+  AS D   R  +  TG V + L GH D + +  F+ DG  + +G  D T R+W+
Sbjct:  330 TLKAHEMPVSSMALH-PRKEIIVTASDDQLWKMWSIPNGDIIMTGQGHTDWIGDCDFNPTGTNLATGGGDSTVKVWDFSQGACVLTLEGHGHAVWGCSWHSC--GDFIASSSMDNSSKVWDVNSERCRQTLRGHTDSVNSVEFLPYSSTLLTSSADKTLSLWDARTG-RCAQIFYGHLHSCNHGTFNLKGDTVVSCDSYGVIKVWDVRKGTATMTLNLGPHPA--NRLSFHPSGHVMAVASDDACVRIVDLLTGHV-ETLSGHEDAVQAVVFSPDGDTLFSGGSDGTIRMWE 614          

HSP 2 Score: 133.65 bits (335), Expect = 6.404e-34
Identity = 86/295 (29.15%), Postives = 134/295 (45.42%), Query Frame = 3
Query:  315 LFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDL-FTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWN 1196
            + + L+AH +P++++  +   +  +T S D+  K+W    G  + T +GH + +    +N P    + TG  D T K+W  + G+   T +GH   V    ++     + +  MD  + +WDV S +C   L+GHT  V S++F        L+T S D T+ LWD   GR      GH    +   FN  G  V +      IK+WD+R G   +   L  H    L  +F   G  +A A  D  VR+ D+   +       GHE  V  V F+P G  L S  +D + R W 
Sbjct:  327 ISQTLKAHEMPVSSMALHPRKEIIVTASDDQLWKMWSIPNGDIIMTGQGHTDWIGDCDFN-PTGTNLATGGGDSTVKVWDFSQGACVLTLEGHGHAVWGCSWHSCGDFIASSSMDNSSKVWDVNSERCRQTLRGHTDSVNSVEF--LPYSSTLLTSSADKTLSLWDARTGRCAQIFYGHLHSCNHGTFNLKGDTVVSCDSYGVIKVWDVRKGTATMTLNLGPHPANRL--SFHPSGHVMAVASDDACVRIVDL--LTGHVETLSGHEDAVQAVVFSPDGDTLFSGGSDGTIRMWE 614          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 139.043 bits (349), Expect = 2.099e-36
Identity = 88/292 (30.14%), Postives = 153/292 (52.40%), Query Frame = 3
Query:  453 LEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNL-QGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARD-LFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
             +GH++ + S+ +N P   ++ +GS D    +W+    +  + F GH   V+ VQF+PS  LV +   D    LW V S K  S + + HTA V S+ F    +G+ L+T S D ++ +W VH  + +  L  H   + +A F+ DG  + + S D+++++WD    +R+ + T   H   V  V F   G  +A+AG DNTV++WD++  +K    ++ H A V+ ++F+P G  L++AS D + +  +   G++   L GH     + AF+  G    +G  D    +W+
Sbjct:   14 FKGHRDTITSVDFN-PNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLW-VPSVKGESTVFKAHTATVRSVSFSA--DGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWD--SNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIR-MNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVWK 298          

HSP 2 Score: 129.028 bits (323), Expect = 7.612e-33
Identity = 78/252 (30.95%), Postives = 127/252 (50.40%), Query Frame = 3
Query:  561 DGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRI 1316
            D SL   FKGH   +  V FNP+   + +G MD   M+W+ +         GH   V+S+QF  +  G  +++ S D TV LW        +    H A + +  F+ DG  + TAS DKSIK+W +    + L++L  H++ V    F   G+ + S   D TVR+WD  +  +    F  H   V++V F+P GT + +A  D + + W+    K++Q  + H   + S +F+  G+ +IT S D+T ++
Sbjct:    7 DPSLERHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPS--GHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHR-QKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWD-SNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKV 254          

HSP 3 Score: 124.02 bits (310), Expect = 3.851e-31
Identity = 87/317 (27.44%), Postives = 148/317 (46.69%), Query Frame = 3
Query:  291 VPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKV--IQVLEGH 1235
            +P  +   L +  + H   +T+V FN N  +  +GS D    VW+    T  +   GHK+ V S+ ++ P    +V+ S DKT ++W  +       FK HTA V  V F+     + T   D    +W V   K + +L  H+  V S +F    +G+ +++GS D TV +WD ++   V     H   ++   F+  GT +A A  D ++K+WD+RM  + L     H   V  ++F   G  + +A  D+T+++ D+ +  +  +   GH+   + V F+  G    S  +D+    W T    V   +VL  H
Sbjct:    2 LPWQEDPSLERHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFS-PSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSP--DGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMN-KLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVE-GRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVWKTNFDSVDYSEVLRSH 313          

HSP 4 Score: 120.553 bits (301), Expect = 6.879e-30
Identity = 80/250 (32.00%), Postives = 119/250 (47.60%), Query Frame = 3
Query:  201 DMIMKTE-----HLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIW 935
            D +M  +     HLV    RD  +        +L VP  K  G   V +AH   + +V+F+ +G   +T S D++ KVW       L++L  H N V S  ++ P    IV+GS D+T ++W +N     HTF  H   V  V F+PS T +   G D    +WD+   K + + Q H A V SL F     G +LIT S D T+ + D+  GR    L GH    +A  F+  G + A+   D+ + +W
Sbjct:   61 DAVMSVQFSPSGHLVVSASRDKTV--------RLWVPSVK--GESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFS-PDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHP--TGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 147.132 bits (370), Expect = 2.896e-39
Identity = 95/336 (28.27%), Postives = 160/336 (47.62%), Query Frame = 3
Query:  453 LEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSN-LQGHTAEVISLQFGQAH-----NGKHLITGSFDHTVILWDVHNGRRVSQ--LIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGH----------TDEVLDV-TFDNVGKQ----------------------------VASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            + GH + +   A+    S ++VTG+ D TA++W  +  +  HT KGH   V+CV ++P   ++ TG MD    LWD +SG+C+ + L+GH+  + SL +   H     +   L + S D T+ +WD  +  RV Q  + GH   +S   +   G  + + S D+++++WD+    R +  L  H          TD  L +  FD+ GK+                            + +A  D T+ LW+    +KP     GH+  V+ V F+P G  ++SAS D S + W+   GK I    GH   ++  A++ D   +++ SKD T ++W
Sbjct:  139 IAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVS--RVCQYTMSGHTNSVSCVKWGGQG-LLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW 471          

HSP 2 Score: 145.591 bits (366), Expect = 1.090e-38
Identity = 100/364 (27.47%), Postives = 169/364 (46.43%), Query Frame = 3
Query:  381 RFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGS-LYHTFKGHTAEVVCVQFNP-------SSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLI-TGSFDHTVILWDVHN-GRRVSQLIGH-----------DAEISAAVFNFDGT----------------------------YVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            R +TG+ D T ++WD    T + TL+GH N V  ++++ P  + I TGS D T ++W    G  L    +GH+  +  + + P       S   + +   D    +WD  S  C   + GHT  V  +++G    G+ L+ +GS D TV +WD+++ GR ++ L  H           D  +    F+  G                              + TAS D ++ +W+     + +  + GH   V  V F   G+ + SA  DN+++LWD +D     FI  F+GH A V +V ++    +L+S S D + + W+  T K+   L GH DE+++  ++ DG ++ +G KD   R+W
Sbjct:  158 RMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWS-PDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWG----GQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGK---FISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 124.79 bits (312), Expect = 6.252e-31
Identity = 66/209 (31.58%), Postives = 112/209 (53.59%), Query Frame = 3
Query:  321 KVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAE-ISAAVFNFDGTYVATASMDKSIKIWDLR 944
            K L  H   + + +F+ +    L+GS D+T ++W     T L + +GH + V+ ++++ P      T S D+TA++WS +       F GH  +V CV F+P+   V TG  D    +WDV +G  V    GHTA VIS+      +G+ L TGS D  + +WD+  G+R+ Q+ GH    I +  ++ +G  + +   D ++++WDL+
Sbjct:  519 KTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFS-PLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAV--CPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724          

HSP 2 Score: 117.472 bits (293), Expect = 1.883e-28
Identity = 72/218 (33.03%), Postives = 111/218 (50.92%), Query Frame = 3
Query:  423 DTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGH-TDEVLDVTFDNVGKQVASAGADNTVRLWDVK 1073
            D     T  TL GH   VYS +++ P +  +++GS DKT ++WS +  +   ++KGH   V  V F+P      T   D  A LW  +    +    GH  +V  + F    NG ++ TGS D T  +WDV  G  V   +GH A + +     DG +++T S D  I +WD+  G R L  + GH  + +  +++   G  + S GAD+TVR+WD+K
Sbjct:  511 DKDEDPTCKTLVGHSGTVYSTSFS-PDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHP--NGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKR-LKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724          

HSP 3 Score: 109.768 bits (273), Expect = 6.034e-26
Identity = 74/266 (27.82%), Postives = 123/266 (46.24%), Query Frame = 3
Query:  576 HTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLW-----------------DVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGH-TDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            +TF+    ++ C+ F+    +   G  D+   +W                 D +       L GH+  V S  F  + + K+L++GS D TV LW +     +    GH+  +    F+  G Y ATAS D++ ++W        L   AGH ++V  V+F   G  V +  +D T R+WDV        +F GH A V  +   P G  L + S D     W+  TGK ++ + GH  + I+S +++ +G+ +I+G  D+T R+W
Sbjct:  460 YTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSF--SPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH-IYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVST-GDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVW 721          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 122.094 bits (305), Expect = 4.266e-30
Identity = 80/263 (30.42%), Postives = 126/263 (47.91%), Query Frame = 3
Query:  606 VCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMG------ARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPS-----------FIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKI-------ITGSKDNTCRIWQ 1322
            VC  F+P    + TG  D L  +WD+E+ K V  LQGH  ++ SL +  +  G  L++GS D TV +WD+  G+    L   D   + AV   DG Y+A  S+D+++++WD   G        +  +  GH D V  V F   G+ V S   D +V+LW++++ +  S             + GH+  V  V        +LS S D+    W+  +G  + +L+GH + + S A   +GS +        TGS D   RIW+
Sbjct:  449 VC--FSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS--GDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAV-ANGSPLGPEYNVFATGSGDCKARIWK 706          

HSP 2 Score: 104.76 bits (260), Expect = 2.592e-24
Identity = 74/273 (27.11%), Postives = 120/273 (43.96%), Query Frame = 3
Query:  342 LPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNP-SSTLVGTGGMDTLAMLWDVESGKCVSNLQ-------GHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQ------------LIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDN---VGKQV---ASAGADNTVRLWDVKDFS 1082
            L + +V F+ +G    TG+ DR  ++WD      +  L+GH+  +YS+ Y  P  DK+V+GS D+T ++W    G    T       V  V  +P     +  G +D    +WD E+G  V  L        GH   V S+ F    +G+ +++GS D +V LW++ N    S              IGH   + +     +  Y+ + S D+ +  WD + G   L  L GH + V+ V   N   +G +    A+   D   R+W  K  +
Sbjct:  444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDY-FPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVF--TRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSG-NPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIA 711          

HSP 3 Score: 78.9518 bits (193), Expect = 5.493e-16
Identity = 63/232 (27.16%), Postives = 102/232 (43.97%), Query Frame = 3
Query:  324 VLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFK-------GHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVE------------SGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGH-DAEISAAVFN-----FDGTYVATASMDKSIKIWDLR 944
            +L+ H   + ++ +  +GD+ ++GS DRT ++WD   G    TL     V  ++A +      I  GS D+  ++W +  G L            GH   V  V F      V +G +D    LW+++            SG C     GH   V+S+   Q  N +++++GS D  V+ WD  +G  +  L GH ++ IS AV N      +    AT S D   +IW  +
Sbjct:  480 ILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVT-TVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQ--NDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYK 708          

HSP 4 Score: 57.7658 bits (138), Expect = 2.176e-9
Identity = 23/67 (34.33%), Postives = 39/67 (58.21%), Query Frame = 3
Query: 1119 VSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            +  V F+P G  L + + D+  R W+    K++ +L+GH  +I+S  +   G K+++GS D T RIW
Sbjct:  446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIW 512          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Yeast
Match: CDC4 (F-box protein required for both the G1/S and G2/M phase transitions; modular substrate specificity factor which associates with core SCF (Cdc53p, Skp1p and Hrt1p/Rbx1p) to form the SCFCdc4 complex; SCFCdc4 acts as a ubiquitin-protein ligase directing ubiquitination of cyclin-dependent kinase (CDK) phosphorylated substrates, such as: Sic1p, Far1p, Cdc6p, Clb6p, and Cln3p [Source:SGD;Acc:S000001885])

HSP 1 Score: 114.005 bits (284), Expect = 2.402e-27
Identity = 104/386 (26.94%), Postives = 175/386 (45.34%), Query Frame = 3
Query:  255 IELIKNLQEKLKVPVDKTYGLFKVLRAHILP-LTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVC---VQFNPSSTLVGTGGMDTLAMLWDVESGKCVSN-----------------------LQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLR---------------------MGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKV-TFNPQGTVLLSASADKSARTWNTTTGKVIQV-LEGHTDEIFSCAF 1262
            I ++KN      VP   T      LR H+   +T + F  N    +TG+ D+  +V+D+     L  L GH   V+++ Y       +V+GS D+T ++W    G   H FKGH + V C   V++     +V TG  D    +W +     V +                       L+GH A V ++    + +G  +++GS+D+T+I+WDV   + +  L GH   I + +++ +     +ASMD +I+IWDL                      +GA  ++TL GHT  V  +   +  K + SA AD ++R WD  D+S+    F  H   +S + TF     +L+S S ++    +N  +GK++   +    D+I+S  F
Sbjct:  359 IFILKNWYNPKFVPQRTT------LRGHMTSVITCLQFEDN--YVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKY--AHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIV-TGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTV----SGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGA--MYTLQGHTALVGLLRLSD--KFLVSAAADGSIRGWDANDYSRK---FSYHHTNLSAITTFYVSDNILVSGSENQ-FNIYNLRSGKLVHANILKDADQIWSVNF 721          

HSP 2 Score: 92.0485 bits (227), Expect = 3.616e-20
Identity = 66/229 (28.82%), Postives = 111/229 (48.47%), Query Frame = 3
Query:  708 LQGHTAEVIS-LQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGA-RDLFTLAGHTDEVLD-VTFDNVGKQVASAGADNTVRLWDVKDFS--------------------KPSFI--FKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L+GH   VI+ LQF       ++ITG+ D  + ++D  N + + QL GHD  + A  +   G  V + S D+++++WD++ G    +F     T   LD V + N+ K + +   DNT+ +W +   S                     P F+   +GH A V  V+    G +++S S D +   W+    K + +L GHTD I+S  ++++  + I+ S D T RIW
Sbjct:  377 LRGHMTSVITCLQF----EDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGILV-SGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNI-KYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVS--GHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIW 597          

HSP 3 Score: 47.3654 bits (111), Expect = 3.669e-6
Identity = 36/123 (29.27%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  966 TLAGHTDEVLD-VTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSC--AFNYDGSK-IITGSKDNTCRIWQ 1322
            TL GH   V+  + F++    V +   D  +R++D  +  K      GH+  V  + +   G +L+S S D++ R W+   G    V +GH   +  C     Y   K I+TGS+DNT  +W+
Sbjct:  376 TLRGHMTSVITCLQFED--NYVITGADDKMIRVYDSIN-KKFLLQLSGHDGGVWALKY-AHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTV-RCLDIVEYKNIKYIVTGSRDNTLHVWK 493          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 107.842 bits (268), Expect = 2.325e-25
Identity = 85/295 (28.81%), Postives = 132/295 (44.75%), Query Frame = 3
Query:  582 FKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDG--TYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKV-------------------------------------TFNPQGTVL----------LSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            FKGH   V+ +QFN    L+ TG  D+   +WD+ +GK +  L GH+  V +L F    + + LITGS D T+ +W+   G  +S   GH    S +V + D     + + S DK++K+W +   +R  +TL GHT+ V  V          S   D T+R+WD++  S    +F+GH  +V K+                                       N Q TVL          LS   D + + W+  TGK I+   GH + ++  A   D  +II+GS D + ++W
Sbjct:  298 FKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF----DDRKLITGSLDKTIRVWNYITGECISTYRGH----SDSVLSVDSYQKVIVSGSADKTVKVWHVE--SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK-VFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVW 577          

HSP 2 Score: 104.375 bits (259), Expect = 2.844e-24
Identity = 61/187 (32.62%), Postives = 99/187 (52.94%), Query Frame = 3
Query:  690 GKC-VSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEI 1247
            G C +   +GH   V++LQF    N + L TGS+D T+ +WD+  G+ + +L GH   +      FD   + T S+DK+I++W+   G   + T  GH+D VL V  D+  K + S  AD TV++W V+  S+  +  +GH   V+ V  +P+     S S D + R W+  T   ++V  GH  ++
Sbjct:  291 GHCRIQEFKGHMDGVLTLQF----NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGV--KTLYFDDRKLITGSLDKTIRVWNYITGEC-ISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVE--SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466          

HSP 3 Score: 93.9745 bits (232), Expect = 6.212e-21
Identity = 84/330 (25.45%), Postives = 143/330 (43.33%), Query Frame = 3
Query:  276 QEKLKVPVDKTYGLFKV--LRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAV---------FNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEG 1232
            +E+ KV  +   G  ++   + H+  +  + FN       TGSYD T  +WD   G  +  L GH + V ++ ++     K++TGS DKT ++W+   G    T++GH+  V+ V  +    ++ +G  D    +W VES  C + L+GHT  V  ++           + S D T+ +WD+     +    GH  ++   +            D T   ++  D       +  GA +  T +   + VLD         + S G DNT++LWDVK        F GH   V  +  +     ++S S D S + W+  +GK +    G
Sbjct:  279 RERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD---DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFS--CFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPT----MTDGADESDTPSNEQETVLDENIP-YPTHLLSCGLDNTIKLWDVKTGKCIRTQF-GHVEGVWDIAAD--NFRIISGSHDGSIKVWDLQSGKCMHTFNG 590          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 516.153 bits (1328), Expect = 0.000e+0
Identity = 250/419 (59.67%), Postives = 311/419 (74.22%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            M+LK+FL+RY+PPGIILEYEQ G +KTK+ DLLDL   T+ + ++D I   E L+T  R D V +LI  LQEK     D+ + LFK+LRAHILPLTNV FNK+G  F+TGSYDRTCKVWDT+ G    TLEGHKNVVY+IA+N P+ DKI TGSFDKT K+W+A  G  YHT++GH+AE+VC+ FNP ST++ TG MDT A LWDV++G  +S L GH+AE+IS  F     G  L+TGSFDHTV +WD  +GRRV  LIGH  EIS A FNFD +++ T SMDK+ KIWD   G + + TL GH DEVLDV FD  G+ +A+A AD T R+++       S + +GHE E+SK+TFN QGT LL+AS+DK+AR W+  TGK +QVLEGHTDEIFSCAFNYDG  IITGSKDNTCR+W+
Sbjct:    1 MRLKKFLLRYYPPGIILEYEQSGVLKTKSIDLLDLKPSTDVDAILDDISAKEPLITPARLDQVRKLIIRLQEKQIETDDRHFYLFKILRAHILPLTNVAFNKSGTSFITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNS--TGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTG-KCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKL-EGHEGEISKITFNAQGTRLLTASSDKTARLWDPNTGKCLQVLEGHTDEIFSCAFNYDGDIIITGSKDNTCRLWR 415          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Nematostella
Match: EDO49767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR6])

HSP 1 Score: 148.288 bits (373), Expect = 5.211e-41
Identity = 87/293 (29.69%), Postives = 146/293 (49.83%), Query Frame = 3
Query:  315 LFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTW 1193
            L + +      +  +    +  + +TG  D + +VWD   G  L  L  H  +VY++A + P +D +V+G+FD T K+W  +  SL HT KGH   V  V   P S  + +   D    +WDVE+   V++L GH   V  +      +G+ L++ S D T+ +W++     VS L GH   +     + D  +  + S D  +KIWDL   A+++ +L GHT ++  V     G +V S+G D  V++W ++   + + +  GH   V  VT +P G  ++S S D + + W
Sbjct:    5 LLRTIDGRSRTILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKLVYTLALS-PHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAI--TSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLE-SAKEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLH-GHSESVRIVTVSPDGLTIVSGSEDATFKIW 292          

HSP 2 Score: 140.198 bits (352), Expect = 4.217e-38
Identity = 79/253 (31.23%), Postives = 132/253 (52.17%), Query Frame = 3
Query:  564 GSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            G L  T  G +  ++ +   P +  + TGG D    +WD E+GK ++ L  HT  V +L    + +   L++G+FDHTV +WD+     V  L GH   +S  +   D   + ++S DK++KIWD+   A  + +L GH   V  +   + G+++ SA  D T+R+W+++ F+  S   +GH   V  V  +P     +S S D   + W+  + K ++ L GHT +IF+ A   DGSK+I+   D   ++W 
Sbjct:    3 GPLLRTIDGRSRTILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKLVYTLAL--SPHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAF-VNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVS-TLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWS 251          

HSP 3 Score: 139.813 bits (351), Expect = 6.480e-38
Identity = 84/295 (28.47%), Postives = 146/295 (49.49%), Query Frame = 3
Query:  435 GTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            G  L T++G    +  IA   P + KI+TG  D + ++W    G   +    HT  V  +  +P +  + +G  D    +WD+++   V  L+GH   V  +      + K +I+ S+D TV +WDV     V+ L GHD  +       DG  + +AS D++++IW+L   A  + TL GH++ V  V      K   S   D  V++WD++  +K      GH +++  V   P G+ ++S+  D   + W+  +G+ +  L GH++ +     + DG  I++GS+D T +IW
Sbjct:    3 GPLLRTIDGRSRTILGIAVT-PDTKKIITGGADGSIRVWDYETGKELNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLV--TPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAH-VSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLES-AKEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDATFKIW 292          

HSP 4 Score: 108.997 bits (271), Expect = 8.338e-27
Identity = 62/212 (29.25%), Postives = 107/212 (50.47%), Query Frame = 3
Query:  306 TYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSD--KIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIW 935
            T  L   L+ H   ++ V    +  R ++ SYD+T K+WD      + +L+GH   V  IA     SD  ++V+ S D+T ++W+    +   T +GH+  V CV  +P      +G  DT+  +WD+ES K V +L GHT+++ ++      +G  +I+   D  V +W + +G  ++ L GH   +     + DG  + + S D + KIW
Sbjct:   86 TLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAIT---SDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAV--TPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDATFKIW 292          

HSP 5 Score: 78.1814 bits (191), Expect = 4.285e-16
Identity = 45/169 (26.63%), Postives = 80/169 (47.34%), Query Frame = 3
Query:  303 KTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILW 809
            +T      L  H   +  +    +G R ++ S DRT ++W+      + TL GH   VY +  + P     ++GS D   K+W         +  GHT+++  V   P  + V + G DT   +W +ESG+ +++L GH+  V  +    + +G  +++GS D T  +W
Sbjct:  127 ETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCS-PDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTV--SPDGLTIVSGSEDATFKIW 292          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Nematostella
Match: EDO44795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR9])

HSP 1 Score: 143.665 bits (361), Expect = 1.772e-39
Identity = 88/278 (31.65%), Postives = 134/278 (48.20%), Query Frame = 3
Query:  510 KIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLR-----MGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDV---KDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            KI +GS D T ++W +  G+L     GH   V CV+ +P   ++ +   D    LW+  S + + +L+GH   V SL F +  NGK L++ + D  + +WDV +G  +  L GHD       F+ DG  +A+   D ++ IWD+      M    +  L GH+D V+DV F + G  + S   D TVR+WD    +   K  F    H      V ++  G  L SAS D   R W       +  +EGH  EI   +F+ D S + + + D T R+W
Sbjct:    2 KIFSGSEDCTIRVWDSKTGALLAQLDGHAGAVTCVRVSPDGGVIASSSADKTIRLWN-PSDEFLRSLEGHEDRVTSLAFSK--NGKRLVSVALDKKLKVWDVESGNLLDTLTGHDGYPVCLDFSPDGMLLASTGADSNVIIWDISTARCYMQGTIIALLGGHSDWVMDVAFSSDGALLTSGSRDRTVRVWDCAAAEKLKKARF----HSERCWSVAYSDDGMWLASASDDFKVRLWAVEGYAQVAAMEGHESEIRVVSFSPDDSLLASAALDQTIRVW 272          

HSP 2 Score: 137.502 bits (345), Expect = 3.422e-37
Identity = 83/278 (29.86%), Postives = 142/278 (51.08%), Query Frame = 3
Query:  381 RFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQ------LIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWN 1196
            +  +GS D T +VWD+  G  L  L+GH   V  +  + P    I + S DKT ++W+ +D     + +GH   V  + F+ +   + +  +D    +WDVESG  +  L GH    + L F  + +G  L +   D  VI+WD+   R   Q      L GH   +    F+ DG  + + S D+++++WD    A  L     H++    V + + G  +ASA  D  VRLW V+ +++ + + +GHE+E+  V+F+P  ++L SA+ D++ R W+
Sbjct:    2 KIFSGSEDCTIRVWDSKTGALLAQLDGHAGAVTCVRVS-PDGGVIASSSADKTIRLWNPSD-EFLRSLEGHEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNLLDTLTGHDGYPVCLDF--SPDGMLLASTGADSNVIIWDISTARCYMQGTIIALLGGHSDWVMDVAFSSDGALLTSGSRDRTVRVWDC-AAAEKLKKARFHSERCWSVAYSDDGMWLASASDDFKVRLWAVEGYAQVAAM-EGHESEIRVVSFSPDDSLLASAALDQTIRVWD 273          

HSP 3 Score: 129.798 bits (325), Expect = 1.766e-34
Identity = 78/267 (29.21%), Postives = 139/267 (52.06%), Query Frame = 3
Query:  285 LKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKC------VSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWD 1067
            ++V   KT  L   L  H   +T V  + +G    + S D+T ++W+ S    L +LEGH++ V S+A++     ++V+ + DK  K+W    G+L  T  GH    VC+ F+P   L+ + G D+  ++WD+ + +C      ++ L GH+  V+ + F  + +G  L +GS D TV +WD     ++ +   H     +  ++ DG ++A+AS D  +++W +  G   +  + GH  E+  V+F      +ASA  D T+R+WD
Sbjct:   12 IRVWDSKTGALLAQLDGHAGAVTCVRVSPDGGVIASSSADKTIRLWNPS-DEFLRSLEGHEDRVTSLAFS-KNGKRLVSVALDKKLKVWDVESGNLLDTLTGHDGYPVCLDFSPDGMLLASTGADSNVIIWDISTARCYMQGTIIALLGGHSDWVMDVAF--SSDGALLTSGSRDRTVRVWDCAAAEKLKKARFHSERCWSVAYSDDGMWLASASDDFKVRLWAVE-GYAQVAAMEGHESEIRVVSFSPDDSLLASAALDQTIRVWD 273          

HSP 4 Score: 108.227 bits (269), Expect = 1.216e-26
Identity = 61/193 (31.61%), Postives = 104/193 (53.89%), Query Frame = 3
Query:  765 KHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLF--TLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTT------GKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            + + +GS D T+ +WD   G  ++QL GH   ++    + DG  +A++S DK+I++W+      D F  +L GH D V  + F   GK++ S   D  +++WDV+  +       GH+     + F+P G +L S  AD +   W+ +T      G +I +L GH+D +   AF+ DG+ + +GS+D T R+W
Sbjct:    1 RKIFSGSEDCTIRVWDSKTGALLAQLDGHAGAVTCVRVSPDGGVIASSSADKTIRLWN----PSDEFLRSLEGHEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNLLD-TLTGHDGYPVCLDFSPDGMLLASTGADSNVIIWDISTARCYMQGTIIALLGGHSDWVMDVAFSSDGALLTSGSRDRTVRVW 188          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Nematostella
Match: EDO37614 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFB4])

HSP 1 Score: 146.747 bits (369), Expect = 6.435e-39
Identity = 92/295 (31.19%), Postives = 144/295 (48.81%), Query Frame = 3
Query:  513 IVTGSFDKTAKMWSANDGS--LYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIW--------------DLRMGARDLFTLAGHTDEVLDVTFDNVGK-QVASAGADNTVRLWDV---KDFSKPSFI-----FKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            + + S DKTA++W    G+        GH   V     +P  TL+ T   D+  MLW++E+G+C++ L+GHT  V   +F  + N + LI+GS D T I+WDV   + V  +   ++ ++A  F  DG ++ T + +  + IW              D+ +GA D     G     L  T  +  +  +AS G DN VRLW +     FS+   I        H+++V    F+P G +L SAS DK+   WN   G  +  + GH+  +  C+F+ DG  + T S D T R+WQ
Sbjct:   27 LASCSGDKTARLWDVEKGTELAQSPLDGHNYHVNSCSVSPFGTLMATASTDSTLMLWNLETGECLAVLEGHTGAVRVCRF--SPNSQFLISGSADETFIIWDVLLKKPVRCVDKLESSVTACAFTPDGLHIITGTSEGKLAIWEAQKGKFITQVEGHDMGVGACDFSPTFGSAVPGLSDTSGSAPQFLLASGGNDNLVRLWTIYTASAFSEECHIASRCVLDQHQSQVWDCCFSPNGKILASASGDKTVILWNPLNGVALHTITGHSRYVTCCSFSPDGKWLATASGDRTLRLWQ 319          

HSP 2 Score: 98.9821 bits (245), Expect = 2.345e-22
Identity = 83/333 (24.92%), Postives = 134/333 (40.24%), Query Frame = 3
Query:  324 VLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLF--TLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDV------------------------------------------ESGKCVSNLQGHTAEV----ISLQFGQAHNGKH----------LITGSFDHTVILWDVHNGRRVSQ---------LIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEV 1121
            V+  H   +T   F+ N     + S D+T ++WD   GT L    L+GH   V S + + PF   + T S D T  +W+   G      +GHT  V   +F+P+S  + +G  D   ++WDV                                          + GK ++ ++GH   V     S  FG A  G            L +G  D+ V LW ++     S+         L  H +++    F+ +G  +A+AS DK++ +W+   G   L T+ GH+  V   +F   GK +A+A  D T+RLW +       F  +G    +
Sbjct:    7 VISRHTKDVTGCCFSANSRVLASCSGDKTARLWDVEKGTELAQSPLDGHNYHVNSCSVS-PFGTLMATASTDSTLMLWNLETGECLAVLEGHTGAVRVCRFSPNSQFLISGSADETFIIWDVLLKKPVRCVDKLESSVTACAFTPDGLHIITGTSEGKLAIWEAQKGKFITQVEGHDMGVGACDFSPTFGSAVPGLSDTSGSAPQFLLASGGNDNLVRLWTIYTASAFSEECHIASRCVLDQHQSQVWDCCFSPNGKILASASGDKTVILWNPLNGVA-LHTITGHSRYVTCCSFSPDGKWLATASGDRTLRLWQLTLTENGKFELRGERKRL 337          

HSP 3 Score: 96.6709 bits (239), Expect = 1.333e-21
Identity = 70/268 (26.12%), Postives = 117/268 (43.66%), Query Frame = 3
Query:  318 FKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPS----------------STLVGTGGMDTLAMLWDVESG-----------KCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAG 1040
              VL  H   +    F+ N    ++GS D T  +WD  +   +  ++  ++ V + A+  P    I+TG+ +    +W A  G      +GH   V    F+P+                  L+ +GG D L  LW + +            +CV  L  H ++V    F  + NGK L + S D TVILW+  NG  +  + GH   ++   F+ DG ++ATAS D+++++W L +     F L G    ++  T + V   + S G
Sbjct:   91 LAVLEGHTGAVRVCRFSPNSQFLISGSADETFIIWDVLLKKPVRCVDKLESSVTACAFT-PDGLHIITGTSEGKLAIWEAQKGKFITQVEGHDMGVGACDFSPTFGSAVPGLSDTSGSAPQFLLASGGNDNLVRLWTIYTASAFSEECHIASRCV--LDQHQSQVWDCCF--SPNGKILASASGDKTVILWNPLNGVALHTITGHSRYVTCCSFSPDGKWLATASGDRTLRLWQLTLTENGKFELRGERKRLVTWTVEEVCTWLESIG 353          

HSP 4 Score: 79.337 bits (194), Expect = 5.767e-16
Identity = 41/120 (34.17%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  963 FTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSK-PSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            + ++ HT +V    F    + +AS   D T RLWDV+  ++       GH   V+  + +P GT++ +AS D +   WN  TG+ + VLEGHT  +  C F+ +   +I+GS D T  IW
Sbjct:    6 YVISRHTKDVTGCCFSANSRVLASCSGDKTARLWDVEKGTELAQSPLDGHNYHVNSCSVSPFGTLMATASTDSTLMLWNLETGECLAVLEGHTGAVRVCRFSPNSQFLISGSADETFIIW 125          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Nematostella
Match: EDO37328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG41])

HSP 1 Score: 139.428 bits (350), Expect = 2.738e-38
Identity = 84/244 (34.43%), Postives = 122/244 (50.00%), Query Frame = 3
Query:  498 PFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLE 1229
            P   ++VTG  D   K+W +  G +  T + H   + CV F+    L  +   D L M+W+  +GK V  LQGHT  V +  F    NG  L +GS+D+T I+W + NG     L  H   I    F+ D   VAT S D ++++W L  G   +  L GH   V  + F      +AS   D T+RLWD K   +   +  GH   V   +F+  G +L SAS D++ R W+T+TG+ I+ LE
Sbjct:    9 PDWTRVVTGGDDDLVKIWDSKTGKVLFTLEHHDGAIKCVCFSSDGKLFASAAYDHLVMVWEAATGKQVFCLQGHTHSVETCCFSP--NGAFLCSGSWDNTAIIWSLKNGMPTYVLNKHRNVIQTCAFSHDSKTVATGSWDCTVRLWHLVEGDMAVKCLDGHKSNVHSLAFAK-NHMLASGSWDMTIRLWDSKT-GELIHLLTGHSGWVQACSFSGSGDLLASASDDQTVRVWDTSTGRCIKELE 248          

HSP 2 Score: 127.487 bits (319), Expect = 8.179e-34
Identity = 72/240 (30.00%), Postives = 124/240 (51.67%), Query Frame = 3
Query:  600 EVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            +V    F+P  T V TGG D L  +WD ++GK +  L+ H   +  + F    +GK   + ++DH V++W+   G++V  L GH   +    F+ +G ++ + S D +  IW L+ G    + L  H + +    F +  K VA+   D TVRLW + +         GH++ V  + F  +  +L S S D + R W++ TG++I +L GH+  + +C+F+  G  + + S D T R+W
Sbjct:    1 QVNTCAFSPDWTRVVTGGDDDLVKIWDSKTGKVLFTLEHHDGAIKCVCFSS--DGKLFASAAYDHLVMVWEAATGKQVFCLQGHTHSVETCCFSPNGAFLCSGSWDNTAIIWSLKNG-MPTYVLNKHRNVIQTCAFSHDSKTVATGSWDCTVRLWHLVEGDMAVKCLDGHKSNVHSLAF-AKNHMLASGSWDMTIRLWDSKTGELIHLLTGHSGWVQACSFSGSGDLLASASDDQTVRVW 236          

HSP 3 Score: 114.775 bits (286), Expect = 3.432e-29
Identity = 70/223 (31.39%), Postives = 109/223 (48.88%), Query Frame = 3
Query:  285 LKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWD-VESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMG 950
            +K+   KT  +   L  H   +  V F+ +G  F + +YD    VW+ + G  +F L+GH + V +  ++ P    + +GS+D TA +WS  +G   +    H   +    F+  S  V TG  D    LW  VE    V  L GH + V SL F + H    L +GS+D T+ LWD   G  +  L GH   + A  F+  G  +A+AS D+++++WD   G
Sbjct:   23 VKIWDSKTGKVLFTLEHHDGAIKCVCFSSDGKLFASAAYDHLVMVWEAATGKQVFCLQGHTHSVETCCFS-PNGAFLCSGSWDNTAIIWSLKNGMPTYVLNKHRNVIQTCAFSHDSKTVATGSWDCTVRLWHLVEGDMAVKCLDGHKSNVHSLAFAKNHM---LASGSWDMTIRLWDSKTGELIHLLTGHSGWVQACSFSGSGDLLASASDDQTVRVWDTSTG 241          

HSP 4 Score: 110.538 bits (275), Expect = 1.069e-27
Identity = 73/243 (30.04%), Postives = 118/243 (48.56%), Query Frame = 3
Query:  348 LTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDK--IVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNG-RRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWD 1067
            +    F+ +  R +TG  D   K+WD+  G  LFTLE H   +  + ++   SD     + ++D    +W A  G      +GHT  V    F+P+   + +G  D  A++W +++G     L  H   + +  F  +H+ K + TGS+D TV LW +  G   V  L GH + + +  F      +A+ S D +I++WD + G   +  L GH+  V   +F   G  +ASA  D TVR+WD
Sbjct:    2 VNTCAFSPDWTRVVTGGDDDLVKIWDSKTGKVLFTLEHHDGAIKCVCFS---SDGKLFASAAYDHLVMVWEAATGKQVFCLQGHTHSVETCCFSPNGAFLCSGSWDNTAIIWSLKNGMPTYVLNKHRNVIQTCAF--SHDSKTVATGSWDCTVRLWHLVEGDMAVKCLDGHKSNVHSLAFA-KNHMLASGSWDMTIRLWDSKTGEL-IHLLTGHSGWVQACSFSGSGDLLASASDDQTVRVWD 237          

HSP 5 Score: 82.4185 bits (202), Expect = 8.862e-18
Identity = 50/174 (28.74%), Postives = 86/174 (49.43%), Query Frame = 3
Query:  324 VLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSL-YHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQL 842
             L+ H   +    F+ NG    +GS+D T  +W    G   + L  H+NV+ + A++   S  + TGS+D T ++W   +G +      GH + V  + F   + ++ +G  D    LWD ++G+ +  L GH+  V +  F  + +G  L + S D TV +WD   GR + +L
Sbjct:   78 CLQGHTHSVETCCFSPNGAFLCSGSWDNTAIIWSLKNGMPTYVLNKHRNVIQTCAFSHD-SKTVATGSWDCTVRLWHLVEGDMAVKCLDGHKSNVHSLAF-AKNHMLASGSWDMTIRLWDSKTGELIHLLTGHSGWVQACSF--SGSGDLLASASDDQTVRVWDTSTGRCIKEL 247          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Medaka
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:101168478])

HSP 1 Score: 460.299 bits (1183), Expect = 6.985e-160
Identity = 220/419 (52.51%), Postives = 297/419 (70.88%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            MKL RF +RYFPPGIILEY+Q G +KTK+ DLLDLTS+T+P+E+V  I ++E L+T  R + V ELI  LQ+K     ++++ L + +  H+LPLTNV FNK+G RF+TGSYDR C+VWDT+ G  L +LEGH N+V ++A+N+P+ DKI TGSFD+T K+W A  GS  HT +GH AE+ C+ FNP STLV TG  D  A LWDV+ GK V+ L+GH+AE++SL F     G  L+TGS D T+ +WDV   R V  L GH  EIS A FN+D + + + S+D + K+W+   G R + TLA HT+EVLDV FD+ G+ VA A AD T  +++   +   + + +GHE E+SK+ F+PQG  +L+AS+DK+AR W+  TG  +Q+L GHT EIFSCAFNY+G  IITGS DNTC+IW+
Sbjct:    1 MKLLRFFIRYFPPGIILEYKQGGYIKTKSIDLLDLTSDTDPDELVVEIQQSEPLITQSRVEQVKELIHRLQQKQ--AHNRSFFLQQEVHVHLLPLTNVAFNKSGSRFITGSYDRRCRVWDTTSGQQLLSLEGHTNIVAAVAFNIPYGDKIATGSFDRTCKLWCAQTGSCLHTLRGHLAEIRCLAFNPQSTLVATGSTDASAKLWDVKRGKEVATLKGHSAEILSLCFNSV--GSQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQFNWDCSLIVSGSLDNTCKLWEAVSG-RCVATLAAHTEEVLDVCFDSTGQLVAIASADGTASVFNAATYECMARL-EGHEGEISKICFSPQGNTILTASSDKTARLWDVQTGGCLQILTGHTLEIFSCAFNYEGDTIITGSADNTCQIWR 413          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Medaka
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:101168478])

HSP 1 Score: 434.491 bits (1116), Expect = 1.072e-149
Identity = 210/406 (51.72%), Postives = 286/406 (70.44%), Query Frame = 3
Query:  105 GIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            GIILEY+Q G +KTK+ DLLDLTS+T+P+E+V  I ++E L+T  R + V ELI  LQ+K     ++++ L + +  H+LPLTNV FNK+G RF+TGSYDR C+VWDT+ G  L +LEGH N+V ++A+N+P+ DKI TGSFD+T K+W A  GS  HT +GH AE+ C+ FNP STLV TG  D  A LWDV+ GK V+ L+GH+AE++SL F     G  L+TGS D T+ +WDV   R V  L GH  EIS A FN+D + + + S+D + K+W+   G R + TLA HT+EVLDV FD+ G+ VA A AD T  +++   +   + + +GHE E+SK+ F+PQG  +L+AS+DK+AR W+  TG  +Q+L GHT EIFSCAFNY+G  IITGS DNTC+IW+
Sbjct:   21 GIILEYKQGGYIKTKSIDLLDLTSDTDPDELVVEIQQSEPLITQSRVEQVKELIHRLQQKQ--AHNRSFFLQQEVHVHLLPLTNVAFNKSGSRFITGSYDRRCRVWDTTSGQQLLSLEGHTNIVAAVAFNIPYGDKIATGSFDRTCKLWCAQTGSCLHTLRGHLAEIRCLAFNPQSTLVATGSTDASAKLWDVKRGKEVATLKGHSAEILSLCFNSV--GSQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQFNWDCSLIVSGSLDNTCKLWEAVSG-RCVATLAAHTEEVLDVCFDSTGQLVAIASADGTASVFNAATYECMARL-EGHEGEISKICFSPQGNTILTASSDKTARLWDVQTGGCLQILTGHTLEIFSCAFNYEGDTIITGSADNTCQIWR 420          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Medaka
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:101168478])

HSP 1 Score: 320.857 bits (821), Expect = 3.877e-106
Identity = 165/363 (45.45%), Postives = 225/363 (61.98%), Query Frame = 3
Query:  105 GIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTW 1193
            GIILEY+Q G +KTK+ DLLDLTS+T+P+E+V  I ++E L+T  R + V ELI  LQ+K     ++++ L +V   H+LPLTNV FNK+G RF+TGSYDR C+VWDT+ G  L +LEGH N+V ++A+N+P+ DKI TGSFD+T K+W A  GS  HT +GH AE+ C+ FNP STLV TG  D  A LWDV+ GK V+ L+GH+AE++SL F     G  L+TGS D T+ +WDV   R V  L GH  EIS A FN+D + + + S+D + KI                        F   G  + +A +D T RLWDV+       I  GH  E+    FN +G  +++ SAD + + W
Sbjct:   21 GIILEYKQGGYIKTKSIDLLDLTSDTDPDELVVEIQQSEPLITQSRVEQVKELIHRLQQKQ--AHNRSFFLQQV-HVHLLPLTNVAFNKSGSRFITGSYDRRCRVWDTTSGQQLLSLEGHTNIVAAVAFNIPYGDKIATGSFDRTCKLWCAQTGSCLHTLRGHLAEIRCLAFNPQSTLVATGSTDASAKLWDVKRGKEVATLKGHSAEILSLCFNSV--GSQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQFNWDCSLIVSGSLDNTCKI-----------------------CFSPQGNTILTASSDKTARLWDVQTGGCLQ-ILTGHTLEIFSCAFNYEGDTIITGSADNTCQIW 354          

HSP 2 Score: 198.364 bits (503), Expect = 9.403e-59
Identity = 107/264 (40.53%), Postives = 150/264 (56.82%), Query Frame = 3
Query:  591 HTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVS--------------------KVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            H   +  V FN S +   TG  D    +WD  SG+ + +L+GHT  V ++ F   + G  + TGSFD T  LW    G  +  L GH AEI    FN   T VAT S D S K+WD++ G +++ TL GH+ E+L + F++VG Q+ +  +D T+ +WDV    +   +  GH  E+S                    K+ F+PQG  +L+AS+DK+AR W+  TG  +Q+L GHT EIFSCAFNY+G  IITGS DNTC+IW+
Sbjct:   95 HLLPLTNVAFNKSGSRFITGSYDRRCRVWDTTSGQQLLSLEGHTNIVAAVAFNIPY-GDKIATGSFDRTCKLWCAQTGSCLHTLRGHLAEIRCLAFNPQSTLVATGSTDASAKLWDVKRG-KEVATLKGHSAEILSLCFNSVGSQLVTGSSDQTLAVWDVAT-ERLVHMLAGHAGEISNAQFNWDCSLIVSGSLDNTCKICFSPQGNTILTASSDKTARLWDVQTGGCLQILTGHTLEIFSCAFNYEGDTIITGSADNTCQIWR 355          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 150.214 bits (378), Expect = 7.510e-41
Identity = 96/299 (32.11%), Postives = 149/299 (49.83%), Query Frame = 3
Query:  447 FTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFN---PQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGS--KDNTCRIWQ 1322
            FTL GH   V S+ ++ P  + + + S DK  K+W A DG    T  GH   +  V ++  S L+ +   D    +WDV SGKC+  L+GH+  V    F    N   +++GSFD +V +WDV  G+ +  L  H   +SA  FN DG+ + ++S D   +IWD   G      +      V  V F   GK + +A  DNT++LWD   +SK   +  + GH+ E   +  N     G  ++S S D     WN  T +++Q L+GHTD + S A +   + I + +   D T ++W+
Sbjct:   39 FTLAGHTKAVSSVKFS-PSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSN--LIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWD---YSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          

HSP 2 Score: 147.132 bits (370), Expect = 1.036e-39
Identity = 93/306 (30.39%), Postives = 157/306 (51.31%), Query Frame = 3
Query:  309 YGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHD-AEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV----GKQVASAGADNTVRLWDV--KDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASA--DKSARTWNT 1199
            Y L   L  H   +++V F+ +G+   + S D+  K+W    G    T+ GHK  +  +A++   S+ +V+ S DKT K+W  N G    T KGH+  V C  FNP S L+ +G  D    +WDV++GKC+  L  H+  V ++ F +  +G  +++ S+D    +WD  +G+ +  LI  D   +S   F+ +G Y+  A++D ++K+WD   G + L T  GH +E   + F N     GK + S   DN V +W++  K+  +     +GH   V     +P   ++ SA+   DK+ + W +
Sbjct:   35 YSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSD-SNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNR--DGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKG-KCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQK---LQGHTDVVISTACHPTENIIASAALENDKTIKLWKS 332          

HSP 3 Score: 135.191 bits (339), Expect = 2.332e-35
Identity = 77/255 (30.20%), Postives = 125/255 (49.02%), Query Frame = 3
Query:  567 SLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYD---GSKIITGSKDNTCRIWQ 1322
            SL  T  GHT  V  V+F+PS   + +   D L  +W    GK    + GH   +  + +    N   L++ S D T+ +WDV++G+ +  L GH   +    FN     + + S D+S++IWD++ G + L TL  H+D V  V F+  G  + S+  D   R+WD         +       VS V F+P G  +L+A+ D + + W+ + GK ++   GH +E +    N+    G  I++GS+DN   IW 
Sbjct:   36 SLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN--LLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTG-KCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWN 287          

HSP 4 Score: 92.4337 bits (228), Expect = 3.111e-20
Identity = 58/186 (31.18%), Postives = 91/186 (48.92%), Query Frame = 3
Query:  270 NLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSST---LVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSF---DHTVILW 809
            +  E +++   KT    K L AH  P++ V FN++G   ++ SYD  C++WDT+ G  L TL    N   S     P    I+  + D T K+W  + G    T+ GH  E  C+  N S T    + +G  D +  +W++++ + V  LQGHT  VIS      H  +++I  +    D T+ LW
Sbjct:  148 SFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVIST---ACHPTENIIASAALENDKTIKLW 330          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Medaka
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:101167102])

HSP 1 Score: 151.369 bits (381), Expect = 3.517e-39
Identity = 90/259 (34.75%), Postives = 137/259 (52.90%), Query Frame = 3
Query:  546 MWSANDGSLY---HTFKGHTAEVVCVQFNPSS-TLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFI--FKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDN 1304
            M +AN   +Y     F+ H   V C+    S+  L+ TGG D    LW +    C+ +L GH   V  +QF  +   + +  GS   ++ +WD+   + +  L+GH A I++  F+  G ++A++SMD +IK+WD+R     +F   GHTD V  + F   GK +ASA  D TV+LWD    S+   I  FK H A V+ V F+P   +L S S+D+S R W+     +I  LEG T  I    F+ DGS + +G+ D+
Sbjct:    1 MAAANPTKIYWRLQEFEAHARPVSCLALGKSTGRLLATGGEDCRVNLWSLNKANCIMSLTGHKTAVECIQFSLSE--EQVAAGSQSGSIRVWDLEAAKILQTLMGHKASITSLGFHPYGQFLASSSMDTNIKLWDVRRKGY-VFRFKGHTDAVRSLAFSPDGKWLASASDDCTVKLWD---LSQGKIITEFKSHSAAVNIVQFHPNEYLLASGSSDRSVRLWDLEKFTMIGTLEGDTSAIRCVCFSPDGSCLFSGATDS 253          

HSP 2 Score: 124.02 bits (310), Expect = 8.019e-30
Identity = 79/262 (30.15%), Postives = 122/262 (46.56%), Query Frame = 3
Query:  444 LFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLE 1229
            L   E H   V  +A        + TG  D    +WS N  +   +  GH   V C+QF+ S   V  G       +WD+E+ K +  L GH A + SL F     G+ L + S D  + LWDV     V +  GH   + +  F+ DG ++A+AS D ++K+WDL  G + +     H+  V  V F      +AS  +D +VRLWD++ F+      +G  + +  V F+P G+ L S + D S R +     + I V+ 
Sbjct:   13 LQEFEAHARPVSCLALGKSTGRLLATGGEDCRVNLWSLNKANCIMSLTGHKTAVECIQFSLSEEQVAAGSQSGSIRVWDLEAAKILQTLMGHKASITSLGFHP--YGQFLASSSMDTNIKLWDVRRKGYVFRFKGHTDAVRSLAFSPDGKWLASASDDCTVKLWDLSQG-KIITEFKSHSAAVNIVQFHPNEYLLASGSSDRSVRLWDLEKFTMIG-TLEGDTSAIRCVCFSPDGSCLFSGATD-SLRVFGWEPDRCIDVVR 269          

HSP 3 Score: 121.324 bits (303), Expect = 6.390e-29
Identity = 75/255 (29.41%), Postives = 125/255 (49.02%), Query Frame = 3
Query:  303 KTYGLFKVLRAHILPLTNVTFNKNGDRFL-TGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLW 1064
            K Y   +   AH  P++ +   K+  R L TG  D    +W  +    + +L GHK  V  I ++L   +++  GS   + ++W      +  T  GH A +  + F+P    + +  MDT   LWDV     V   +GHT  V SL F  + +GK L + S D TV LWD+  G+ +++   H A ++   F+ +   +A+ S D+S+++WDL      + TL G T  +  V F   G  + S GA +++R++
Sbjct:    8 KIYWRLQEFEAHARPVSCLALGKSTGRLLATGGEDCRVNLWSLNKANCIMSLTGHKTAVECIQFSL-SEEQVAAGSQSGSIRVWDLEAAKILQTLMGHKASITSLGFHPYGQFLASSSMDTNIKLWDVRRKGYVFRFKGHTDAVRSLAF--SPDGKWLASASDDCTVKLWDLSQGKIITEFKSHSAAVNIVQFHPNEYLLASGSSDRSVRLWDLEKFTM-IGTLEGDTSAIRCVCFSPDGSCLFS-GATDSLRVF 257          

HSP 4 Score: 111.309 bits (277), Expect = 1.368e-25
Identity = 64/207 (30.92%), Postives = 101/207 (48.79%), Query Frame = 3
Query:  699 VSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            +   + H   V  L  G++  G+ L TG  D  V LW ++    +  L GH   +    F+     VA  S   SI++WDL   A+ L TL GH   +  + F   G+ +AS+  D  ++LWDV+      F FKGH   V  + F+P G  L SAS D + + W+ + GK+I   + H+  +    F+ +   + +GS D + R+W
Sbjct:   13 LQEFEAHARPVSCLALGKS-TGRLLATGGEDCRVNLWSLNKANCIMSLTGHKTAVECIQFSLSEEQVAAGSQSGSIRVWDLE-AAKILQTLMGHKASITSLGFHPYGQFLASSSMDTNIKLWDVRRKGY-VFRFKGHTDAVRSLAFSPDGKWLASASDDCTVKLWDLSQGKIITEFKSHSAAVNIVQFHPNEYLLASGSSDRSVRLW 216          

HSP 5 Score: 78.5666 bits (192), Expect = 4.901e-15
Identity = 47/165 (28.48%), Postives = 82/165 (49.70%), Query Frame = 3
Query:  828 RVSQLIGHDAEISA-AVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            R+ +   H   +S  A+    G  +AT   D  + +W L   A  + +L GH   V  + F    +QVA+     ++R+WD+ + +K      GH+A ++ + F+P G  L S+S D + + W+      +   +GHTD + S AF+ DG  + + S D T ++W
Sbjct:   12 RLQEFEAHARPVSCLALGKSTGRLLATGGEDCRVNLWSLNK-ANCIMSLTGHKTAVECIQFSLSEEQVAAGSQSGSIRVWDL-EAAKILQTLMGHKASITSLGFHPYGQFLASSSMDTNIKLWDVRRKGYVFRFKGHTDAVRSLAFSPDGKWLASASDDCTVKLW 174          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Planmine SMEST
Match: SMESG000008529.1 (SMESG000008529.1)

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 355/356 (99.72%), Postives = 356/356 (100.00%), Query Frame = 3
Query:   66 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVT 1133
            MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKV+
Sbjct:    1 MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMKTEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVS 356          

HSP 2 Score: 144.05 bits (362), Expect = 1.365e-38
Identity = 85/253 (33.60%), Postives = 127/253 (50.20%), Query Frame = 3
Query:  570 LYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV--GKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTG-KVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
            L+   + H   +  V FN +     TG  D    +WD   G  +  L+GH   V S+ +    + K ++TGSFD T  +W  ++G       GH AE+    FN   T V T  MD    +WD+  G + +  L GHT EV+ + F     GK + +   D+TV LWDV +  + S +  GH+AE+S   FN  GT + +AS DKS + W+   G + +  L GHTDE+    F+  G ++ +   DNT R+W
Sbjct:   84 LFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDK-IVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESG-KCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLI-GHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLW 333          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 297/297 (100.00%), Postives = 297/297 (100.00%), Query Frame = 3
Query:  432 MGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            MGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ
Sbjct:    1 MGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 297          

HSP 2 Score: 159.458 bits (402), Expect = 6.873e-45
Identity = 93/276 (33.70%), Postives = 146/276 (52.90%), Query Frame = 3
Query:  378 DRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSST---LVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRR-VSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTW 1193
            D+ +TGS+D+T K+W  + G+   T +GH   V  + +N P S  + TG  D  A +W    G      +GHTAEV+ +QF  +     L+ TG  D   +LWDV +G+ VS L GH AE+ +  F    +G ++ T S D ++ +WD+  G R +  L GH  E+    F+  G  VA+A  D ++++WD++  ++  F   GH  EV  VTF+  G  + SA AD + R W+     K   + +GH  E+    FN  G+ +++ S D + R W
Sbjct:   26 DKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFN-PSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLI-TGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFN--FDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTT-GKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 296          

HSP 3 Score: 141.739 bits (356), Expect = 2.502e-38
Identity = 85/253 (33.60%), Postives = 127/253 (50.20%), Query Frame = 3
Query:  315 LFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDK-IVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESG-KCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLI-GHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLW 1064
            L+   + H   +  V FN +     TG  D    +WD   G  +  L+GH   V S+ +    + K ++TGSFD T  +W  ++G       GH AE+    FN   T V T  MD    +WD+  G + +  L GHT EV+ + F     GK + +   D+TV LWDV +  + S +  GH+AE+S   FN  GT + +AS DKS + W+   G + +  L GHTDE+    F+  G ++ +   DNT R+W
Sbjct:   47 LYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV--GKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTG-KVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 296          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 461.84 bits (1187), Expect = 1.208e-163
Identity = 223/223 (100.00%), Postives = 223/223 (100.00%), Query Frame = 3
Query:  654 MDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
            MDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ
Sbjct:    1 MDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 223          

HSP 2 Score: 130.568 bits (327), Expect = 5.734e-35
Identity = 78/224 (34.82%), Postives = 116/224 (51.79%), Query Frame = 3
Query:  402 DRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDK-IVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESG-KCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLI-GHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLW 1064
            D    +WD   G  +  L+GH   V S+ +    + K ++TGSFD T  +W  ++G       GH AE+    FN   T V T  MD    +WD+  G + +  L GHT EV+ + F     GK + +   D+TV LWDV +  + S +  GH+AE+S   FN  GT + +AS DKS + W+   G + +  L GHTDE+    F+  G ++ +   DNT R+W
Sbjct:    2 DTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNV--GKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTG-KVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 222          

HSP 3 Score: 102.449 bits (254), Expect = 1.021e-24
Identity = 66/207 (31.88%), Postives = 101/207 (48.79%), Query Frame = 3
Query:  327 LRAHILPLTNVTFNK--NGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSL-YHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVES-GKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIW 935
            L+ H   + ++ F +  NG   +TGS+D T  +WD   G  +  L GH   + +  +N   +  + T S DK+ K+W    G+    T  GHT EV+ V F+     V + G D    LWDV+   K     +GH AEV  + F     G  L++ S D +   W+   G+ +  L GH  EI +  FN+DG+ + T S D + +IW
Sbjct:   19 LQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGT-YVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNP--QGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 222          

HSP 4 Score: 62.3882 bits (150), Expect = 7.499e-11
Identity = 28/76 (36.84%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  324 VLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMW 551
            + + H   ++ VTFN  G   L+ S D++ + W+T+ G  +  LEGH + ++S A+N   S KI+TGS D T ++W
Sbjct:  148 IFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGS-KIITGSKDNTCRIW 222          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Planmine SMEST
Match: SMESG000071691.1 (SMESG000071691.1)

HSP 1 Score: 140.198 bits (352), Expect = 1.232e-35
Identity = 92/296 (31.08%), Postives = 146/296 (49.32%), Query Frame = 3
Query:  309 YGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWN 1196
            + L   ++AH   +T +  +KN   F T S D + K+W       L T +GH N V   A++    +K+ T S D T K+W+ +     +TF+GH+  +  V ++ S+  + T   D    +WD+ S KC + L+GH+  V S+QF    N   L+T S D TV LWD         + GH   +++A  N  GT +A+      +K WD R  A  + T+        DV +D  G  VA + +D+ +++ +   F+  S +  GHE  V    F+  G  L+SASAD + R W+
Sbjct:  301 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTSDDDSWKLWSLDSLQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQF--LVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLV--GHEDSVQSAMFDHDGEFLISASADCTVRVWS 591          

HSP 2 Score: 108.997 bits (271), Expect = 4.094e-25
Identity = 68/269 (25.28%), Postives = 129/269 (47.96%), Query Frame = 3
Query:  513 IVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
              T S D + K+WS +   +  T KGHT  V C  F+     + T   DT   +W++ + +C+   +GH+  + S+ +  +     L T S D T+ +WD+++ +  + L GH   +++  F  +   + T+S DK++ +WD R+      +++GH   V     +  G  +AS  A   ++ WD +  +             + V ++  G+ +  +S+D   +   T +  V  ++ GH D + S  F++DG  +I+ S D T R+W
Sbjct:  326 FCTTSDDDSWKLWSLDSLQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTS--APFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQ-SISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLV-GHEDSVQSAMFDHDGEFLISASADCTVRVW 590          

HSP 3 Score: 87.4261 bits (215), Expect = 4.088e-18
Identity = 58/199 (29.15%), Postives = 96/199 (48.24%), Query Frame = 3
Query:  693 KCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIIT 1289
            K  + ++ H   V  ++  +  N K   T S D +  LW + + + +    GH   +S A F+ DG  +AT S D ++KIW+L   A  L+T  GH+  +  V +      +A+A  D T+++WD+    K   I +GH   V+ V F     +LL++SADK+   W+       Q + GH   + S   N  G+ I +
Sbjct:  302 KLTNTIKAHEGAVTCIRTHK--NKKVFCTTSDDDSWKLWSLDSLQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLS-AAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSL-KCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIAS 496          

HSP 4 Score: 75.0998 bits (183), Expect = 4.097e-14
Identity = 44/158 (27.85%), Postives = 81/158 (51.27%), Query Frame = 3
Query:  846 GHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 1319
             H+  ++    + +     T S D S K+W L    + L T  GHT+ V    FDN G+++A+   D T+++W++   ++  + F+GH   +  V ++     L +AS DK+ + W+  + K   +L GH+D + S  F  + + ++T S D T  +W
Sbjct:  309 AHEGAVTCIRTHKNKKVFCTTSDDDSWKLWSLD-SLQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLS-AAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLW 464          
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 138.272 bits (347), Expect = 1.434e-35
Identity = 86/291 (29.55%), Postives = 149/291 (51.20%), Query Frame = 3
Query:  453 LEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNL-QGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 1322
             +GHK+ V  + +N P S ++ +G  D    +W+    +  + F GH   ++ V+F+P+  LV +   D    LW V S K  S + + HTA V S+    + +   ++TGS D T+ +W +H  +    L  H   +    F+ DG  +A++S DK+IK+WD R     + T   H   V  + F   G  +AS G D+ V +WD++  +K    +  H + V+ V+F+P G  L+S+S D S + ++   G+++  ++GH   I   AF++ G    +G  D+   +WQ
Sbjct:   10 FKGHKDKVTCVDFN-PNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLW-VPSIKGESLVFRAHTATVRSVDI--SCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD-RHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR-MNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 294          

HSP 2 Score: 127.872 bits (320), Expect = 7.545e-32
Identity = 76/250 (30.40%), Postives = 122/250 (48.80%), Query Frame = 3
Query:  348 LTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSI---AYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKP 1088
            + +V F+  G    + S D+T ++W  S+         H   V S+     NL    ++VTGS DKT K+W  +     ++   H   V CV+F+    L+ +   D    LWD  + +C+   Q H   V SL F    NG ++ +G  D  V +WD+   + +     H + ++A  F+  G ++ ++S D S+KI+DL  G R L+T+ GH   +L   F + G+  AS GAD+ V LW     S+P
Sbjct:   59 ILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNL----EMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHP--NGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEG-RLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEP 301          

HSP 3 Score: 102.064 bits (253), Expect = 5.182e-23
Identity = 70/242 (28.93%), Postives = 116/242 (47.93%), Query Frame = 3
Query:  216 TEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDK--IVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIW 935
            T  LV    RD  +        +L VP  K   L  V RAH   + +V  + +    +TGS D+T KVW        ++L  HKN V  + ++   SD   I + S DKT K+W  ++    HTF+ H   V  + F+P+ + + +GG D+   +WD+   K + +   HT+ V ++ F  +  G  LI+ S D ++ ++D+  GR +  + GH+  I    F+  G   A+   D  + +W
Sbjct:   67 TGQLVASASRDKTV--------RLWVPSIKGESL--VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFS---SDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPS--GNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 293          
The following BLAST results are available for this feature:
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DAW11.257e-17958.47dynein assembly factor with WD repeats 1 [Source:H... [more]
DAW11.418e-13658.13dynein assembly factor with WD repeats 1 [Source:H... [more]
WDR5B4.329e-4229.94WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:1... [more]
WDR55.338e-4130.55WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12... [more]
SNRNP404.433e-4030.56small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel-104.343e-3830.98F-box/WD repeat-containing protein sel-10 [Source... [more]
sel-105.488e-3830.98F-box/WD repeat-containing protein sel-10 [Source... [more]
sel-105.488e-3830.98F-box/WD repeat-containing protein sel-10 [Source... [more]
W07E6.26.662e-3525.23pep chromosome:WBcel235:II:480722:484386:-1 gene:W... [more]
wdr-5.31.537e-3426.55WD repeat-containing protein wdr-5.3 [Source:UniP... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG75681.487e-12141.06gene:FBgn0039673 transcript:FBtr0330294[more]
CG75684.366e-12141.06gene:FBgn0039673 transcript:FBtr0330295[more]
wds4.741e-3930.77gene:FBgn0040066 transcript:FBtr0308566[more]
wds4.741e-3930.77gene:FBgn0040066 transcript:FBtr0070438[more]
Taf51.068e-3631.54gene:FBgn0010356 transcript:FBtr0088240[more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daw12.497e-17457.52dynein assembly factor with WDR repeat domains 1 [... [more]
daw12.476e-16656.59dynein assembly factor with WDR repeat domains 1 [... [more]
wdr56.970e-4132.12WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
fbxw71.940e-3832.29F-box and WD repeat domain containing 7 [Source:ZF... [more]
AL954386.12.420e-3832.29F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daw10.000e+060.14dynein assembly factor with WDR repeat domains 1 [... [more]
daw17.934e-17558.75dynein assembly factor with WDR repeat domains 1 [... [more]
daw15.097e-16856.97dynein assembly factor with WDR repeat domains 1 [... [more]
daw16.126e-16856.74dynein assembly factor with WDR repeat domains 1 [... [more]
daw19.766e-16857.49dynein assembly factor with WDR repeat domains 1 [... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Daw11.428e-17858.00dynein assembly factor with WDR repeat domains 1 [... [more]
Daw14.508e-9245.35dynein assembly factor with WDR repeat domains 1 [... [more]
Daw13.919e-8844.71dynein assembly factor with WDR repeat domains 1 [... [more]
Wdr5b2.388e-4129.17WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr53.665e-4130.55WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P2Y2|DAW1_XENTR0.000e+060.14Dynein assembly factor with WDR repeat domains 1 O... [more]
sp|Q5FWQ6|DAW1_XENLA0.000e+059.67Dynein assembly factor with WDR repeat domains 1 O... [more]
sp|Q8N136|DAW1_HUMAN6.037e-17958.47Dynein assembly factor with WDR repeat domains 1 O... [more]
sp|Q0P593|DAW1_BOVIN5.244e-17858.47Dynein assembly factor with WDR repeat domains 1 O... [more]
sp|Q5BK30|DAW1_RAT6.245e-17858.00Dynein assembly factor with WDR repeat domains 1 O... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EMF00.000e+064.68WD_REPEATS_REGION domain-containing protein OS=Mac... [more]
W5MNV10.000e+060.14Dynein assembly factor with WDR repeat domains 1 O... [more]
A0A1I8I2000.000e+063.70WD_REPEATS_REGION domain-containing protein OS=Mac... [more]
A0A1I8HZY50.000e+063.70WD_REPEATS_REGION domain-containing protein OS=Mac... [more]
G4V7M50.000e+059.67Putative wd-repeat protein OS=Schistosoma mansoni ... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daw10.000e+059.14dynein assembly factor with WD repeats 1 [Source:N... [more]
ENSAMXT00000007963.21.404e-4131.09WD repeat-containing protein 5-like [Source:NCBI g... [more]
wdr56.347e-4132.12WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
ENSAMXT00000007962.26.301e-4030.70WD repeat-containing protein 5-like [Source:NCBI g... [more]
ENSAMXT00000052579.16.301e-4030.70WD repeat-containing protein 5-like [Source:NCBI g... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008862.11.246e-3932.29pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
snrnp409.565e-3831.64small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
pafah1b1b3.914e-3727.65platelet-activating factor acetylhydrolase 1b, reg... [more]
ENSPMAT00000004902.11.082e-3632.19pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 ge... [more]
POC1A2.099e-3630.14POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RSA42.896e-3928.27WD-repeat protein involved in ribosome biogenesis;... [more]
TAF56.252e-3131.58Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
TUP14.266e-3030.42General repressor of transcription; forms complex ... [more]
CDC42.402e-2726.94F-box protein required for both the G1/S and G2/M ... [more]
MET302.325e-2528.81F-box protein containing five copies of the WD40 m... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348650.000e+059.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497675.211e-4129.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447951.772e-3931.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376146.435e-3931.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373282.738e-3834.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daw16.985e-16052.51dynein assembly factor with WD repeats 1 [Source:N... [more]
daw11.072e-14951.72dynein assembly factor with WD repeats 1 [Source:N... [more]
daw13.877e-10645.45dynein assembly factor with WD repeats 1 [Source:N... [more]
wdr57.510e-4132.11WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
katnb13.517e-3934.75katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Dynein assembly factor with WDR repeat domains 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008529.11.365e-3899.72SMESG000008529.1[more]
SMESG000008519.16.873e-45100.00SMESG000008519.1[more]
SMESG000008519.11.208e-163100.00SMESG000008519.1[more]
SMESG000071691.11.232e-3531.08SMESG000071691.1[more]
SMESG000024482.11.434e-3529.55SMESG000024482.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004518 ID=SMED30004518|Name=Dynein assembly factor with WDR repeat domains 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1454bp
GTTTAAATTTCTTATTAATTATTATCACTAGTGTAAATTAAATCTTTGGC
ACAATTTTAAGTGCAATGAAATTGAAACGTTTTTTGGTTCGTTATTTTCC
ACCTGGAATTATTCTTGAATATGAACAGCGGGGAGAAATGAAGACTAAAG
CATTTGACTTATTAGACTTAACATCAGAAACTAACCCAGAAGAAGTAGTT
GATATGATTATGAAAACTGAGCACTTGGTAACTATTAAACGTCGTGATAC
AGTGATTGAATTAATAAAAAACCTTCAAGAGAAACTAAAAGTACCAGTTG
ATAAAACTTATGGTTTATTCAAAGTTCTCAGAGCACATATTTTGCCATTA
ACAAATGTTACATTTAATAAAAATGGTGACAGATTTCTGACGGGCTCATA
TGATCGAACTTGTAAAGTTTGGGATACGTCTATGGGAACAACTCTTTTTA
CATTGGAGGGCCACAAGAATGTTGTATATTCTATTGCTTATAATTTACCA
TTTTCTGATAAAATTGTGACTGGGTCTTTTGATAAAACCGCAAAAATGTG
GTCAGCCAACGATGGGAGCCTTTATCATACCTTTAAAGGCCATACTGCTG
AAGTAGTATGTGTACAGTTCAATCCTAGCAGTACTTTAGTAGGAACAGGA
GGTATGGATACATTGGCTATGTTATGGGATGTCGAATCTGGTAAATGTGT
AAGCAACTTACAAGGTCACACAGCAGAAGTGATATCGCTACAGTTTGGCC
AAGCTCATAATGGGAAACATTTAATTACCGGTTCGTTCGATCATACAGTG
ATACTATGGGATGTTCATAATGGTCGCCGTGTTAGCCAACTAATCGGTCA
CGATGCAGAAATATCTGCTGCAGTGTTTAACTTCGATGGAACATATGTTG
CAACAGCTTCAATGGACAAATCAATTAAGATCTGGGATCTGAGAATGGGA
GCTCGAGATCTTTTCACCTTGGCTGGTCACACTGATGAAGTTCTTGATGT
GACATTTGACAATGTCGGGAAGCAGGTTGCCTCCGCTGGAGCAGACAATA
CTGTTAGGTTATGGGATGTCAAAGATTTTTCTAAGCCTTCTTTTATTTTC
AAAGGACATGAAGCAGAAGTTAGCAAAGTAACATTTAATCCGCAAGGAAC
AGTTTTATTATCAGCGAGCGCAGACAAAAGTGCCAGGACATGGAACACGA
CGACTGGTAAGGTTATCCAGGTATTAGAAGGCCATACAGACGAGATATTC
AGTTGTGCCTTCAATTACGATGGCAGTAAGATAATAACGGGATCCAAAGA
TAATACGTGTCGTATATGGCAATAATAATAATACTATTAATACTAATAAA
GCGTCTTTGTACATTAGTAATGCATTGTACTTTTATGTCTAATGTTTGTG
AATTTCGGTTTTACTAGAAATTTGAACCGTTTCTATTTTCATTTTATTTT
TGTA
back to top

protein sequence of SMED30004518-orf-1

>SMED30004518-orf-1 ID=SMED30004518-orf-1|Name=SMED30004518-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=420bp
MKLKRFLVRYFPPGIILEYEQRGEMKTKAFDLLDLTSETNPEEVVDMIMK
TEHLVTIKRRDTVIELIKNLQEKLKVPVDKTYGLFKVLRAHILPLTNVTF
NKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKI
VTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTL
AMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDV
HNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLF
TLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEA
EVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFN
YDGSKIITGSKDNTCRIWQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005929cilium
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 393..395
NoneNo IPR availablePANTHERPTHR44156:SF1DYNEIN ASSEMBLY FACTOR WITH WDR REPEAT DOMAINS 1coord: 1..395
NoneNo IPR availablePANTHERPTHR44156FAMILY NOT NAMEDcoord: 1..395
NoneNo IPR availableCDDcd00200WD40coord: 60..353
e-value: 2.27053E-82
score: 251.871
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 297..311
score: 38.4
coord: 212..226
score: 38.79
coord: 254..268
score: 38.11
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 57..96
e-value: 4.7E-7
score: 39.4
coord: 142..181
e-value: 1.8E-7
score: 40.9
coord: 356..395
e-value: 3.5E-11
score: 53.2
coord: 228..267
e-value: 1.5E-8
score: 44.4
coord: 184..225
e-value: 6.3E-8
score: 42.3
coord: 271..310
e-value: 1.1E-8
score: 44.9
coord: 314..353
e-value: 8.1E-7
score: 38.7
coord: 99..139
e-value: 3.3E-5
score: 33.3
IPR001680WD40 repeatPFAMPF00400WD40coord: 62..96
e-value: 1.8E-5
score: 25.4
coord: 185..225
e-value: 3.6E-4
score: 21.3
coord: 316..353
e-value: 7.1E-4
score: 20.3
coord: 275..310
e-value: 4.1E-5
score: 24.3
coord: 232..267
e-value: 1.8E-6
score: 28.5
coord: 358..394
e-value: 1.6E-7
score: 31.9
coord: 101..139
e-value: 7.2E-4
score: 20.3
coord: 144..181
e-value: 3.4E-5
score: 24.5
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 363..395
score: 15.655
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 64..105
score: 13.683
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 235..269
score: 14.652
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 278..312
score: 15.087
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 149..190
score: 15.02
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 321..362
score: 15.889
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 106..148
score: 12.146
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 191..234
score: 14.051
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 234..316
e-value: 4.7E-26
score: 93.8
coord: 62..147
e-value: 1.6E-25
score: 92.0
coord: 318..395
e-value: 4.8E-28
score: 100.3
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 148..233
e-value: 3.1E-26
score: 94.2
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 168..182
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 212..226
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 340..354
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 254..268
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 297..311
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 64..395
score: 85.869
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 58..150
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 121..395