Tyrosine-protein phosphatase

Overview
NameTyrosine-protein phosphatase
Smed IDSMED30004511
Length (bp)3301
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein phosphatase (SMED30004511) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase (SMED30004511) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein phosphatase (SMED30004511) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase (SMED30004511) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004511

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30004511SMESG000022143.1 dd_Smed_v4_9236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004511SMESG000022143.1 dd_Smed_v4_9236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004511SMESG000022143.1 dd_Smed_v4_9236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein phosphatase vs. Ensembl Human
Match: PTPN4 (protein tyrosine phosphatase non-receptor type 4 [Source:HGNC Symbol;Acc:HGNC:9656])

HSP 1 Score: 405.216 bits (1040), Expect = 2.663e-124
Identity = 199/426 (46.71%), Postives = 278/426 (65.26%), Query Frame = 1
Query: 1912 YDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDG--GFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            +DN ++I+++ D N R+GF V+   ++K P+I++ +   TPAD+C PRLN GDQ++ ING ++   T D+V+  IK S E   G+++L VRPN    +VE       D+ + I E                        +ES+  L   +    +L QF+ +YRKKPG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I  + +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP+   +  +G +Q++C    +SE+G   +  R + ++     E R +  +QYI+WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC IE  +P+  +DI++TMRDQRA MIQTP+Q++FVCEAI+KVY++  ++ L
Sbjct:  512 HDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPNAVYDVVEEKLENEPDFQY-IPEKAPLDSVHQDDHS----------LRESMIQLAEGLITGTVLTQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTC----HSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPL 920          

HSP 2 Score: 207.994 bits (528), Expect = 1.285e-54
Identity = 135/373 (36.19%), Postives = 205/373 (54.96%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPS 1236
            G +Y V A E  +     ++ C ++LLD  V+ F + K   G  LLD++F  L+L E+D+FGLQ  D    S    +WL+  K I+KQL    PY  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L S+A+Q+ELGDY+  ++ SGY+S++ F+ NQ    E +I+ LH +    SP +AE  YLN A  L+ YGV+   A       + IG  S G  ++KN+ RM+ F W          K + I  K   F  Q +  +E ++S   +  + + +   CK LW+ CV++HTFFR+  P P      A+  + GS F        +CGR  + +++   K     DR F R+PS
Sbjct:   10 GRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDVVFKHLDLTEQDYFGLQLADD---STDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLPCPSNTAALLASFAVQSELGDYDQSENLSGYLSDYSFIPNQPQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGGILIYKNRVRMNTFPW---------LKIVKISFKCKQFFIQLR--KELHESRETLLGFNMVNYRACKNLWKACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKF-------RYCGRTEVQSVQ-YGKEKANKDRVFARSPS 360          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Human
Match: PTPN3 (protein tyrosine phosphatase non-receptor type 3 [Source:HGNC Symbol;Acc:HGNC:9655])

HSP 1 Score: 358.992 bits (920), Expect = 4.050e-109
Identity = 179/418 (42.82%), Postives = 262/418 (62.68%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            ++I++  D + ++GF ++   ++K P++++ I   +PAD C P+LN GDQ++ ING ++   T D+V+  IK S ES   ++ L +R          V S    F+  ++  E       +   +     D  + S+  L+  +E+  +L QFE +YRKKPGL +  AK  +N  KNRY+D+ PYD TRV+L+  G+ DYINAS +NM+I    ++NKYIA QGPL  T   FWQ+ W+Q   LIVMLT L+E+GR KCH+YWP   + +  G F I C  E+ +    +  R+++V  T + EE  V H+QY++WPDHGVP    +F+ FV  VR  R    EP++VHCSAGIGRTGVL+TMETAMC  E   PI  +DI++ MRDQRA M+QT +Q+KFVCEAI++VY++  ++ L
Sbjct:  333 VLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRR-------AVRS----FADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQ--GNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTI--AYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDS-EPVLVHCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQML 734          

HSP 2 Score: 98.5969 bits (244), Expect = 2.451e-20
Identity = 64/190 (33.68%), Postives = 102/190 (53.68%), Query Frame = 1
Query:  499 DIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVK 1068
            DI + RL C  +   +L SYA+Q+  GDYN   H  GY+S+  F+ +Q      K+  LH +      ++AE  Y+NIA  LD+YGV++ +   L    + IG +S G +V++       + W +I KISFK+KK         F+ Q +   ES +    +  + + +   CK LW++CV++HTFF+ K
Sbjct:    2 DICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICTSFYPWVNILKISFKRKKF--------FIHQRQKQAESREH---IVAFNMLNYRSCKNLWKSCVEHHTFFQAK 180          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Human
Match: PTPN3 (protein tyrosine phosphatase non-receptor type 3 [Source:HGNC Symbol;Acc:HGNC:9655])

HSP 1 Score: 358.992 bits (920), Expect = 1.199e-108
Identity = 179/418 (42.82%), Postives = 262/418 (62.68%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            ++I++  D + ++GF ++   ++K P++++ I   +PAD C P+LN GDQ++ ING ++   T D+V+  IK S ES   ++ L +R          V S    F+  ++  E       +   +     D  + S+  L+  +E+  +L QFE +YRKKPGL +  AK  +N  KNRY+D+ PYD TRV+L+  G+ DYINAS +NM+I    ++NKYIA QGPL  T   FWQ+ W+Q   LIVMLT L+E+GR KCH+YWP   + +  G F I C  E+ +    +  R+++V  T + EE  V H+QY++WPDHGVP    +F+ FV  VR  R    EP++VHCSAGIGRTGVL+TMETAMC  E   PI  +DI++ MRDQRA M+QT +Q+KFVCEAI++VY++  ++ L
Sbjct:  378 VLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRR-------AVRS----FADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQ--GNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTI--AYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDS-EPVLVHCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQML 779          

HSP 2 Score: 100.138 bits (248), Expect = 1.062e-20
Identity = 69/222 (31.08%), Postives = 114/222 (51.35%), Query Frame = 1
Query:  499 DIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRV-KVPPNNSQIKANTKSKGSNFFGISITPAFCGR 1161
            DI + RL C  +   +L SYA+Q+  GDYN   H  GY+S+  F+ +Q      K+  LH +      ++AE  Y+NIA  LD+YGV++ +   L    + IG +S G +V++       + W +I KISFK+KK         F+ Q +   ES +    +  + + +   CK LW++CV++HTFF+  K+ P    + +   + GS     S+   +C +
Sbjct:    2 DICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICTSFYPWVNILKISFKRKKF--------FIHQRQKQAESREH---IVAFNMLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKK 212          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Human
Match: PTPN3 (protein tyrosine phosphatase non-receptor type 3 [Source:HGNC Symbol;Acc:HGNC:9655])

HSP 1 Score: 358.607 bits (919), Expect = 2.923e-107
Identity = 179/418 (42.82%), Postives = 262/418 (62.68%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            ++I++  D + ++GF ++   ++K P++++ I   +PAD C P+LN GDQ++ ING ++   T D+V+  IK S ES   ++ L +R          V S    F+  ++  E       +   +     D  + S+  L+  +E+  +L QFE +YRKKPGL +  AK  +N  KNRY+D+ PYD TRV+L+  G+ DYINAS +NM+I    ++NKYIA QGPL  T   FWQ+ W+Q   LIVMLT L+E+GR KCH+YWP   + +  G F I C  E+ +    +  R+++V  T + EE  V H+QY++WPDHGVP    +F+ FV  VR  R    EP++VHCSAGIGRTGVL+TMETAMC  E   PI  +DI++ MRDQRA M+QT +Q+KFVCEAI++VY++  ++ L
Sbjct:  509 VLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRR-------AVRS----FADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQ--GNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTI--AYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDS-EPVLVHCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQML 910          

HSP 2 Score: 176.407 bits (446), Expect = 1.819e-44
Identity = 118/353 (33.43%), Postives = 192/353 (54.39%), Query Frame = 1
Query:  109 LKMLGGSYY-VAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRV-KVPPNNSQIKANTKSKGSNFFGISITPAFCGR 1161
            L+ LGG    +   E  K    +++ C +  LDG V+ F + K+  G  LLD++ + L + E+++FGLQ+ D    S +   WL  +K+I+KQL G  P   HFRV+F+  +P+ +++E TR+L FLQLK DI + RL C  +   +L SYA+Q+  GDYN   H  GY+S+  F+ +Q      K+  LH +      ++AE  Y+NIA  LD+YGV++ +   L    + IG +S G +V++       + W +I KISFK+KK         F+ Q +   ES +    +  + + +   CK LW++CV++HTFF+  K+ P    + +   + GS     S+   +C +
Sbjct:    5 LRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHNHLGVTEKEYFGLQHDDDSVDSPR---WLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQEQTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICTSFYPWVNILKISFKRKKF--------FIHQRQKQAESREH---IVAFNMLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKK 343          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Human
Match: PTPN4 (protein tyrosine phosphatase non-receptor type 4 [Source:HGNC Symbol;Acc:HGNC:9656])

HSP 1 Score: 230.335 bits (586), Expect = 1.692e-68
Identity = 109/215 (50.70%), Postives = 149/215 (69.30%), Query Frame = 1
Query: 2566 MINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDG--GFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTP---------AQFKFVCEAIIKVYKDSDIRAL 3177
            +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP+   +  +G +Q++C    +SE+G   +  R + ++     E R +  +QYI+WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC IE  +P+  +DI++TMRDQRA MIQTP         +Q++FVCEAI+KVY++  ++ L
Sbjct:    3 IINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTC----HSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPFCFLYFIFQSQYRFVCEAILKVYEEGFVKPL 213          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Celegans
Match: ptp-1 (Tyrosine-protein phosphatase 1 [Source:UniProtKB/Swiss-Prot;Acc:P28191])

HSP 1 Score: 396.741 bits (1018), Expect = 1.520e-125
Identity = 190/423 (44.92%), Postives = 276/423 (65.25%), Query Frame = 1
Query: 1915 DNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGC--GDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            D  + IK+R DR+ R+GF V+  +++  P+I++ +   + AD C PRLN GDQ++ I+G +V  ++ D V+  I+ S+ SG   G++ L +RPN Y +     E  + D ++             ++      N D   +SL+ L +S+ +  ++  FE +YRKKPG++M   + T N +KNRYRD+ PYD TRV L+ + S DYINA+ +NM+I  +G++N+YIA QGPL  TS DFW M WEQ+   IVMLT ++E+GR KCH+YWP+++ET E+G   I C+ ++ + +  +  R+  +    S EERRV  MQYI+WPDHGVP     FI FV +VRK R G  +PIVVHCSAGIGRTGVLI META C +E+ +P+  +DI++TMRDQRA +IQTP Q+ FVCE+I++ Y D  I+ L
Sbjct:  176 DQVVTIKMRPDRHGRFGFNVKGGADQNYPVIVSRVAPGSSADKCQPRLNEGDQVLFIDGRDVSTMSHDHVVQFIR-SARSGLNGGELHLTIRPNVYRL---GEEVDEPDSTMVPE---------PARVADSVPNSDKLSKSLQLLADSLNSGKVVDHFEMLYRKKPGMSMNICRLTANLAKNRYRDVCPYDDTRVTLQASPSGDYINANYVNMEIPSSGIVNRYIACQGPLAHTSSDFWVMVWEQHCTTIVMLTTITERGRVKCHQYWPRVFETQEYGRLMIKCIKDKQTTNCCY--REFSIRDRNSSEERRVTQMQYIAWPDHGVPDDPKHFIQFVDEVRKARQGSVDPIVVHCSAGIGRTGVLILMETAACLVESNEPVYPLDIVRTMRDQRAMLIQTPGQYTFVCESILRAYHDGTIKPL 583          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Celegans
Match: ptp-1 (Tyrosine-protein phosphatase 1 [Source:UniProtKB/Swiss-Prot;Acc:P28191])

HSP 1 Score: 396.741 bits (1018), Expect = 1.520e-125
Identity = 190/423 (44.92%), Postives = 276/423 (65.25%), Query Frame = 1
Query: 1915 DNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGC--GDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            D  + IK+R DR+ R+GF V+  +++  P+I++ +   + AD C PRLN GDQ++ I+G +V  ++ D V+  I+ S+ SG   G++ L +RPN Y +     E  + D ++             ++      N D   +SL+ L +S+ +  ++  FE +YRKKPG++M   + T N +KNRYRD+ PYD TRV L+ + S DYINA+ +NM+I  +G++N+YIA QGPL  TS DFW M WEQ+   IVMLT ++E+GR KCH+YWP+++ET E+G   I C+ ++ + +  +  R+  +    S EERRV  MQYI+WPDHGVP     FI FV +VRK R G  +PIVVHCSAGIGRTGVLI META C +E+ +P+  +DI++TMRDQRA +IQTP Q+ FVCE+I++ Y D  I+ L
Sbjct:  176 DQVVTIKMRPDRHGRFGFNVKGGADQNYPVIVSRVAPGSSADKCQPRLNEGDQVLFIDGRDVSTMSHDHVVQFIR-SARSGLNGGELHLTIRPNVYRL---GEEVDEPDSTMVPE---------PARVADSVPNSDKLSKSLQLLADSLNSGKVVDHFEMLYRKKPGMSMNICRLTANLAKNRYRDVCPYDDTRVTLQASPSGDYINANYVNMEIPSSGIVNRYIACQGPLAHTSSDFWVMVWEQHCTTIVMLTTITERGRVKCHQYWPRVFETQEYGRLMIKCIKDKQTTNCCY--REFSIRDRNSSEERRVTQMQYIAWPDHGVPDDPKHFIQFVDEVRKARQGSVDPIVVHCSAGIGRTGVLILMETAACLVESNEPVYPLDIVRTMRDQRAMLIQTPGQYTFVCESILRAYHDGTIKPL 583          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Celegans
Match: ptp-1 (Tyrosine-protein phosphatase 1 [Source:UniProtKB/Swiss-Prot;Acc:P28191])

HSP 1 Score: 396.741 bits (1018), Expect = 1.520e-125
Identity = 190/423 (44.92%), Postives = 276/423 (65.25%), Query Frame = 1
Query: 1915 DNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGC--GDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            D  + IK+R DR+ R+GF V+  +++  P+I++ +   + AD C PRLN GDQ++ I+G +V  ++ D V+  I+ S+ SG   G++ L +RPN Y +     E  + D ++             ++      N D   +SL+ L +S+ +  ++  FE +YRKKPG++M   + T N +KNRYRD+ PYD TRV L+ + S DYINA+ +NM+I  +G++N+YIA QGPL  TS DFW M WEQ+   IVMLT ++E+GR KCH+YWP+++ET E+G   I C+ ++ + +  +  R+  +    S EERRV  MQYI+WPDHGVP     FI FV +VRK R G  +PIVVHCSAGIGRTGVLI META C +E+ +P+  +DI++TMRDQRA +IQTP Q+ FVCE+I++ Y D  I+ L
Sbjct:  176 DQVVTIKMRPDRHGRFGFNVKGGADQNYPVIVSRVAPGSSADKCQPRLNEGDQVLFIDGRDVSTMSHDHVVQFIR-SARSGLNGGELHLTIRPNVYRL---GEEVDEPDSTMVPE---------PARVADSVPNSDKLSKSLQLLADSLNSGKVVDHFEMLYRKKPGMSMNICRLTANLAKNRYRDVCPYDDTRVTLQASPSGDYINANYVNMEIPSSGIVNRYIACQGPLAHTSSDFWVMVWEQHCTTIVMLTTITERGRVKCHQYWPRVFETQEYGRLMIKCIKDKQTTNCCY--REFSIRDRNSSEERRVTQMQYIAWPDHGVPDDPKHFIQFVDEVRKARQGSVDPIVVHCSAGIGRTGVLILMETAACLVESNEPVYPLDIVRTMRDQRAMLIQTPGQYTFVCESILRAYHDGTIKPL 583          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Celegans
Match: ptp-1 (Tyrosine-protein phosphatase 1 [Source:UniProtKB/Swiss-Prot;Acc:P28191])

HSP 1 Score: 396.356 bits (1017), Expect = 7.117e-125
Identity = 190/423 (44.92%), Postives = 276/423 (65.25%), Query Frame = 1
Query: 1915 DNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGC--GDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            D  + IK+R DR+ R+GF V+  +++  P+I++ +   + AD C PRLN GDQ++ I+G +V  ++ D V+  I+ S+ SG   G++ L +RPN Y +     E  + D ++             ++      N D   +SL+ L +S+ +  ++  FE +YRKKPG++M   + T N +KNRYRD+ PYD TRV L+ + S DYINA+ +NM+I  +G++N+YIA QGPL  TS DFW M WEQ+   IVMLT ++E+GR KCH+YWP+++ET E+G   I C+ ++ + +  +  R+  +    S EERRV  MQYI+WPDHGVP     FI FV +VRK R G  +PIVVHCSAGIGRTGVLI META C +E+ +P+  +DI++TMRDQRA +IQTP Q+ FVCE+I++ Y D  I+ L
Sbjct:  211 DQVVTIKMRPDRHGRFGFNVKGGADQNYPVIVSRVAPGSSADKCQPRLNEGDQVLFIDGRDVSTMSHDHVVQFIR-SARSGLNGGELHLTIRPNVYRL---GEEVDEPDSTMVPE---------PARVADSVPNSDKLSKSLQLLADSLNSGKVVDHFEMLYRKKPGMSMNICRLTANLAKNRYRDVCPYDDTRVTLQASPSGDYINANYVNMEIPSSGIVNRYIACQGPLAHTSSDFWVMVWEQHCTTIVMLTTITERGRVKCHQYWPRVFETQEYGRLMIKCIKDKQTTNCCY--REFSIRDRNSSEERRVTQMQYIAWPDHGVPDDPKHFIQFVDEVRKARQGSVDPIVVHCSAGIGRTGVLILMETAACLVESNEPVYPLDIVRTMRDQRAMLIQTPGQYTFVCESILRAYHDGTIKPL 618          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Celegans
Match: ptp-1 (Tyrosine-protein phosphatase 1 [Source:UniProtKB/Swiss-Prot;Acc:P28191])

HSP 1 Score: 396.356 bits (1017), Expect = 7.117e-125
Identity = 190/423 (44.92%), Postives = 276/423 (65.25%), Query Frame = 1
Query: 1915 DNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGC--GDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            D  + IK+R DR+ R+GF V+  +++  P+I++ +   + AD C PRLN GDQ++ I+G +V  ++ D V+  I+ S+ SG   G++ L +RPN Y +     E  + D ++             ++      N D   +SL+ L +S+ +  ++  FE +YRKKPG++M   + T N +KNRYRD+ PYD TRV L+ + S DYINA+ +NM+I  +G++N+YIA QGPL  TS DFW M WEQ+   IVMLT ++E+GR KCH+YWP+++ET E+G   I C+ ++ + +  +  R+  +    S EERRV  MQYI+WPDHGVP     FI FV +VRK R G  +PIVVHCSAGIGRTGVLI META C +E+ +P+  +DI++TMRDQRA +IQTP Q+ FVCE+I++ Y D  I+ L
Sbjct:  211 DQVVTIKMRPDRHGRFGFNVKGGADQNYPVIVSRVAPGSSADKCQPRLNEGDQVLFIDGRDVSTMSHDHVVQFIR-SARSGLNGGELHLTIRPNVYRL---GEEVDEPDSTMVPE---------PARVADSVPNSDKLSKSLQLLADSLNSGKVVDHFEMLYRKKPGMSMNICRLTANLAKNRYRDVCPYDDTRVTLQASPSGDYINANYVNMEIPSSGIVNRYIACQGPLAHTSSDFWVMVWEQHCTTIVMLTTITERGRVKCHQYWPRVFETQEYGRLMIKCIKDKQTTNCCY--REFSIRDRNSSEERRVTQMQYIAWPDHGVPDDPKHFIQFVDEVRKARQGSVDPIVVHCSAGIGRTGVLILMETAACLVESNEPVYPLDIVRTMRDQRAMLIQTPGQYTFVCESILRAYHDGTIKPL 618          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Fly
Match: Ptpmeg (gene:FBgn0261985 transcript:FBtr0306563)

HSP 1 Score: 249.595 bits (636), Expect = 1.927e-68
Identity = 129/353 (36.54%), Postives = 199/353 (56.37%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPN-------------NYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGD-FQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFR 2940
            + I+L+ D   RYGF V+   +   P+ ++ +  +TPAD C PR+  GD+++ ING +V  L  ++V+++I++      G+++L VRP               Y+ E + + S     S   +G                     F +SL  L + + +  +L Q+E +YRK P L + EA+K  N  KNRYRDISPYD TRV L N+ + DYINA+ +NM+I   G +N+YIA QGPL  T+ DFW+M  +++++L+VMLT + E GR KCH+YWP   E ++  + F + CL E+  E G F  R+ ++      E+R + HMQY++WPDH VP+    F+ F  +VR  R
Sbjct:  503 ITIRLQADEQGRYGFNVKGGVDLSLPVQVSKVVPHTPADRCTPRVCEGDEVLMINGRDVHGLRHEQVVAMIRDCRHQASGELLLTVRPQRSAPLLLEEEPLYQYVPESDEIGS----HSNLLDGDAL------------------FTQSLLLLSDGLASGALLAQYELMYRKNPDLAITEARKPANAPKNRYRDISPYDCTRVSLVNSLTGDYINANYVNMEI-PGGAVNRYIATQGPLASTTTDFWRMVQQESSHLLVMLTTVMESGRQKCHQYWPVTGEELQLAEGFSVRCLSEKPDETGSFVFREFVLKD--KHEQRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAAR 830          

HSP 2 Score: 172.17 bits (435), Expect = 2.202e-43
Identity = 121/364 (33.24%), Postives = 199/364 (54.67%), Query Frame = 1
Query:  190 VVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQ-----LTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAF--CGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLS 1260
            V+ LD     F ++K++ G  LLD +F  LEL ERD+FGL +       G   +W++  K  KKQ     L      +  FRVKF+ ++PS+++EE+TRY  +LQ+K++I   +L C+ +   +L SY +Q+ELGD+N  +H+ GY+S  + + +QT   E K+ +LH   +   P  AE  YL  A  L+ YG+D+  A   + + +Q+G S++G  VF++  R++ F WS + K+SFK+K          F  Q +     N  +  +  + +SS    K LW++CV++H+FFR+K P            + S F  IS+   F   GR  +  +++ ++R R   + F+R+PS   K+LL 
Sbjct:   38 VLFLDDITHTFRIEKRAKGSELLDQVFQYLELSERDYFGLLFPQK---PGDVVRWVDAQKQFKKQCSSVSLDNDAVPLLEFRVKFFVSDPSRLQEEFTRYQFYLQIKRNILLGKLPCSSNTQCLLASYTVQSELGDFNALEHQPGYLSGMQLLCDQTTEAERKVGELHKLHRGQLPADAEYNYLEHAKRLELYGIDLHRATDSNGKELQLGVSAVGLLVFQHSLRVNTFSWSKMVKVSFKRKD---------FFIQLRREPSENYDT--LLGFGMSSHKHAKALWKSCVEHHSFFRLKRP-----------HRLSRFLNISLGSKFYYSGRTELQAVQESKQRGR-IHKVFVRSPS---KRLLG 372          

HSP 3 Score: 98.9821 bits (245), Expect = 1.249e-20
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 1
Query: 2956 PIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVY 3153
            P++VHCSAGIGRTGVLI M+TA+  +EAR+P+  +DI++TMRDQRA M+Q  +Q++FVCE I   Y
Sbjct:  894 PVIVHCSAGIGRTGVLILMDTALALMEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICAAY 959          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Fly
Match: Ptpmeg (gene:FBgn0261985 transcript:FBtr0306559)

HSP 1 Score: 249.595 bits (636), Expect = 1.927e-68
Identity = 129/353 (36.54%), Postives = 199/353 (56.37%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPN-------------NYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGD-FQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFR 2940
            + I+L+ D   RYGF V+   +   P+ ++ +  +TPAD C PR+  GD+++ ING +V  L  ++V+++I++      G+++L VRP               Y+ E + + S     S   +G                     F +SL  L + + +  +L Q+E +YRK P L + EA+K  N  KNRYRDISPYD TRV L N+ + DYINA+ +NM+I   G +N+YIA QGPL  T+ DFW+M  +++++L+VMLT + E GR KCH+YWP   E ++  + F + CL E+  E G F  R+ ++      E+R + HMQY++WPDH VP+    F+ F  +VR  R
Sbjct:  503 ITIRLQADEQGRYGFNVKGGVDLSLPVQVSKVVPHTPADRCTPRVCEGDEVLMINGRDVHGLRHEQVVAMIRDCRHQASGELLLTVRPQRSAPLLLEEEPLYQYVPESDEIGS----HSNLLDGDAL------------------FTQSLLLLSDGLASGALLAQYELMYRKNPDLAITEARKPANAPKNRYRDISPYDCTRVSLVNSLTGDYINANYVNMEI-PGGAVNRYIATQGPLASTTTDFWRMVQQESSHLLVMLTTVMESGRQKCHQYWPVTGEELQLAEGFSVRCLSEKPDETGSFVFREFVLKD--KHEQRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAAR 830          

HSP 2 Score: 172.17 bits (435), Expect = 2.202e-43
Identity = 121/364 (33.24%), Postives = 199/364 (54.67%), Query Frame = 1
Query:  190 VVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQ-----LTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAF--CGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLS 1260
            V+ LD     F ++K++ G  LLD +F  LEL ERD+FGL +       G   +W++  K  KKQ     L      +  FRVKF+ ++PS+++EE+TRY  +LQ+K++I   +L C+ +   +L SY +Q+ELGD+N  +H+ GY+S  + + +QT   E K+ +LH   +   P  AE  YL  A  L+ YG+D+  A   + + +Q+G S++G  VF++  R++ F WS + K+SFK+K          F  Q +     N  +  +  + +SS    K LW++CV++H+FFR+K P            + S F  IS+   F   GR  +  +++ ++R R   + F+R+PS   K+LL 
Sbjct:   38 VLFLDDITHTFRIEKRAKGSELLDQVFQYLELSERDYFGLLFPQK---PGDVVRWVDAQKQFKKQCSSVSLDNDAVPLLEFRVKFFVSDPSRLQEEFTRYQFYLQIKRNILLGKLPCSSNTQCLLASYTVQSELGDFNALEHQPGYLSGMQLLCDQTTEAERKVGELHKLHRGQLPADAEYNYLEHAKRLELYGIDLHRATDSNGKELQLGVSAVGLLVFQHSLRVNTFSWSKMVKVSFKRKD---------FFIQLRREPSENYDT--LLGFGMSSHKHAKALWKSCVEHHSFFRLKRP-----------HRLSRFLNISLGSKFYYSGRTELQAVQESKQRGR-IHKVFVRSPS---KRLLG 372          

HSP 3 Score: 98.9821 bits (245), Expect = 1.249e-20
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 1
Query: 2956 PIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVY 3153
            P++VHCSAGIGRTGVLI M+TA+  +EAR+P+  +DI++TMRDQRA M+Q  +Q++FVCE I   Y
Sbjct:  894 PVIVHCSAGIGRTGVLILMDTALALMEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICAAY 959          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Fly
Match: Ptpmeg (gene:FBgn0261985 transcript:FBtr0306560)

HSP 1 Score: 249.595 bits (636), Expect = 1.927e-68
Identity = 129/353 (36.54%), Postives = 199/353 (56.37%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPN-------------NYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGD-FQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFR 2940
            + I+L+ D   RYGF V+   +   P+ ++ +  +TPAD C PR+  GD+++ ING +V  L  ++V+++I++      G+++L VRP               Y+ E + + S     S   +G                     F +SL  L + + +  +L Q+E +YRK P L + EA+K  N  KNRYRDISPYD TRV L N+ + DYINA+ +NM+I   G +N+YIA QGPL  T+ DFW+M  +++++L+VMLT + E GR KCH+YWP   E ++  + F + CL E+  E G F  R+ ++      E+R + HMQY++WPDH VP+    F+ F  +VR  R
Sbjct:  503 ITIRLQADEQGRYGFNVKGGVDLSLPVQVSKVVPHTPADRCTPRVCEGDEVLMINGRDVHGLRHEQVVAMIRDCRHQASGELLLTVRPQRSAPLLLEEEPLYQYVPESDEIGS----HSNLLDGDAL------------------FTQSLLLLSDGLASGALLAQYELMYRKNPDLAITEARKPANAPKNRYRDISPYDCTRVSLVNSLTGDYINANYVNMEI-PGGAVNRYIATQGPLASTTTDFWRMVQQESSHLLVMLTTVMESGRQKCHQYWPVTGEELQLAEGFSVRCLSEKPDETGSFVFREFVLKD--KHEQRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAAR 830          

HSP 2 Score: 172.17 bits (435), Expect = 2.202e-43
Identity = 121/364 (33.24%), Postives = 199/364 (54.67%), Query Frame = 1
Query:  190 VVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQ-----LTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAF--CGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLS 1260
            V+ LD     F ++K++ G  LLD +F  LEL ERD+FGL +       G   +W++  K  KKQ     L      +  FRVKF+ ++PS+++EE+TRY  +LQ+K++I   +L C+ +   +L SY +Q+ELGD+N  +H+ GY+S  + + +QT   E K+ +LH   +   P  AE  YL  A  L+ YG+D+  A   + + +Q+G S++G  VF++  R++ F WS + K+SFK+K          F  Q +     N  +  +  + +SS    K LW++CV++H+FFR+K P            + S F  IS+   F   GR  +  +++ ++R R   + F+R+PS   K+LL 
Sbjct:   38 VLFLDDITHTFRIEKRAKGSELLDQVFQYLELSERDYFGLLFPQK---PGDVVRWVDAQKQFKKQCSSVSLDNDAVPLLEFRVKFFVSDPSRLQEEFTRYQFYLQIKRNILLGKLPCSSNTQCLLASYTVQSELGDFNALEHQPGYLSGMQLLCDQTTEAERKVGELHKLHRGQLPADAEYNYLEHAKRLELYGIDLHRATDSNGKELQLGVSAVGLLVFQHSLRVNTFSWSKMVKVSFKRKD---------FFIQLRREPSENYDT--LLGFGMSSHKHAKALWKSCVEHHSFFRLKRP-----------HRLSRFLNISLGSKFYYSGRTELQAVQESKQRGR-IHKVFVRSPS---KRLLG 372          

HSP 3 Score: 98.9821 bits (245), Expect = 1.249e-20
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 1
Query: 2956 PIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVY 3153
            P++VHCSAGIGRTGVLI M+TA+  +EAR+P+  +DI++TMRDQRA M+Q  +Q++FVCE I   Y
Sbjct:  894 PVIVHCSAGIGRTGVLILMDTALALMEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICAAY 959          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Fly
Match: Ptpmeg (gene:FBgn0261985 transcript:FBtr0306561)

HSP 1 Score: 249.595 bits (636), Expect = 1.927e-68
Identity = 129/353 (36.54%), Postives = 199/353 (56.37%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPN-------------NYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGD-FQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFR 2940
            + I+L+ D   RYGF V+   +   P+ ++ +  +TPAD C PR+  GD+++ ING +V  L  ++V+++I++      G+++L VRP               Y+ E + + S     S   +G                     F +SL  L + + +  +L Q+E +YRK P L + EA+K  N  KNRYRDISPYD TRV L N+ + DYINA+ +NM+I   G +N+YIA QGPL  T+ DFW+M  +++++L+VMLT + E GR KCH+YWP   E ++  + F + CL E+  E G F  R+ ++      E+R + HMQY++WPDH VP+    F+ F  +VR  R
Sbjct:  503 ITIRLQADEQGRYGFNVKGGVDLSLPVQVSKVVPHTPADRCTPRVCEGDEVLMINGRDVHGLRHEQVVAMIRDCRHQASGELLLTVRPQRSAPLLLEEEPLYQYVPESDEIGS----HSNLLDGDAL------------------FTQSLLLLSDGLASGALLAQYELMYRKNPDLAITEARKPANAPKNRYRDISPYDCTRVSLVNSLTGDYINANYVNMEI-PGGAVNRYIATQGPLASTTTDFWRMVQQESSHLLVMLTTVMESGRQKCHQYWPVTGEELQLAEGFSVRCLSEKPDETGSFVFREFVLKD--KHEQRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAAR 830          

HSP 2 Score: 172.17 bits (435), Expect = 2.202e-43
Identity = 121/364 (33.24%), Postives = 199/364 (54.67%), Query Frame = 1
Query:  190 VVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQ-----LTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAF--CGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLS 1260
            V+ LD     F ++K++ G  LLD +F  LEL ERD+FGL +       G   +W++  K  KKQ     L      +  FRVKF+ ++PS+++EE+TRY  +LQ+K++I   +L C+ +   +L SY +Q+ELGD+N  +H+ GY+S  + + +QT   E K+ +LH   +   P  AE  YL  A  L+ YG+D+  A   + + +Q+G S++G  VF++  R++ F WS + K+SFK+K          F  Q +     N  +  +  + +SS    K LW++CV++H+FFR+K P            + S F  IS+   F   GR  +  +++ ++R R   + F+R+PS   K+LL 
Sbjct:   38 VLFLDDITHTFRIEKRAKGSELLDQVFQYLELSERDYFGLLFPQK---PGDVVRWVDAQKQFKKQCSSVSLDNDAVPLLEFRVKFFVSDPSRLQEEFTRYQFYLQIKRNILLGKLPCSSNTQCLLASYTVQSELGDFNALEHQPGYLSGMQLLCDQTTEAERKVGELHKLHRGQLPADAEYNYLEHAKRLELYGIDLHRATDSNGKELQLGVSAVGLLVFQHSLRVNTFSWSKMVKVSFKRKD---------FFIQLRREPSENYDT--LLGFGMSSHKHAKALWKSCVEHHSFFRLKRP-----------HRLSRFLNISLGSKFYYSGRTELQAVQESKQRGR-IHKVFVRSPS---KRLLG 372          

HSP 3 Score: 98.9821 bits (245), Expect = 1.249e-20
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 1
Query: 2956 PIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVY 3153
            P++VHCSAGIGRTGVLI M+TA+  +EAR+P+  +DI++TMRDQRA M+Q  +Q++FVCE I   Y
Sbjct:  894 PVIVHCSAGIGRTGVLILMDTALALMEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICAAY 959          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Fly
Match: Ptpmeg (gene:FBgn0261985 transcript:FBtr0306562)

HSP 1 Score: 249.595 bits (636), Expect = 1.927e-68
Identity = 129/353 (36.54%), Postives = 199/353 (56.37%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPN-------------NYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGD-FQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFR 2940
            + I+L+ D   RYGF V+   +   P+ ++ +  +TPAD C PR+  GD+++ ING +V  L  ++V+++I++      G+++L VRP               Y+ E + + S     S   +G                     F +SL  L + + +  +L Q+E +YRK P L + EA+K  N  KNRYRDISPYD TRV L N+ + DYINA+ +NM+I   G +N+YIA QGPL  T+ DFW+M  +++++L+VMLT + E GR KCH+YWP   E ++  + F + CL E+  E G F  R+ ++      E+R + HMQY++WPDH VP+    F+ F  +VR  R
Sbjct:  503 ITIRLQADEQGRYGFNVKGGVDLSLPVQVSKVVPHTPADRCTPRVCEGDEVLMINGRDVHGLRHEQVVAMIRDCRHQASGELLLTVRPQRSAPLLLEEEPLYQYVPESDEIGS----HSNLLDGDAL------------------FTQSLLLLSDGLASGALLAQYELMYRKNPDLAITEARKPANAPKNRYRDISPYDCTRVSLVNSLTGDYINANYVNMEI-PGGAVNRYIATQGPLASTTTDFWRMVQQESSHLLVMLTTVMESGRQKCHQYWPVTGEELQLAEGFSVRCLSEKPDETGSFVFREFVLKD--KHEQRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAAR 830          

HSP 2 Score: 172.17 bits (435), Expect = 2.202e-43
Identity = 121/364 (33.24%), Postives = 199/364 (54.67%), Query Frame = 1
Query:  190 VVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQ-----LTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAF--CGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLS 1260
            V+ LD     F ++K++ G  LLD +F  LEL ERD+FGL +       G   +W++  K  KKQ     L      +  FRVKF+ ++PS+++EE+TRY  +LQ+K++I   +L C+ +   +L SY +Q+ELGD+N  +H+ GY+S  + + +QT   E K+ +LH   +   P  AE  YL  A  L+ YG+D+  A   + + +Q+G S++G  VF++  R++ F WS + K+SFK+K          F  Q +     N  +  +  + +SS    K LW++CV++H+FFR+K P            + S F  IS+   F   GR  +  +++ ++R R   + F+R+PS   K+LL 
Sbjct:   38 VLFLDDITHTFRIEKRAKGSELLDQVFQYLELSERDYFGLLFPQK---PGDVVRWVDAQKQFKKQCSSVSLDNDAVPLLEFRVKFFVSDPSRLQEEFTRYQFYLQIKRNILLGKLPCSSNTQCLLASYTVQSELGDFNALEHQPGYLSGMQLLCDQTTEAERKVGELHKLHRGQLPADAEYNYLEHAKRLELYGIDLHRATDSNGKELQLGVSAVGLLVFQHSLRVNTFSWSKMVKVSFKRKD---------FFIQLRREPSENYDT--LLGFGMSSHKHAKALWKSCVEHHSFFRLKRP-----------HRLSRFLNISLGSKFYYSGRTELQAVQESKQRGR-IHKVFVRSPS---KRLLG 372          

HSP 3 Score: 98.9821 bits (245), Expect = 1.249e-20
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 1
Query: 2956 PIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVY 3153
            P++VHCSAGIGRTGVLI M+TA+  +EAR+P+  +DI++TMRDQRA M+Q  +Q++FVCE I   Y
Sbjct:  894 PVIVHCSAGIGRTGVLILMDTALALMEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICAAY 959          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Zebrafish
Match: ptpn4a (protein tyrosine phosphatase non-receptor type 4a [Source:ZFIN;Acc:ZDB-GENE-030616-449])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 388/1032 (37.60%), Postives = 560/1032 (54.26%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQ--SPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL*INYFQSN 3201
            G SY V   E  +     ++ C ++LLD  V+ F + K   G  LLD +F  LEL ERD+FGL   D  PS     +WL+  K I+KQL    P+  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L SYA+Q+ELGDY+  ++  GY+SEF F+ NQ    E  ++  H +    +P ++E  YLN A  LD YGV++  A       + +G  S G  ++KN+ R++ F W  I KISFK K          F  Q +      + + L +  V   +  CK LW+ CV++HTFFR+  P P      A+  S GS F        +CGR    +++   K     DR F R+PS    + L      +  AVSR+S  LS  +L ET+          S   RS   +P+HNSL              S  G+ +D        H S +  +  N+ +    +  SIS+E       +  P   +                   +S  N+S +LI S+S  +  + I  +  +   + +K +P                    NG++              +DN ++IK++ D N R+GF V+  S++K PII++ +   T AD+C PRLN GDQ++ ING  +   + D+V+  IK S ES  G++IL VRPN    +VE       D+ + I E      S +          + D +++S+ +L+  + +  IL QF+ +YRK+PG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I    +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP    +  +G FQISC  EE   +  F +R++ +    S E R +  +QY++WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC +E  +P+  ++I++TMRDQRA MIQTP+QFKFVCEAI+KVY++  ++ L    ++SN
Sbjct:   10 GRSYNVRTTELARDRQRTEVVCNILLLDNTVQPFKVNKHDQGQILLDAVFKHLELTERDYFGLHLADE-PSDSP--RWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILSGRLPCPHNTAALLASYAVQSELGDYSEAENLPGYLSEFFFIPNQPQGFEKDVAKHHQQHNGLNPAQSEFNYLNTARTLDLYGVELHYARDQSNTEIYVGVLSAGIGIYKNRVRINYFPWLKIVKISFKCK---------QFFIQLRKEAHDTRDTLLGFNMVNYRA--CKNLWKTCVEHHTFFRLDRPVPPQKNFFAHYFSLGSRF-------RYCGRTEAQSVQ-YGKEKGIKDRVFARSPSKPLARKLM--GVTDWEAVSRNS--LSEERL-ETR----------SLPTRSPPGTPNHNSL----FVQEGPRLRPSSMGHLVDHV-----IHASPSLPVFSNHKSASSTQANSISLESTPSPEGVEGPPPAL----------------PPKQSRKNLS-QLILSHSQQDLDNHIN-EMYDVPTATDKVMP--------------------NGVVP-------------HDNLVLIKMKPDENGRFGFNVKGGSDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGREIAEHSHDQVVMFIKASCESHSGELILLVRPNAIYDVVEEKLETEPDFQY-IPEKSPTDPSHL----------DQDAWRDSMLYLKEGLNSGTILAQFDQLYRKRPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GTEDYINANYINMEIPACSLINRYIACQGPLPNTCSDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPNPSGSATYGGFQISCQTEE--GNSAFLVREITLTHIESGESRELTQIQYLAWPDHGVPDDSTDFLDFVALVRNKRAGKDEPVVVHCSAGIGRTGVLITMETAMCLMECSQPVFPLEIVRTMRDQRAMMIQTPSQFKFVCEAILKVYEEGLVKPLKSILYESN 929          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Zebrafish
Match: ptpn4a (protein tyrosine phosphatase non-receptor type 4a [Source:ZFIN;Acc:ZDB-GENE-030616-449])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 387/1032 (37.50%), Postives = 559/1032 (54.17%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQ--SPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL*INYFQSN 3201
            G SY V   E  +     ++ C ++LLD  V+ F +     G  LLD +F  LEL ERD+FGL   D  PS     +WL+  K I+KQL    P+  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L SYA+Q+ELGDY+  ++  GY+SEF F+ NQ    E  ++  H +    +P ++E  YLN A  LD YGV++  A       + +G  S G  ++KN+ R++ F W  I KISFK K          F  Q +      + + L +  V   +  CK LW+ CV++HTFFR+  P P      A+  S GS F        +CGR    +++   K     DR F R+PS    + L      +  AVSR+S  LS  +L ET+          S   RS   +P+HNSL              S  G+ +D        H S +  +  N+ +    +  SIS+E       +  P   +                   +S  N+S +LI S+S  +  + I  +  +   + +K +P                    NG++              +DN ++IK++ D N R+GF V+  S++K PII++ +   T AD+C PRLN GDQ++ ING  +   + D+V+  IK S ES  G++IL VRPN    +VE       D+ + I E      S +          + D +++S+ +L+  + +  IL QF+ +YRK+PG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I    +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP    +  +G FQISC  EE   +  F +R++ +    S E R +  +QY++WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC +E  +P+  ++I++TMRDQRA MIQTP+QFKFVCEAI+KVY++  ++ L    ++SN
Sbjct:   10 GRSYNVRTTELARDRQRTEVVCNILLLDNTVQPFKVNHDQ-GQILLDAVFKHLELTERDYFGLHLADE-PSDSP--RWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILSGRLPCPHNTAALLASYAVQSELGDYSEAENLPGYLSEFFFIPNQPQGFEKDVAKHHQQHNGLNPAQSEFNYLNTARTLDLYGVELHYARDQSNTEIYVGVLSAGIGIYKNRVRINYFPWLKIVKISFKCK---------QFFIQLRKEAHDTRDTLLGFNMVNYRA--CKNLWKTCVEHHTFFRLDRPVPPQKNFFAHYFSLGSRF-------RYCGRTEAQSVQ-YGKEKGIKDRVFARSPSKPLARKLM--GVTDWEAVSRNS--LSEERL-ETR----------SLPTRSPPGTPNHNSL----FVQEGPRLRPSSMGHLVDHV-----IHASPSLPVFSNHKSASSTQANSISLESTPSPEGVEGPPPAL----------------PPKQSRKNLS-QLILSHSQQDLDNHIN-EMYDVPTATDKVMP--------------------NGVVP-------------HDNLVLIKMKPDENGRFGFNVKGGSDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGREIAEHSHDQVVMFIKASCESHSGELILLVRPNAIYDVVEEKLETEPDFQY-IPEKSPTDPSHL----------DQDAWRDSMLYLKEGLNSGTILAQFDQLYRKRPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GTEDYINANYINMEIPACSLINRYIACQGPLPNTCSDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPNPSGSATYGGFQISCQTEE--GNSAFLVREITLTHIESGESRELTQIQYLAWPDHGVPDDSTDFLDFVALVRNKRAGKDEPVVVHCSAGIGRTGVLITMETAMCLMECSQPVFPLEIVRTMRDQRAMMIQTPSQFKFVCEAILKVYEEGLVKPLKSILYESN 928          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Zebrafish
Match: ptpn4a (protein tyrosine phosphatase non-receptor type 4a [Source:ZFIN;Acc:ZDB-GENE-030616-449])

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 367/975 (37.64%), Postives = 531/975 (54.46%), Query Frame = 1
Query:  292 RDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQ--SPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL*INYFQSN 3201
            RD+FGL   D  PS     +WL+  K I+KQL    P+  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L SYA+Q+ELGDY+  ++  GY+SEF F+ NQ    E  ++  H +    +P ++E  YLN A  LD YGV++  A       + +G  S G  ++KN+ R++ F W  I KISFK K          F  Q +      + + L +  V   +  CK LW+ CV++HTFFR+  P P      A+  S GS F        +CGR    +++   K     DR F R+PS    + L      +  AVSR+S  LS  +L ET+          S   RS   +P+HNSL              S  G+ +D        H S +  +  N+ +    +  SIS+E       +  P   +                   +S  N+S +LI S+S  +  + I  +  +   + +K +P                    NG++              +DN ++IK++ D N R+GF V+  S++K PII++ +   T AD+C PRLN GDQ++ ING  +   + D+V+  IK S ES  G++IL VRPN    +VE       D+ + I E      S +          + D +++S+ +L+  + +  IL QF+ +YRK+PG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I    +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP    +  +G FQISC  EE   +  F +R++ +    S E R +  +QY++WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC +E  +P+  ++I++TMRDQRA MIQTP+QFKFVCEAI+KVY++  ++ L    ++SN
Sbjct:   20 RDYFGLHLADE-PSDSP--RWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILSGRLPCPHNTAALLASYAVQSELGDYSEAENLPGYLSEFFFIPNQPQGFEKDVAKHHQQHNGLNPAQSEFNYLNTARTLDLYGVELHYARDQSNTEIYVGVLSAGIGIYKNRVRINYFPWLKIVKISFKCK---------QFFIQLRKEAHDTRDTLLGFNMVNYRA--CKNLWKTCVEHHTFFRLDRPVPPQKNFFAHYFSLGSRF-------RYCGRTEAQSVQ-YGKEKGIKDRVFARSPSKPLARKLM--GVTDWEAVSRNS--LSEERL-ETR----------SLPTRSPPGTPNHNSL----FVQEGPRLRPSSMGHLVDHV-----IHASPSLPVFSNHKSASSTQANSISLESTPSPEGVEGPPPAL----------------PPKQSRKNLS-QLILSHSQQDLDNHIN-EMYDVPTATDKVMP--------------------NGVVP-------------HDNLVLIKMKPDENGRFGFNVKGGSDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGREIAEHSHDQVVMFIKASCESHSGELILLVRPNAIYDVVEEKLETEPDFQY-IPEKSPTDPSHL----------DQDAWRDSMLYLKEGLNSGTILAQFDQLYRKRPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GTEDYINANYINMEIPACSLINRYIACQGPLPNTCSDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPNPSGSATYGGFQISCQTEE--GNSAFLVREITLTHIESGESRELTQIQYLAWPDHGVPDDSTDFLDFVALVRNKRAGKDEPVVVHCSAGIGRTGVLITMETAMCLMECSQPVFPLEIVRTMRDQRAMMIQTPSQFKFVCEAILKVYEEGLVKPLKSILYESN 882          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Zebrafish
Match: ptpn4a (protein tyrosine phosphatase non-receptor type 4a [Source:ZFIN;Acc:ZDB-GENE-030616-449])

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 382/1032 (37.02%), Postives = 555/1032 (53.78%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQ--SPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL*INYFQSN 3201
            G SY V   E  +     ++ C ++LLD  V+ F + K   G  LLD +F  LEL ERD+FGL   D  PS     +WL+  K I+KQL    P+  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L SYA+Q+ELGDY+  ++  GY+SEF F+ NQ    E  ++  H +    +P ++E  YLN A  LD YGV++  A       + +G  S G  ++KN+ R++ F W  I KISFK K          F  Q +      + + L +  V   +  CK LW+ CV++HTFFR+  P P      A+  S GS F        +CGR    +++   K     DR F   P   +   ++     +  AVSR+S  LS  +L ET+          S   RS   +P+HNSL              S  G+ +D        H S +  +  N+ +    +  SIS+E       +  P   +                   +S  N+S +LI S+S  +  + I  +  +   + +K +P                    NG++              +DN ++IK++ D N R+GF V+  S++K PII++ +   T AD+C PRLN GDQ++ ING  +   + D+V+  IK S ES  G++IL VRPN    +VE       D+ + I E      S +          + D +++S+ +L+  + +  IL QF+ +YRK+PG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I    +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT      + KCH+YWP    +  +G FQISC  EE   +  F +R++ +    S E R +  +QY++WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC +E  +P+  ++I++TMRDQRA MIQTP+QFKFVCEAI+KVY++  ++ L    ++SN
Sbjct:   10 GRSYNVRTTELARDRQRTEVVCNILLLDNTVQPFKVNKHDQGQILLDAVFKHLELTERDYFGLHLADE-PSDSP--RWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILSGRLPCPHNTAALLASYAVQSELGDYSEAENLPGYLSEFFFIPNQPQGFEKDVAKHHQQHNGLNPAQSEFNYLNTARTLDLYGVELHYARDQSNTEIYVGVLSAGIGIYKNRVRINYFPWLKIVKISFKCK---------QFFIQLRKEAHDTRDTLLGFNMVNYRA--CKNLWKTCVEHHTFFRLDRPVPPQKNFFAHYFSLGSRF-------RYCGRTEAQSVQ-YGKEKGIKDRVFASKPLARKLMGVT-----DWEAVSRNS--LSEERL-ETR----------SLPTRSPPGTPNHNSL----FVQEGPRLRPSSMGHLVDHV-----IHASPSLPVFSNHKSASSTQANSISLESTPSPEGVEGPPPAL----------------PPKQSRKNLS-QLILSHSQQDLDNHIN-EMYDVPTATDKVMP--------------------NGVVP-------------HDNLVLIKMKPDENGRFGFNVKGGSDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGREIAEHSHDQVVMFIKASCESHSGELILLVRPNAIYDVVEEKLETEPDFQY-IPEKSPTDPSHL----------DQDAWRDSMLYLKEGLNSGTILAQFDQLYRKRPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GTEDYINANYINMEIPACSLINRYIACQGPLPNTCSDFWQMTWEQGSSMVVMLTT-----QVKCHQYWPNPSGSATYGGFQISCQTEE--GNSAFLVREITLTHIESGESRELTQIQYLAWPDHGVPDDSTDFLDFVALVRNKRAGKDEPVVVHCSAGIGRTGVLITMETAMCLMECSQPVFPLEIVRTMRDQRAMMIQTPSQFKFVCEAILKVYEEGLVKPLKSILYESN 921          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Zebrafish
Match: ptpn4a (protein tyrosine phosphatase non-receptor type 4a [Source:ZFIN;Acc:ZDB-GENE-030616-449])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 379/1032 (36.72%), Postives = 549/1032 (53.20%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQ--SPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL*INYFQSN 3201
            G SY V   E  +     ++ C ++LLD  V+ F +     G  LLD +F  LEL ERD+FGL   D  PS     +WL+  K I+KQL    P+  +FRVKF+ ++P++++EEYTR               L C  +  A+L SYA+Q+ELGDY+  ++  GY+SEF F+ NQ    E  ++  H +    +P ++E  YLN A  LD YGV++  A       + +G  S G  ++KN+ R++ F W  I KISFK K          F  Q +      + + L +  V   +  CK LW+ CV++HTFFR+  P P      A+  S GS F        +CGR    +++   K     DR F R+PS    + L      +  AVSR+S  LS  +L ET+          S   RS   +P+HNSL              S  G+ +D        H S +  +  N+ +    +  SIS+E       +  P   +                   +S  N+S +LI S+S  +  + I  +  +   + +K +P                    NG++              +DN ++IK++ D N R+GF V+  S++K PII++ +   T AD+C PRLN GDQ++ ING  +   + D+V+  IK S ES  G++IL VRPN    +VE       D+ + I E      S +          + D +++S+ +L+  + +  IL QF+ +YRK+PG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I    +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP    +  +G FQISC  EE   +  F +R++ +    S E R +  +QY++WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC +E  +P+  ++I++TMRDQRA MIQTP+QFKFVCEAI+KVY++  ++ L    ++SN
Sbjct:   10 GRSYNVRTTELARDRQRTEVVCNILLLDNTVQPFKVNHDQ-GQILLDAVFKHLELTERDYFGLHLADE-PSDSP--RWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDPNKLQEEYTR---------------LPCPHNTAALLASYAVQSELGDYSEAENLPGYLSEFFFIPNQPQGFEKDVAKHHQQHNGLNPAQSEFNYLNTARTLDLYGVELHYARDQSNTEIYVGVLSAGIGIYKNRVRINYFPWLKIVKISFKCK---------QFFIQLRKEAHETRDTLLGFNMVNYRA--CKNLWKTCVEHHTFFRLDRPVPPQKNFFAHYFSLGSRF-------RYCGRTEAQSVQ-YGKEKGIKDRVFARSPSKPLARKLM--GVTDWEAVSRNS--LSEERL-ETR----------SLPTRSPPGTPNHNSL----FVQEGPRLRPSSMGHLVDHV-----IHASPSLPVFSNHKSASSTQANSISLESTPSPEGVEGPPPAL----------------PPKQSRKNLS-QLILSHSQQDLDNHIN-EMYDVPTATDKAMP--------------------NGVVP-------------HDNLVLIKMKPDENGRFGFNVKGGSDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGREIAEHSHDQVVMFIKASCESHSGELILLVRPNAIYDVVEEKLETEPDFQY-IPEKSPTDPSHL----------DQDAWRDSMLYLKEGLNSGTILAQFDQLYRKRPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GTEDYINANYINMEIPACSLINRYIACQGPLPNTCSDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPNPSGSATYGGFQISCQTEE--GNSAFLVREITLTHIESGESRELTQIQYLAWPDHGVPDDSTDFLDFVALVRNKRAGKDEPVVVHCSAGIGRTGVLITMETAMCLMECSQPVFPLEIVRTMRDQRAMMIQTPSQFKFVCEAILKVYEEGLVKPLKSILYESN 913          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Xenopus
Match: mon2 (MON2 homolog, regulator of endosome-to-Golgi trafficking [Source:Xenbase;Acc:XB-GENE-975876])

HSP 1 Score: 360.918 bits (925), Expect = 3.448e-108
Identity = 176/418 (42.11%), Postives = 259/418 (61.96%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            L++ +  D   ++GF ++   ++K  ++++ I   +PAD C P+L  GDQ++ ING ++   T D+V+  IK S ES   +++L VR         T    D DF+          S             D  + S++ L   +E   +L QFE +YRKKPGL ++ A+  +N  KNRY+D+ PYD TRV+L+  G  DYINAS +NM+I    ++NKY+A QGPL  T E FWQM WEQ   +I+MLT L+E+GR KC +YWP   E  E+G F++ C  E+ +    +  R++++  T +  E  + H+QY++WPDHGVP    +F+ F   VRK R  + +P++VHCSAGIGRTGVLITMETA+C IE  +P+  +DI++ MRDQRA M+QT +Q+KFVCEAI++VYKD  +R +
Sbjct:  496 LLVHIIPDEEGKFGFNLKGGVDQKMQLVVSRITPGSPADKCIPKLKEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELVLLVRRKVVRHLGKTKSEDDADFTFFPPSILPTCSEYG----------DTLQGSMEQLSKGLETGVVLIQFEQLYRKKPGLAIICARTGQNMDKNRYKDVLPYDATRVLLQ--GEDDYINASYVNMEIPSTNIVNKYVATQGPLPHTCEQFWQMVWEQKLSIIIMLTTLTERGRTKCQQYWPDPPEVTEYGKFRVICKTEDCTI--AYVFREMLLTNTETGNEFPIFHLQYVAWPDHGVPDDSSDFLEFATCVRKKRVAN-QPVLVHCSAGIGRTGVLITMETAICLIEQNQPVYPLDIVRQMRDQRAMMVQTSSQYKFVCEAILRVYKDGLVRPM 898          

HSP 2 Score: 122.479 bits (306), Expect = 1.204e-27
Identity = 90/321 (28.04%), Postives = 158/321 (49.22%), Query Frame = 1
Query:  109 LKMLGGSYY-VAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVK 1068
            L+ LGG    +   E  K    +++ C V  LDG+   F + K+  GH LLD++++ L L ER+FFGLQ+ +    S   ++W+   K I+KQL G  P    FRV+F+  +P+ ++++ TR               + C  +   +L SYA+Q+ELGD+N   H  G++S   F+ +Q      K+     +      T+AE  Y+NIA  L++YG++  +   L    + IG +S G +V++       + W                 +   F+ Q    ++ N+    + T+ + +   CK +W++CV++HTFF+ +
Sbjct:    5 LRALGGRINNIRVTELPKEKNRSEVVCTVRFLDGSQHCFRVNKQDTGHTLLDMVYNYLNLKEREFFGLQHSEDSLDS---HRWIEPNKPIRKQLKGGFPCSLLFRVRFFIPDPNTLQQDQTR---------------ISCPLNSAVVLASYAVQSELGDHNSSVHVPGHLSNTSFIPDQDNDFLSKV-----EACGLGQTEAESCYINIARTLEFYGIETHSGRDLHNLDLLIGIASGGVAVYRKLICTSFYPW--------VNILKISFKRKKFFLHQ---RQKQNECREQIVTFNMLNYRACKNVWRSCVEHHTFFQTR 291          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Xenopus
Match: mon2 (MON2 homolog, regulator of endosome-to-Golgi trafficking [Source:Xenbase;Acc:XB-GENE-975876])

HSP 1 Score: 349.747 bits (896), Expect = 1.285e-106
Identity = 172/397 (43.32%), Postives = 248/397 (62.47%), Query Frame = 1
Query: 1987 ERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            ++K  ++++ I   +PAD C P+L  GDQ++ ING ++   T D+V+  IK S ES   +++L VR         T    D DF+          S             D  + S++ L   +E   +L QFE +YRKKPGL ++ A+  +N  KNRY+D+ PYD TRV+L+  G  DYINAS +NM+I    ++NKY+A QGPL  T E FWQM WEQ   +I+MLT L+E+GR KC +YWP   E  E+G F++ C  E+ +    +  R++++  T +  E  + H+QY++WPDHGVP    +F+ F   VRK R  + +P++VHCSAGIGRTGVLITMETA+C IE  +P+  +DI++ MRDQRA M+QT +Q+KFVCEAI++VYKD  +R +
Sbjct:  268 DQKMQLVVSRITPGSPADKCIPKLKEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELVLLVRRKVVRHLGKTKSEDDADFTFFPPSILPTCSEYG----------DTLQGSMEQLSKGLETGVVLIQFEQLYRKKPGLAIICARTGQNMDKNRYKDVLPYDATRVLLQ--GEDDYINASYVNMEIPSTNIVNKYVATQGPLPHTCEQFWQMVWEQKLSIIIMLTTLTERGRTKCQQYWPDPPEVTEYGKFRVICKTEDCTI--AYVFREMLLTNTETGNEFPIFHLQYVAWPDHGVPDDSSDFLEFATCVRKKRVAN-QPVLVHCSAGIGRTGVLITMETAICLIEQNQPVYPLDIVRQMRDQRAMMVQTSSQYKFVCEAILRVYKDGLVRPM 649          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Xenopus
Match: mon2 (MON2 homolog, regulator of endosome-to-Golgi trafficking [Source:Xenbase;Acc:XB-GENE-975876])

HSP 1 Score: 349.362 bits (895), Expect = 5.219e-106
Identity = 172/397 (43.32%), Postives = 248/397 (62.47%), Query Frame = 1
Query: 1987 ERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            ++K  ++++ I   +PAD C P+L  GDQ++ ING ++   T D+V+  IK S ES   +++L VR         T    D DF+          S             D  + S++ L   +E   +L QFE +YRKKPGL ++ A+  +N  KNRY+D+ PYD TRV+L+  G  DYINAS +NM+I    ++NKY+A QGPL  T E FWQM WEQ   +I+MLT L+E+GR KC +YWP   E  E+G F++ C  E+ +    +  R++++  T +  E  + H+QY++WPDHGVP    +F+ F   VRK R  + +P++VHCSAGIGRTGVLITMETA+C IE  +P+  +DI++ MRDQRA M+QT +Q+KFVCEAI++VYKD  +R +
Sbjct:  311 DQKMQLVVSRITPGSPADKCIPKLKEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELVLLVRRKVVRHLGKTKSEDDADFTFFPPSILPTCSEYG----------DTLQGSMEQLSKGLETGVVLIQFEQLYRKKPGLAIICARTGQNMDKNRYKDVLPYDATRVLLQ--GEDDYINASYVNMEIPSTNIVNKYVATQGPLPHTCEQFWQMVWEQKLSIIIMLTTLTERGRTKCQQYWPDPPEVTEYGKFRVICKTEDCTI--AYVFREMLLTNTETGNEFPIFHLQYVAWPDHGVPDDSSDFLEFATCVRKKRVAN-QPVLVHCSAGIGRTGVLITMETAICLIEQNQPVYPLDIVRQMRDQRAMMVQTSSQYKFVCEAILRVYKDGLVRPM 692          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Xenopus
Match: mon2 (MON2 homolog, regulator of endosome-to-Golgi trafficking [Source:Xenbase;Acc:XB-GENE-975876])

HSP 1 Score: 342.043 bits (876), Expect = 4.004e-102
Identity = 169/381 (44.36%), Postives = 238/381 (62.47%), Query Frame = 1
Query: 2035 ADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            AD C P+L  GDQ++ ING ++   T D+V+  IK S ES   +++L VR         T    D DF+          S             D  + S++ L   +E   +L QFE +YRKKPGL ++ A+  +N  KNRY+D+ PYD TRV+L+  G  DYINAS +NM+I    ++NKY+A QGPL  T E FWQM WEQ   +I+MLT L+E+GR KC +YWP   E  E+G F++ C  E+ +    +  R++++  T +  E  + H+QY++WPDHGVP    +F+ F   VRK R  + +P++VHCSAGIGRTGVLITMETA+C IE  +P+  +DI++ MRDQRA M+QT +Q+KFVCEAI++VYKD  +R +
Sbjct:  449 ADKCIPKLKEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELVLLVRRKVVRHLGKTKSEDDADFTFFPPSILPTCSEYG----------DTLQGSMEQLSKGLETGVVLIQFEQLYRKKPGLAIICARTGQNMDKNRYKDVLPYDATRVLLQ--GEDDYINASYVNMEIPSTNIVNKYVATQGPLPHTCEQFWQMVWEQKLSIIIMLTTLTERGRTKCQQYWPDPPEVTEYGKFRVICKTEDCTI--AYVFREMLLTNTETGNEFPIFHLQYVAWPDHGVPDDSSDFLEFATCVRKKRVAN-QPVLVHCSAGIGRTGVLITMETAICLIEQNQPVYPLDIVRQMRDQRAMMVQTSSQYKFVCEAILRVYKDGLVRPM 814          

HSP 2 Score: 101.679 bits (252), Expect = 3.127e-21
Identity = 89/332 (26.81%), Postives = 156/332 (46.99%), Query Frame = 1
Query:  109 LKMLGGSYY-VAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAI--LGSYALQ---------AELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVK 1068
            L+ LGG    +   E  K    +++ C V  LDG+   F + K+  GH LLD++++ L L ER+FFGLQ+ +    S   ++W+   K I+KQL G  P    FRV+F+  +P+ ++++ T           + D  L+    M  I  L S  ++         +ELGD+N   H  G++S   F+ +Q      K+            T+AE  Y+NIA  L++YG++  +   L    + IG +S G +V++       + W                 +   F+ Q    ++ N+    + T+ + +   CK +W++CV++HTFF+ +
Sbjct:    5 LRALGGRINNIRVTELPKEKNRSEVVCTVRFLDGSQHCFRVNKQDTGHTLLDMVYNYLNLKEREFFGLQHSEDSLDS---HRWIEPNKPIRKQLKGGFPCSLLFRVRFFIPDPNTLQQDQT----------SVQDSVLYALTIMFYICQLFSQCIESGNILSRWFSELGDHNSSVHVPGHLSNTSFIPDQDNDFLSKVEAC-----GLGQTEAESCYINIARTLEFYGIETHSGRDLHNLDLLIGIASGGVAVYRKLICTSFYPW--------VNILKISFKRKKFFLHQ---RQKQNECREQIVTFNMLNYRACKNVWRSCVEHHTFFQTR 307          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Xenopus
Match: mon2 (MON2 homolog, regulator of endosome-to-Golgi trafficking [Source:Xenbase;Acc:XB-GENE-975876])

HSP 1 Score: 342.428 bits (877), Expect = 8.441e-102
Identity = 169/381 (44.36%), Postives = 238/381 (62.47%), Query Frame = 1
Query: 2035 ADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            AD C P+L  GDQ++ ING ++   T D+V+  IK S ES   +++L VR         T    D DF+          S             D  + S++ L   +E   +L QFE +YRKKPGL ++ A+  +N  KNRY+D+ PYD TRV+L+  G  DYINAS +NM+I    ++NKY+A QGPL  T E FWQM WEQ   +I+MLT L+E+GR KC +YWP   E  E+G F++ C  E+ +    +  R++++  T +  E  + H+QY++WPDHGVP    +F+ F   VRK R  + +P++VHCSAGIGRTGVLITMETA+C IE  +P+  +DI++ MRDQRA M+QT +Q+KFVCEAI++VYKD  +R +
Sbjct:  487 ADKCIPKLKEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELVLLVRRKVVRHLGKTKSEDDADFTFFPPSILPTCSEYG----------DTLQGSMEQLSKGLETGVVLIQFEQLYRKKPGLAIICARTGQNMDKNRYKDVLPYDATRVLLQ--GEDDYINASYVNMEIPSTNIVNKYVATQGPLPHTCEQFWQMVWEQKLSIIIMLTTLTERGRTKCQQYWPDPPEVTEYGKFRVICKTEDCTI--AYVFREMLLTNTETGNEFPIFHLQYVAWPDHGVPDDSSDFLEFATCVRKKRVAN-QPVLVHCSAGIGRTGVLITMETAICLIEQNQPVYPLDIVRQMRDQRAMMVQTSSQYKFVCEAILRVYKDGLVRPM 852          

HSP 2 Score: 88.9669 bits (219), Expect = 2.956e-17
Identity = 85/332 (25.60%), Postives = 153/332 (46.08%), Query Frame = 1
Query:  109 LKMLGGSYY-VAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAI--LGSYALQ---------AELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVK 1068
            L+ LGG    +   E  K    +++ C V  LDG+   F + K+  GH LLD++++ L L ER+FFGLQ+ +    S   ++W+   K I+KQL G  P    FRV+F+  +P+ ++++ T           + D  L+    M  I  L S  ++         +ELGD+N   H  G++S   F+ +Q                N   +K E  + +  ++L+ YG++  +   LD   + IG +S G +V++       + W                 +   F+ Q    ++ N+    + T+ + +   CK +W++CV++HTFF+ +
Sbjct:    5 LRALGGRINNIRVTELPKEKNRSEVVCTVRFLDGSQHCFRVNKQDTGHTLLDMVYNYLNLKEREFFGLQHSEDSLDS---HRWIEPNKPIRKQLKGGFPCSLLFRVRFFIPDPNTLQQDQT----------SVQDSVLYALTIMFYICQLFSQCIESGNILSRWFSELGDHNSSVHVPGHLSNTSFIPDQ---------------DNDFLSKVEAWHYSTGTKLNLYGINFVDLHNLD---LLIGIASGGVAVYRKLICTSFYPW--------VNILKISFKRKKFFLHQ---RQKQNECREQIVTFNMLNYRACKNVWRSCVEHHTFFQTR 294          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Mouse
Match: Ptpn4 (protein tyrosine phosphatase, non-receptor type 4 [Source:MGI Symbol;Acc:MGI:1099792])

HSP 1 Score: 409.453 bits (1051), Expect = 5.093e-126
Identity = 199/425 (46.82%), Postives = 278/425 (65.41%), Query Frame = 1
Query: 1912 YDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFS-ITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDG--GFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            +DN ++IK++ D N R+GF V+   ++K P+I++ +   TPAD+C PRLN GDQ++ ING ++   T D+V+  IK S E   G+++L VRPN           S+ DF  I E                        +ES+  L   +    +L QF+ +YRKKPG+TM  AK  +N SKNRYRDISPYD TRV+LK  G+ DYINA+ INM+I  + +IN+YIA QGPL  T +DFWQM WEQ + ++VMLT   E+GR KCH+YWP+  E+  +G +Q++C    +SE+G   +  R + ++     E R++  +QY +WPDHGVP    +F++FV  VR  R+G  EPI+VHCSAGIGRTGVLITMETAMC IE  +P+  +DI++TMRDQRA MIQTP+Q++FVCEAI+KVY++  ++ L
Sbjct:  512 HDNLVLIKMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCEKHSGELVLLVRPNAVYDVVEEKLESEPDFQYIPEKAPLDSVHQDDHS----------LRESMIQLAEGLITGTVLAQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVLLK--GNEDYINANYINMEIPSSSIINQYIACQGPLPHTCKDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPSESSSYGCYQVTC----HSEEGNPAYIFRKMTLFNQEKNESRQLTQIQYTAWPDHGVPDDSSDFLDFVCHVRDQRAGKEEPIIVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPL 920          

HSP 2 Score: 213.772 bits (543), Expect = 1.198e-56
Identity = 138/373 (37.00%), Postives = 207/373 (55.50%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPS 1236
            G +Y V A E  +     ++ C ++LLD  V+ F + K   G  LLD++F  L+L ERD+FGLQ  D    S    +WL+  K I+KQL    PY  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L S+A+Q+ELGDYN  ++ +GY+S++ F+ NQ    E +I+ LH +    SP +AE  YLN A  L+ YGV+   A       + IG  S G  ++KN+ RM+ FLW          K + I  K   F  Q +  +E ++S   +  + + +   CKTLW+ CV++HTFFR+  P P      A+  + GS F        +CGR  + +++   K     DR F R+PS
Sbjct:   10 GRTYNVRASELARDRQHTEVVCNILLLDNTVQAFRVNKHDQGQVLLDIVFKHLDLTERDYFGLQLADD---STDNPRWLDPNKPIRKQLKRGSPYNLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLSCPCNTAALLASFAVQSELGDYNQSENLAGYLSDYSFIPNQPQDFEKEIAKLHQQHVGLSPAEAEFNYLNAARTLELYGVEFHYARDQSNNEILIGVMSGGILIYKNRVRMNTFLW---------LKIVKISFKCKQFFIQLR--KELHESRETLLGFNMVNYRACKTLWKACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKF-------RYCGRTEVQSVQ-YGKEKANKDRVFARSPS 360          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Mouse
Match: Ptpn3 (protein tyrosine phosphatase, non-receptor type 3 [Source:MGI Symbol;Acc:MGI:105307])

HSP 1 Score: 359.762 bits (922), Expect = 8.194e-108
Identity = 182/446 (40.81%), Postives = 271/446 (60.76%), Query Frame = 1
Query: 1849 ASKNGIIKSL---HIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
             +K G ++     + D+S   D +    ++I++  D   R+GF ++   ++K P++++ I   +PAD C P+LN GDQ++ ING ++   T D+V+  IK S ES   ++ L +R    +     + S D          E       +         D  + S++ L+  +E+  +L QFE +YRKKPGL +  AK  +N  KNRY+D+ PYD TRV+L+  G+ DYINAS +NM++    ++NKYIA QGPL  T   FWQ+ W+Q   L+VMLT L+E+GR KCH+YWP   + ++ G F I C  E+ +    +  R+++V  T + EE  V H+QY++WPDHGVP    +F+ FV  VR  R    EP +VHCSAGIGRTGVL+TMETAMC IE   P+  +DI++ MRDQRA M+QT +Q+KFVCEAI++VY++  ++ L
Sbjct:  484 VTKGGFVEDASQYYCDKSDDGDGYL---VLIRITPDEEGRFGFNLKGGVDQKMPLVVSRINPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIR-RKAVRSLAEIRSED----------ELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGLAVSFAKLPQNLDKNRYKDVLPYDTTRVLLQ--GNEDYINASYVNMEMPAANLVNKYIATQGPLPNTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQTEDCTI--AYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVDG-EPALVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQRL 910          

HSP 2 Score: 166.007 bits (419), Expect = 2.223e-41
Identity = 107/372 (28.76%), Postives = 189/372 (50.81%), Query Frame = 1
Query:  109 LKMLGGSYYVAAREEY-KHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRV-KVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIED-IQKRSRTTDR 1215
            L+ LGG        E  K    +++ C +  LDG V+ F + K+  G  LLD+ +  L + E+++FGLQ+ D    S +   WL  +K ++KQL G  P   HFRV+++  +P+ +++E TR+L FLQLK D+ + RL C  +   +L SYA+Q+  GD+N   H  GY+++ +F+ +Q      K+  LH +      ++AE  Y+NIA  LD+YGV++     L    + IG +S G +V++       + W                 +   F+ Q +   ES +    +  + + +   CK LW++CV++H+FF+  K+ P    + +   + GS     S+   +C +     + + + +RS + +R
Sbjct:    5 LRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPR---WLEASKPLRKQLKGGFPCTLHFRVRYFIPDPNTLQQEQTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHFGDFNSSIHHPGYLADSQFIPDQNDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAGIAVYRKYICTSFYPW--------VNILKISFKRKKFFIHQRQKQAESREH---IVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSVER 362          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Mouse
Match: Ptpn4 (protein tyrosine phosphatase, non-receptor type 4 [Source:MGI Symbol;Acc:MGI:1099792])

HSP 1 Score: 214.157 bits (544), Expect = 5.564e-59
Identity = 138/373 (37.00%), Postives = 207/373 (55.50%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPS 1236
            G +Y V A E  +     ++ C ++LLD  V+ F + K   G  LLD++F  L+L ERD+FGLQ  D    S    +WL+  K I+KQL    PY  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L S+A+Q+ELGDYN  ++ +GY+S++ F+ NQ    E +I+ LH +    SP +AE  YLN A  L+ YGV+   A       + IG  S G  ++KN+ RM+ FLW          K + I  K   F  Q +  +E ++S   +  + + +   CKTLW+ CV++HTFFR+  P P      A+  + GS F        +CGR  + +++   K     DR F R+PS
Sbjct:   10 GRTYNVRASELARDRQHTEVVCNILLLDNTVQAFRVNKHDQGQVLLDIVFKHLDLTERDYFGLQLADD---STDNPRWLDPNKPIRKQLKRGSPYNLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLSCPCNTAALLASFAVQSELGDYNQSENLAGYLSDYSFIPNQPQDFEKEIAKLHQQHVGLSPAEAEFNYLNAARTLELYGVEFHYARDQSNNEILIGVMSGGILIYKNRVRMNTFLW---------LKIVKISFKCKQFFIQLR--KELHESRETLLGFNMVNYRACKTLWKACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKF-------RYCGRTEVQSVQ-YGKEKANKDRVFARSPS 360          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Mouse
Match: Ptpn14 (protein tyrosine phosphatase, non-receptor type 14 [Source:MGI Symbol;Acc:MGI:102467])

HSP 1 Score: 192.2 bits (487), Expect = 6.644e-50
Identity = 104/299 (34.78%), Postives = 165/299 (55.18%), Query Frame = 1
Query: 2317 PFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRV--ILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQI---YETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFR----------SGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDI 3168
            P  E L+ L+  +E+  +  ++E +  KK       A   EN  ++R R++ PY++ RV  I     ++ YINAS I + +   G    YIA QGPL  T  DFWQM WEQ   +I M+TA  E GR K H+YWP++   + +  +G F+++      ++ G +A   L V   +S +ER V H+QY  WP HG P     F++++ +++  R               PIVVHCSAG+GRTGV+I  E  +  +E  + + +  +L+ +R+QR  MIQT AQ+KFV + +++  ++S +
Sbjct:  554 PIDERLRALKKKLEDGMVFTEYEQIPNKKANGVFSTATLPENAERSRIREVVPYEENRVELIPTKENNTGYINASHIKVVVG--GSEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFR--TDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPHHGCPEDVQGFLSYLEEIQSVRRHTNSVLEGIRTRHPPIVVHCSAGVGRTGVVILSELMIYCLEHNEKVEVPTMLRFLREQRMFMIQTIAQYKFVYQVLVQFLQNSRL 848          

HSP 2 Score: 89.3521 bits (220), Expect = 1.723e-17
Identity = 73/231 (31.60%), Postives = 113/231 (48.92%), Query Frame = 1
Query:  166 ASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLT--GSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEF-----RFVKNQTPVLEL--KISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSV 831
            + N    ++ LLD NV   TL  +S G   L+ +   LEL E  +FGL +     S  +  +W+   K +KK L    ++P +F F V FY  N S++++E TRY  +LQ+KKD+ + RL C+ + V  L   A+QA+ GDYN Q     ++ E+          +  + EL  K++  H       P +AE  Y+N    LD +G +IF         V +G   +G  V
Sbjct:   17 SKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETHYFGLWFL----SKSQQARWVELEKPLKKHLDKFANEPLLF-FGVMFYVPNVSRLQQEATRYQYYLQVKKDVLEGRLRCSLEQVIRLAGLAVQADFGDYN-QFDSQEFLREYVLFPMDLAMEEAALEELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDSHGNSVHLGIFFMGIFV 241          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Mouse
Match: Epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:MGI Symbol;Acc:MGI:103006])

HSP 1 Score: 185.267 bits (469), Expect = 1.340e-49
Identity = 123/320 (38.44%), Postives = 174/320 (54.37%), Query Frame = 1
Query:  166 ASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNF 1125
            A + + C+V LLDG      L KK+ G  L D I   L+L+E D+FGL++ DS     +   WL+G KSIKKQ+    PY  H RVKFY + P+ ++EE TRYL  LQLK+DI   +L C  D    L +Y LQAELGDY+  +H    +SEFRFV  QT  +EL I +   + +  +P +AE  YLN A  L+ YGVD+      D     +G +  G  VF+ + ++ LF W  I ++ FKK K+T+ +      DQ K  E +       + + L     CK LW+  V++H FFR++ P   S  ++     GS F
Sbjct:   39 AKSIITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIESDYFGLRFMDS----AQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVVVEDD--DQGKEQEHT-------FVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRF 345          
BLAST of Tyrosine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q9WU22|PTN4_MOUSE (Tyrosine-protein phosphatase non-receptor type 4 OS=Mus musculus OX=10090 GN=Ptpn4 PE=1 SV=2)

HSP 1 Score: 409.453 bits (1051), Expect = 3.563e-125
Identity = 199/425 (46.82%), Postives = 278/425 (65.41%), Query Frame = 1
Query: 1912 YDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFS-ITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDG--GFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            +DN ++IK++ D N R+GF V+   ++K P+I++ +   TPAD+C PRLN GDQ++ ING ++   T D+V+  IK S E   G+++L VRPN           S+ DF  I E                        +ES+  L   +    +L QF+ +YRKKPG+TM  AK  +N SKNRYRDISPYD TRV+LK  G+ DYINA+ INM+I  + +IN+YIA QGPL  T +DFWQM WEQ + ++VMLT   E+GR KCH+YWP+  E+  +G +Q++C    +SE+G   +  R + ++     E R++  +QY +WPDHGVP    +F++FV  VR  R+G  EPI+VHCSAGIGRTGVLITMETAMC IE  +P+  +DI++TMRDQRA MIQTP+Q++FVCEAI+KVY++  ++ L
Sbjct:  512 HDNLVLIKMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCEKHSGELVLLVRPNAVYDVVEEKLESEPDFQYIPEKAPLDSVHQDDHS----------LRESMIQLAEGLITGTVLAQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVLLK--GNEDYINANYINMEIPSSSIINQYIACQGPLPHTCKDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPSESSSYGCYQVTC----HSEEGNPAYIFRKMTLFNQEKNESRQLTQIQYTAWPDHGVPDDSSDFLDFVCHVRDQRAGKEEPIIVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPL 920          

HSP 2 Score: 213.772 bits (543), Expect = 8.378e-56
Identity = 138/373 (37.00%), Postives = 207/373 (55.50%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPS 1236
            G +Y V A E  +     ++ C ++LLD  V+ F + K   G  LLD++F  L+L ERD+FGLQ  D    S    +WL+  K I+KQL    PY  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L S+A+Q+ELGDYN  ++ +GY+S++ F+ NQ    E +I+ LH +    SP +AE  YLN A  L+ YGV+   A       + IG  S G  ++KN+ RM+ FLW          K + I  K   F  Q +  +E ++S   +  + + +   CKTLW+ CV++HTFFR+  P P      A+  + GS F        +CGR  + +++   K     DR F R+PS
Sbjct:   10 GRTYNVRASELARDRQHTEVVCNILLLDNTVQAFRVNKHDQGQVLLDIVFKHLDLTERDYFGLQLADD---STDNPRWLDPNKPIRKQLKRGSPYNLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLSCPCNTAALLASFAVQSELGDYNQSENLAGYLSDYSFIPNQPQDFEKEIAKLHQQHVGLSPAEAEFNYLNAARTLELYGVEFHYARDQSNNEILIGVMSGGILIYKNRVRMNTFLW---------LKIVKISFKCKQFFIQLR--KELHESRETLLGFNMVNYRACKTLWKACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKF-------RYCGRTEVQSVQ-YGKEKANKDRVFARSPS 360          
BLAST of Tyrosine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P29074|PTN4_HUMAN (Tyrosine-protein phosphatase non-receptor type 4 OS=Homo sapiens OX=9606 GN=PTPN4 PE=1 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 1.279e-123
Identity = 199/426 (46.71%), Postives = 278/426 (65.26%), Query Frame = 1
Query: 1912 YDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDG--GFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            +DN ++I+++ D N R+GF V+   ++K P+I++ +   TPAD+C PRLN GDQ++ ING ++   T D+V+  IK S E   G+++L VRPN    +VE       D+ + I E                        +ES+  L   +    +L QF+ +YRKKPG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I  + +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP+   +  +G +Q++C    +SE+G   +  R + ++     E R +  +QYI+WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC IE  +P+  +DI++TMRDQRA MIQTP+Q++FVCEAI+KVY++  ++ L
Sbjct:  512 HDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPNAVYDVVEEKLENEPDFQY-IPEKAPLDSVHQDDHS----------LRESMIQLAEGLITGTVLTQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTC----HSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPL 920          

HSP 2 Score: 207.994 bits (528), Expect = 6.172e-54
Identity = 135/373 (36.19%), Postives = 205/373 (54.96%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPS 1236
            G +Y V A E  +     ++ C ++LLD  V+ F + K   G  LLD++F  L+L E+D+FGLQ  D    S    +WL+  K I+KQL    PY  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L S+A+Q+ELGDY+  ++ SGY+S++ F+ NQ    E +I+ LH +    SP +AE  YLN A  L+ YGV+   A       + IG  S G  ++KN+ RM+ F W          K + I  K   F  Q +  +E ++S   +  + + +   CK LW+ CV++HTFFR+  P P      A+  + GS F        +CGR  + +++   K     DR F R+PS
Sbjct:   10 GRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDVVFKHLDLTEQDYFGLQLADD---STDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLPCPSNTAALLASFAVQSELGDYDQSENLSGYLSDYSFIPNQPQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGGILIYKNRVRMNTFPW---------LKIVKISFKCKQFFIQLR--KELHESRETLLGFNMVNYRACKNLWKACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKF-------RYCGRTEVQSVQ-YGKEKANKDRVFARSPS 360          
BLAST of Tyrosine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P28191|PTP1_CAEEL (Tyrosine-protein phosphatase 1 OS=Caenorhabditis elegans OX=6239 GN=ptp-1 PE=2 SV=3)

HSP 1 Score: 395.971 bits (1016), Expect = 2.782e-119
Identity = 190/423 (44.92%), Postives = 276/423 (65.25%), Query Frame = 1
Query: 1915 DNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGC--GDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            D  + IK+R DR+ R+GF V+  +++  P+I++ +   + AD C PRLN GDQ++ I+G +V  ++ D V+  I+ S+ SG   G++ L +RPN Y +     E  + D ++             ++      N D   +SL+ L +S+ +  ++  FE +YRKKPG++M   + T N +KNRYRD+ PYD TRV L+ + S DYINA+ +NM+I  +G++N+YIA QGPL  TS DFW M WEQ+   IVMLT ++E+GR KCH+YWP+++ET E+G   I C+ ++ + +  +  R+  +    S EERRV  MQYI+WPDHGVP     FI FV +VRK R G  +PIVVHCSAGIGRTGVLI META C +E+ +P+  +DI++TMRDQRA +IQTP Q+ FVCE+I++ Y D  I+ L
Sbjct:  613 DQVVTIKMRPDRHGRFGFNVKGGADQNYPVIVSRVAPGSSADKCQPRLNEGDQVLFIDGRDVSTMSHDHVVQFIR-SARSGLNGGELHLTIRPNVYRL---GEEVDEPDSTMVPE---------PARVADSVPNSDKLSKSLQLLADSLNSGKVVDHFEMLYRKKPGMSMNICRLTANLAKNRYRDVCPYDDTRVTLQASPSGDYINANYVNMEIPSSGIVNRYIACQGPLAHTSSDFWVMVWEQHCTTIVMLTTITERGRVKCHQYWPRVFETQEYGRLMIKCIKDKQTTNCCY--REFSIRDRNSSEERRVTQMQYIAWPDHGVPDDPKHFIQFVDEVRKARQGSVDPIVVHCSAGIGRTGVLILMETAACLVESNEPVYPLDIVRTMRDQRAMLIQTPGQYTFVCESILRAYHDGTIKPL 1020          

HSP 2 Score: 162.925 bits (411), Expect = 2.471e-39
Identity = 132/448 (29.46%), Postives = 229/448 (51.12%), Query Frame = 1
Query:  118 LGGSYYVAAREE------YKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSG-----YISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFK---NNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGT-LSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDY 1416
            LG + Y   R E       K    N ++C V  LD     F ++K S G  LL+ +F+ LE++E+D+FGL +     SS +  KWL+ +K+++KQ+    PY   FRVKFY  +P+++++E+TR+  + Q+++++ + RL CN+  +A+L SY +QAE+GD+  + H        Y  +F  + +       ++++LH      +P  AE+ +L+ A  L+ YG+D+++ +  +   ++IG  ++G  VF    +M+ + W  I K+SFKKK             QF+    NE+    + +++   + S+ +CK LW+ C++ HTFFR+K PP   Q K    + GS F        + GR    T+E+ + R     R F R  S ++   L    S N  ++  S  T  ++    E  +  QLL +      R  + S ++L Y
Sbjct:    3 LGSNSYDVQRTEAIGQTPVKTPPPNQIRCTVTFLDSTSYHFEIEKNSLGIVLLEKVFNYLEIIEKDYFGLVFIAVDNSSAQQKKWLDPSKNLRKQMI-CPPYHLFFRVKFYVRDPNRLRDEFTRFQFYQQVRQNLEEGRLPCNEGSLALLASYVVQAEVGDFEEKTHGMSRTCLCYKIQFATLPDD---FSDRVAELHQLHIGQTPDVAEQNFLDHARRLEMYGMDVYDGVDANHLPIEIGVGAVGIKVFHEGIKMNEYAWVRIRKLSFKKK-------------QFQVLVANEDGVSETIMIFN--IMSAKICKLLWKCCIEQHTFFRLKTPPKTPQRKVF--NFGSKF-------RYSGRTEYQTLEENEHRKSAGHRNFHR--SLSKSSFLRSTFSGNTQSIDSSRYTNTTTTDSPELPSSGQLLARRLLSAARHDTDSSDALGY 420          
BLAST of Tyrosine-protein phosphatase vs. UniProt/SwissProt
Match: sp|A2ALK8|PTN3_MOUSE (Tyrosine-protein phosphatase non-receptor type 3 OS=Mus musculus OX=10090 GN=Ptpn3 PE=1 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 5.732e-107
Identity = 182/446 (40.81%), Postives = 271/446 (60.76%), Query Frame = 1
Query: 1849 ASKNGIIKSL---HIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
             +K G ++     + D+S   D +    ++I++  D   R+GF ++   ++K P++++ I   +PAD C P+LN GDQ++ ING ++   T D+V+  IK S ES   ++ L +R    +     + S D          E       +         D  + S++ L+  +E+  +L QFE +YRKKPGL +  AK  +N  KNRY+D+ PYD TRV+L+  G+ DYINAS +NM++    ++NKYIA QGPL  T   FWQ+ W+Q   L+VMLT L+E+GR KCH+YWP   + ++ G F I C  E+ +    +  R+++V  T + EE  V H+QY++WPDHGVP    +F+ FV  VR  R    EP +VHCSAGIGRTGVL+TMETAMC IE   P+  +DI++ MRDQRA M+QT +Q+KFVCEAI++VY++  ++ L
Sbjct:  484 VTKGGFVEDASQYYCDKSDDGDGYL---VLIRITPDEEGRFGFNLKGGVDQKMPLVVSRINPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIR-RKAVRSLAEIRSED----------ELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGLAVSFAKLPQNLDKNRYKDVLPYDTTRVLLQ--GNEDYINASYVNMEMPAANLVNKYIATQGPLPNTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQTEDCTI--AYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVDG-EPALVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQRL 910          

HSP 2 Score: 166.007 bits (419), Expect = 1.555e-40
Identity = 107/372 (28.76%), Postives = 189/372 (50.81%), Query Frame = 1
Query:  109 LKMLGGSYYVAAREEY-KHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRV-KVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIED-IQKRSRTTDR 1215
            L+ LGG        E  K    +++ C +  LDG V+ F + K+  G  LLD+ +  L + E+++FGLQ+ D    S +   WL  +K ++KQL G  P   HFRV+++  +P+ +++E TR+L FLQLK D+ + RL C  +   +L SYA+Q+  GD+N   H  GY+++ +F+ +Q      K+  LH +      ++AE  Y+NIA  LD+YGV++     L    + IG +S G +V++       + W                 +   F+ Q +   ES +    +  + + +   CK LW++CV++H+FF+  K+ P    + +   + GS     S+   +C +     + + + +RS + +R
Sbjct:    5 LRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPR---WLEASKPLRKQLKGGFPCTLHFRVRYFIPDPNTLQQEQTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHFGDFNSSIHHPGYLADSQFIPDQNDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAGIAVYRKYICTSFYPW--------VNILKISFKRKKFFIHQRQKQAESREH---IVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSVER 362          
BLAST of Tyrosine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P26045|PTN3_HUMAN (Tyrosine-protein phosphatase non-receptor type 3 OS=Homo sapiens OX=9606 GN=PTPN3 PE=1 SV=2)

HSP 1 Score: 358.607 bits (919), Expect = 1.404e-106
Identity = 179/418 (42.82%), Postives = 262/418 (62.68%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            ++I++  D + ++GF ++   ++K P++++ I   +PAD C P+LN GDQ++ ING ++   T D+V+  IK S ES   ++ L +R          V S    F+  ++  E       +   +     D  + S+  L+  +E+  +L QFE +YRKKPGL +  AK  +N  KNRY+D+ PYD TRV+L+  G+ DYINAS +NM+I    ++NKYIA QGPL  T   FWQ+ W+Q   LIVMLT L+E+GR KCH+YWP   + +  G F I C  E+ +    +  R+++V  T + EE  V H+QY++WPDHGVP    +F+ FV  VR  R    EP++VHCSAGIGRTGVL+TMETAMC  E   PI  +DI++ MRDQRA M+QT +Q+KFVCEAI++VY++  ++ L
Sbjct:  509 VLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRR-------AVRS----FADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQ--GNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTI--AYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDS-EPVLVHCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQML 910          

HSP 2 Score: 176.407 bits (446), Expect = 8.733e-44
Identity = 118/353 (33.43%), Postives = 192/353 (54.39%), Query Frame = 1
Query:  109 LKMLGGSYY-VAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRV-KVPPNNSQIKANTKSKGSNFFGISITPAFCGR 1161
            L+ LGG    +   E  K    +++ C +  LDG V+ F + K+  G  LLD++ + L + E+++FGLQ+ D    S +   WL  +K+I+KQL G  P   HFRV+F+  +P+ +++E TR+L FLQLK DI + RL C  +   +L SYA+Q+  GDYN   H  GY+S+  F+ +Q      K+  LH +      ++AE  Y+NIA  LD+YGV++ +   L    + IG +S G +V++       + W +I KISFK+KK         F+ Q +   ES +    +  + + +   CK LW++CV++HTFF+  K+ P    + +   + GS     S+   +C +
Sbjct:    5 LRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHNHLGVTEKEYFGLQHDDDSVDSPR---WLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQEQTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICTSFYPWVNILKISFKRKKF--------FIHQRQKQAESREH---IVAFNMLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKK 343          
BLAST of Tyrosine-protein phosphatase vs. TrEMBL
Match: A0A498ND05 (Tyrosine-protein phosphatase OS=Labeo rohita OX=84645 GN=ROHU_018745 PE=3 SV=1)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 398/1056 (37.69%), Postives = 574/1056 (54.36%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRV--KVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRN--NSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDG------FHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKL-----------------ICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL*INYFQSN 3201
            G SY V A E  +     ++ C V+LLD  V+ F + K   G  LLD +F  LEL ERD+FGL   D    S    +WL+  K I+KQL    P+  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L SYA+Q+ELGDYN  ++  GY+SEF F+ NQ    E +++  H +    +P ++E  YLN A  L+ YGV++  A       + IG  S G +++KN+ R++ F W  I KISFK K          F  Q +      + + L +  V   +  CK LW+ CV++HTFFR+   VPP         K+  +++F +     +CGR    +++   K     DR F R+PS    + L R      +  +VSR+S  LS  +L ET+          S   RS   + N   YK    + +S NS        L     G       H S +  +  N+ +    +  SIS+E   Y   L++PLN      E   N+R    K +  S +     L                 +    S ++LS++ L  S     N     Y   +A+          A+ NG+I              +DN ++IK++ D N R+GF V+  S++K PII++ +   T AD+C PRLN GDQ++ ING ++   T D+V+  IK S ES  G++IL VRPN    +VE       D+ + I E      S +          + D +++S+  L++ + +  +L QF+ +YRK+PG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I  + +IN+YIA QGPL  T  DFWQM WEQ + L+VMLT   E+GR KCH+YWP    +  +G FQ+ C  EE   +  F +RD+ +    S E R +  +QY++WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC +E  +P+  ++I++TMRDQRA MIQTP+QFKFVCEAI+KVY++  ++ L    ++SN
Sbjct:   10 GRSYNVRATELARDRQRTEVVCNVLLLDNTVQPFKVNKHDQGQILLDAVFKHLELTERDYFGLHLADD---SSDSLRWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILSGRLPCPHNTAALLASYAVQSELGDYNEAENLPGYLSEFCFIPNQPQGFEKEVTKHHQQHSGLTPAQSEFNYLNTARTLELYGVELHYARDQSNTEIFIGVMSAGIAIYKNRVRINYFPWLKIVKISFKCK---------QFFIQLRKEAHETRDTLLGFNMVNYRA--CKNLWKACVEHHTFFRLDRPVPPQ--------KNFFAHYFNLGSRFRYCGRTEAQSVQ-YGKEKGIKDRVFARSPS----KPLGRKFMGVTDWESVSRNS--LSEERL-ETR----------SLPTRSPPGTPNHY-YK---CSVNSRNSLFVQEGPRLRPSSMGHLVDHVIHASPSLPVFSNHKSASSTQANSISLESTPYHP-LSAPLN----GPEWKLNARCAAVKCVYRSHSVGHRALDFNGAWSPEGVEGPPPALPPKQSRKNLSQLILSHSQQDLDNHINEMYDVPIATDK--------ATPNGVIP-------------HDNLVLIKMKPDENGRFGFNVKGGSDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGRDIAEHTHDQVVMFIKASCESHSGELILLVRPNAIYDVVEEKLETEPDFQY-IPEKSPTDPSQL----------DQDAWRDSMLQLKDGLNSATVLAQFDQLYRKRPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GTDDYINANYINMEIPASSLINRYIACQGPLPNTCPDFWQMTWEQGSSLVVMLTTQVERGRVKCHQYWPNPSGSATYGGFQVCCQTEE--GNSAFLVRDMTLNHIESGETRELTQIQYLAWPDHGVPDDSTDFLDFVALVRSKRAGKDEPVVVHCSAGIGRTGVLITMETAMCLMECGQPVYPLEIVRTMRDQRAMMIQTPSQFKFVCEAILKVYEEGLVKPLKSMLYESN 980          
BLAST of Tyrosine-protein phosphatase vs. TrEMBL
Match: F1QBE0 (Tyrosine-protein phosphatase OS=Danio rerio OX=7955 GN=ptpn4a PE=3 SV=2)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 388/1032 (37.60%), Postives = 560/1032 (54.26%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQ--SPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL*INYFQSN 3201
            G SY V   E  +     ++ C ++LLD  V+ F + K   G  LLD +F  LEL ERD+FGL   D  PS     +WL+  K I+KQL    P+  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L SYA+Q+ELGDY+  ++  GY+SEF F+ NQ    E  ++  H +    +P ++E  YLN A  LD YGV++  A       + +G  S G  ++KN+ R++ F W  I KISFK K          F  Q +      + + L +  V   +  CK LW+ CV++HTFFR+  P P      A+  S GS F        +CGR    +++   K     DR F R+PS    + L      +  AVSR+S  LS  +L ET+          S   RS   +P+HNSL              S  G+ +D        H S +  +  N+ +    +  SIS+E       +  P   +                   +S  N+S +LI S+S  +  + I  +  +   + +K +P                    NG++              +DN ++IK++ D N R+GF V+  S++K PII++ +   T AD+C PRLN GDQ++ ING  +   + D+V+  IK S ES  G++IL VRPN    +VE       D+ + I E      S +          + D +++S+ +L+  + +  IL QF+ +YRK+PG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I    +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP    +  +G FQISC  EE   +  F +R++ +    S E R +  +QY++WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC +E  +P+  ++I++TMRDQRA MIQTP+QFKFVCEAI+KVY++  ++ L    ++SN
Sbjct:   10 GRSYNVRTTELARDRQRTEVVCNILLLDNTVQPFKVNKHDQGQILLDAVFKHLELTERDYFGLHLADE-PSDSP--RWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILSGRLPCPHNTAALLASYAVQSELGDYSEAENLPGYLSEFFFIPNQPQGFEKDVAKHHQQHNGLNPAQSEFNYLNTARTLDLYGVELHYARDQSNTEIYVGVLSAGIGIYKNRVRINYFPWLKIVKISFKCK---------QFFIQLRKEAHDTRDTLLGFNMVNYRA--CKNLWKTCVEHHTFFRLDRPVPPQKNFFAHYFSLGSRF-------RYCGRTEAQSVQ-YGKEKGIKDRVFARSPSKPLARKLM--GVTDWEAVSRNS--LSEERL-ETR----------SLPTRSPPGTPNHNSL----FVQEGPRLRPSSMGHLVDHV-----IHASPSLPVFSNHKSASSTQANSISLESTPSPEGVEGPPPAL----------------PPKQSRKNLS-QLILSHSQQDLDNHIN-EMYDVPTATDKVMP--------------------NGVVP-------------HDNLVLIKMKPDENGRFGFNVKGGSDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGREIAEHSHDQVVMFIKASCESHSGELILLVRPNAIYDVVEEKLETEPDFQY-IPEKSPTDPSHL----------DQDAWRDSMLYLKEGLNSGTILAQFDQLYRKRPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GTEDYINANYINMEIPACSLINRYIACQGPLPNTCSDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPNPSGSATYGGFQISCQTEE--GNSAFLVREITLTHIESGESRELTQIQYLAWPDHGVPDDSTDFLDFVALVRNKRAGKDEPVVVHCSAGIGRTGVLITMETAMCLMECSQPVFPLEIVRTMRDQRAMMIQTPSQFKFVCEAILKVYEEGLVKPLKSILYESN 929          
BLAST of Tyrosine-protein phosphatase vs. TrEMBL
Match: B3DHD0 (Tyrosine-protein phosphatase OS=Danio rerio OX=7955 GN=ptpn4a PE=2 SV=1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 387/1032 (37.50%), Postives = 559/1032 (54.17%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQ--SPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL*INYFQSN 3201
            G SY V   E  +     ++ C ++LLD  V+ F +     G  LLD +F  LEL ERD+FGL   D  PS     +WL+  K I+KQL    P+  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L SYA+Q+ELGDY+  ++  GY+SEF F+ NQ    E  ++  H +    +P ++E  YLN A  LD YGV++  A       + +G  S G  ++KN+ R++ F W  I KISFK K          F  Q +      + + L +  V   +  CK LW+ CV++HTFFR+  P P      A+  S GS F        +CGR    +++   K     DR F R+PS    + L      +  AVSR+S  LS  +L ET+          S   RS   +P+HNSL              S  G+ +D        H S +  +  N+ +    +  SIS+E       +  P   +                   +S  N+S +LI S+S  +  + I  +  +   + +K +P                    NG++              +DN ++IK++ D N R+GF V+  S++K PII++ +   T AD+C PRLN GDQ++ ING  +   + D+V+  IK S ES  G++IL VRPN    +VE       D+ + I E      S +          + D +++S+ +L+  + +  IL QF+ +YRK+PG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I    +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP    +  +G FQISC  EE   +  F +R++ +    S E R +  +QY++WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC +E  +P+  ++I++TMRDQRA MIQTP+QFKFVCEAI+KVY++  ++ L    ++SN
Sbjct:   10 GRSYNVRTTELARDRQRTEVVCNILLLDNTVQPFKVNHDQ-GQILLDAVFKHLELTERDYFGLHLADE-PSDSP--RWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILSGRLPCPHNTAALLASYAVQSELGDYSEAENLPGYLSEFFFIPNQPQGFEKDVAKHHQQHNGLNPAQSEFNYLNTARTLDLYGVELHYARDQSNTEIYVGVLSAGIGIYKNRVRINYFPWLKIVKISFKCK---------QFFIQLRKEAHETRDTLLGFNMVNYRA--CKNLWKTCVEHHTFFRLDRPVPPQKNFFAHYFSLGSRF-------RYCGRTEAQSVQ-YGKEKGIKDRVFARSPSKPLARKLM--GVTDWEAVSRNS--LSEERL-ETR----------SLPTRSPPGTPNHNSL----FVQEGPRLRPSSMGHLVDHV-----IHASPSLPVFSNHKSASSTQANSISLESTPSPEGVEGPPPAL----------------PPKQSRKNLS-QLILSHSQQDLDNHIN-EMYDVPTATDKVMP--------------------NGVVP-------------HDNLVLIKMKPDENGRFGFNVKGGSDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGREIAEHSHDQVVMFIKASCESHSGELILLVRPNAIYDVVEEKLETEPDFQY-IPEKSPTDPSHL----------DQDAWRDSMLYLKEGLNSGTILAQFDQLYRKRPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GTEDYINANYINMEIPACSLINRYIACQGPLPNTCSDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPNPSGSATYGGFQISCQTEE--GNSAFLVREITLTHIESGESRELTQIQYLAWPDHGVPDDSTDFLDFVALVRNKRAGKDEPVVVHCSAGIGRTGVLITMETAMCLMECSQPVFPLEIVRTMRDQRAMMIQTPSQFKFVCEAILKVYEEGLVKPLKSILYESN 928          
BLAST of Tyrosine-protein phosphatase vs. TrEMBL
Match: A0A2R8QJY8 (Tyrosine-protein phosphatase OS=Danio rerio OX=7955 GN=ptpn4a PE=3 SV=1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 387/1032 (37.50%), Postives = 559/1032 (54.17%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQ--SPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL*INYFQSN 3201
            G SY V   E  +     ++ C ++LLD  V+ F +     G  LLD +F  LEL ERD+FGL   D  PS     +WL+  K I+KQL    P+  +FRVKF+ ++P++++EEYTRY  FLQ+K+DI   RL C  +  A+L SYA+Q+ELGDY+  ++  GY+SEF F+ NQ    E  ++  H +    +P ++E  YLN A  LD YGV++  A       + +G  S G  ++KN+ R++ F W  I KISFK K          F  Q +      + + L +  V   +  CK LW+ CV++HTFFR+  P P      A+  S GS F        +CGR    +++   K     DR F R+PS    + L      +  AVSR+S  LS  +L ET+          S   RS   +P+HNSL              S  G+ +D        H S +  +  N+ +    +  SIS+E       +  P   +                   +S  N+S +LI S+S  +  + I  +  +   + +K +P                    NG++              +DN ++IK++ D N R+GF V+  S++K PII++ +   T AD+C PRLN GDQ++ ING  +   + D+V+  IK S ES  G++IL VRPN    +VE       D+ + I E      S +          + D +++S+ +L+  + +  IL QF+ +YRK+PG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I    +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP    +  +G FQISC  EE   +  F +R++ +    S E R +  +QY++WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC +E  +P+  ++I++TMRDQRA MIQTP+QFKFVCEAI+KVY++  ++ L    ++SN
Sbjct:   10 GRSYNVRTTELARDRQRTEVVCNILLLDNTVQPFKVNHDQ-GQILLDAVFKHLELTERDYFGLHLADE-PSDSP--RWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILSGRLPCPHNTAALLASYAVQSELGDYSEAENLPGYLSEFFFIPNQPQGFEKDVAKHHQQHNGLNPAQSEFNYLNTARTLDLYGVELHYARDQSNTEIYVGVLSAGIGIYKNRVRINYFPWLKIVKISFKCK---------QFFIQLRKEAHDTRDTLLGFNMVNYRA--CKNLWKTCVEHHTFFRLDRPVPPQKNFFAHYFSLGSRF-------RYCGRTEAQSVQ-YGKEKGIKDRVFARSPSKPLARKLM--GVTDWEAVSRNS--LSEERL-ETR----------SLPTRSPPGTPNHNSL----FVQEGPRLRPSSMGHLVDHV-----IHASPSLPVFSNHKSASSTQANSISLESTPSPEGVEGPPPAL----------------PPKQSRKNLS-QLILSHSQQDLDNHIN-EMYDVPTATDKVMP--------------------NGVVP-------------HDNLVLIKMKPDENGRFGFNVKGGSDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGREIAEHSHDQVVMFIKASCESHSGELILLVRPNAIYDVVEEKLETEPDFQY-IPEKSPTDPSHL----------DQDAWRDSMLYLKEGLNSGTILAQFDQLYRKRPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GTEDYINANYINMEIPACSLINRYIACQGPLPNTCSDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPNPSGSATYGGFQISCQTEE--GNSAFLVREITLTHIESGESRELTQIQYLAWPDHGVPDDSTDFLDFVALVRNKRAGKDEPVVVHCSAGIGRTGVLITMETAMCLMECSQPVFPLEIVRTMRDQRAMMIQTPSQFKFVCEAILKVYEEGLVKPLKSILYESN 928          
BLAST of Tyrosine-protein phosphatase vs. TrEMBL
Match: A0A5S6QT60 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 371/1032 (35.95%), Postives = 558/1032 (54.07%), Query Frame = 1
Query:  184 CQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTD------------RTFIRTPSTNRKQLLSR----NNSNNHSAV---SRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYK--PLTATFDSDNSSVDGNEI--DLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNV--SDKLI---CSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLA------SSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            C V  LDG    F ++K + G  LL+ ++D LEL+E+D+FGLQ+ D  P  G   +WL  AKSI+KQ+    PYI HFRVKFY ++PS++ EEYTRY  +LQL+KDI D RL C++    +L SYA+Q+E GD++ ++H+ GY+ +F F  NQTP    K+++LH + +  +P  AE  +L+ A  LD YGVD++ A       VQ+G +S G  VF+   ++  F W  I K+SFK+K          F  Q K++     SS ++  + LSS+   K LW++C+++HTFFR+  PP  S     T   GS F        + GR    T+E+++KR+R               R+ I + S  R Q L+R      S + +AV    R+  +LS +    + +        N+  + +   S   L  +  P+  TF   +++VD + +    YE     H S          +     +    +     + +L S L    R + + + S     +    +   V   D L+   C+ +S  + S +    S          P  S +A      S+  FN F      +G + S                  I++R D   R+GF V+   ++  PII++ +   +PAD C PRLN GDQ+++IN   V   T ++V+  I++  E+   ++ L VRPN Y+ E   +E  D  +              +          D   +SL  L++S+ +   L  F+ +YRK P +TM  AK  EN  KNRYRDISPYD+TRV+++N    DYINAS INM++  +G++N+YIAAQGPL  T+ DFWQ+ WEQ  + +VMLTA  E+GR KCH+YWP +YET  +G  +++C+ E  +  G  A+R+L V    +KEER + HMQY +WPDHGVP    E I+F+  VR+ R+G  EP++VHCSAGIGRTGVLI +ETAMC IE+ +PI  ++I+++MRDQRA +IQ  AQ+KF CEAI+K+Y +  ++ L
Sbjct:   30 CDVHFLDGTQHAFEVEKHALGQELLERVYDHLELIEKDYFGLQFTDLSPDPGAM-RWLEPAKSIRKQMQ-CPPYILHFRVKFYVSDPSKLLEEYTRYHFYLQLRKDIADGRLVCSESSFVVLASYAVQSEFGDHSSEEHREGYLEKFSFAPNQTPEFLRKVAELHKQHRGQTPADAEYNFLDHAKRLDLYGVDLYRAQDSSMSDVQVGVASFGVGVFQRAAKLKTFFWPRIMKLSFKRK---------QFFIQLKSDA---NSSDMIQCFTLSSTRTSKMLWKSCIEHHTFFRLISPPAPSAKALFTF--GSQF-------RYSGRTEHQTLEEMKKRARIGKTFCRLSSTNCFARSTIASSSYARSQELARKLKPTTSVDAAAVMACHRAPSSLSELIPSPSSSDGNSNNNNNNNGNANAGKSDGLLTGRRMPVETTFGLMDATVDSDGVVEQTYELPGVVHGSDGSTGGGGQSSSRMVPNSLPLIYSIKEQKNLRSSL----RHTCHKRVSALLLHQRQQGAGRPVDFKDALVYQHCTTASTSTASPVVCRPSGGRCGTVLASPGHSSVARNGCSPSTALFNGFHSSLGDDGTLVS------------------IRMRPDSQGRFGFNVKGGCDQNYPIIVSRVIPGSPADTCLPRLNEGDQVLAINRVEVSQCTHEQVVRYIRSCKETASKELSLIVRPNAYIGE--DIEEPDQLY-----------VPQTPHVADCVPRPDILNQSLLLLKDSLASGSALLYFDKLYRKSPLMTMSIAKYPENLCKNRYRDISPYDKTRVVIQNGICGDYINASFINMEVPSSGIVNRYIAAQGPLPHTTADFWQVVWEQLCHTVVMLTATVERGRVKCHQYWPNLYETHHYGRLEVTCVKEMDTYIG--AVRELSVICNETKEERLISHMQYSAWPDHGVPDDPSELIDFIVDVRRSRTGMVEPVLVHCSAGIGRTGVLILLETAMCLIESSEPIYPLEIVKSMRDQRAMLIQNAAQYKFACEAILKIYSEGIVKPL 1001          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Cavefish
Match: ptpn4a (protein tyrosine phosphatase non-receptor type 4a [Source:ZFIN;Acc:ZDB-GENE-030616-449])

HSP 1 Score: 418.313 bits (1074), Expect = 2.029e-129
Identity = 202/424 (47.64%), Postives = 285/424 (67.22%), Query Frame = 1
Query: 1912 YDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNY--MVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            +DN ++IK++ D N R+GF V   S++K P+I++ +   T AD+C PRLN GDQ++ ING ++   T D+V+  IK S ES  G++IL VRPN    +VE       D+ +   ++             D    + D ++ES++ L++ + +  +L QF+ +YRK+PG+TM  AK  +N SKNRYRDISPYD TRVILK  G+ DYINA+ INM+I  + +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP    T  +  FQ+SC  EE   +  F +R++ +    ++E R +  +QY++WPDHGVP    +F++FV  VR  R+G  EP+VVHCSAGIGRTGVLITMETAMC +E  +P+  +DI++TMRDQRA MIQTP+QFKFVCEAI++VY++  ++ L
Sbjct:  511 HDNLVLIKMKPDENGRFGFNVTGGSDQKMPVIVSRVAPGTSADLCVPRLNEGDQVVLINGRDISEHTHDQVVMFIKASCESHSGELILLVRPNAIYDVVEEKLEMEPDFQYIPAKS-----------PTDPSQLDQDAWRESMQQLKDGLSSGAVLAQFDQLYRKRPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GTDDYINANYINMEIPASSIINRYIACQGPLPNTCSDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPNPSGTATYDGFQVSCQTEE--GNSAFLVREMTLTHIETEESRELTQIQYLAWPDHGVPDDSTDFLDFVALVRSKRAGKDEPVVVHCSAGIGRTGVLITMETAMCLMECSQPVYPLDIVRTMRDQRAMMIQTPSQFKFVCEAILRVYEEGLVKPL 919          

HSP 2 Score: 206.068 bits (523), Expect = 3.280e-54
Identity = 140/395 (35.44%), Postives = 207/395 (52.41%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSS 1302
            G SY V A E  +     ++ C +VLLD  V+ F + K   G  LLD +F  LEL ERD+FGL   D    S    +WL+  K I+KQL    P+  +FRVKF+ ++PS+++EEYTRY  FLQ+K+DI   RL C  +  A+L SY +Q+ELGDY+  ++  GY+S + F+ NQ    E +++  H +    SP ++E  YLN A  L++YGV++  A       + IG  S G  ++KN+ R++ F W          K + I  K   F  Q + +    + + L +  V   +  CK LW+ CV++HTFFR+  P P      A+  S GS F        +CGR    +++   K     DR F R+PS    + L      +  AVSR+S
Sbjct:   10 GRSYNVRASELARDRQHTEVVCNIVLLDNTVQPFKVNKHDQGQVLLDTVFKHLELTERDYFGLHLADD---SSDCPRWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDPSKLQEEYTRYQYFLQIKQDILSGRLPCPHNTAALLASYTVQSELGDYSEAENPPGYLSGYCFIPNQPQGFEKEVAKHHQQHSGLSPAESEFNYLNTARTLEHYGVELHYARDQSNTEILIGVMSAGIVIYKNRVRINCFPW---------LKIVKISFKCKQFFIQLRKDANETRETLLGFNMVNYRA--CKNLWKTCVEHHTFFRLDQPVPPQKNFFAHYFSLGSKF-------RYCGRTEAQSVQ-YGKEKGIKDRVFARSPSKPLARKLM--GMTDWEAVSRNS 380          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Cavefish
Match: ptpn4b (protein tyrosine phosphatase non-receptor type 4b [Source:ZFIN;Acc:ZDB-GENE-030131-6259])

HSP 1 Score: 406.757 bits (1044), Expect = 1.131e-124
Identity = 203/433 (46.88%), Postives = 282/433 (65.13%), Query Frame = 1
Query: 1885 DRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDG--GFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            D+S +    +DN ++IK++ D N R+GF V+  ++++ PII++ +   T AD+C PRLN GDQ++ ING ++   T D+V+ +IK S E+   ++IL VRPN        V+  D    +            S   D   S  D +K S + L + + +  +L QF+ +YRK+PG++M  A+  +N SKNRYRDISPYD TRV+LK  G+ DYINA+ INM+I   G + +YIA QGPL  T  DFWQM WEQ+  L+VMLT   E+GR KCH+YWP +  T  +G FQ++C+    SEDG   + +R L +    SKEER++  MQY++WPDHGVP    +F+NFV  VR  R    E +VVHCSAGIGRTGVLITMETAMC IE  + +  +DI++TMRDQRA MIQTP+Q++FVCEAI+KVY +  ++ L
Sbjct:  519 DKSMNGAVPHDNLVLIKMKPDENGRFGFNVKGGADQRMPIIVSRVAPGTAADLCVPRLNEGDQVVLINGRDISDYTHDDVVMLIKASCENQSAELILLVRPNAIY----DVDEEDEKLDLESE---FHYIPESCGLDRSHSEPDGWKSSFQLLRDGLSSGSVLAQFDQLYRKRPGMSMSCARLPQNVSKNRYRDISPYDTTRVVLK--GTEDYINANYINMEITGGGGVRRYIACQGPLPGTCGDFWQMVWEQSATLVVMLTTQVERGRVKCHQYWPNVSATGTYGGFQVTCI----SEDGNSAYLLRALTLTHLESKEERQLCQMQYMAWPDHGVPDDSTDFLNFVSLVRSKRGDSQEAVVVHCSAGIGRTGVLITMETAMCLIERSQSVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYDEEMVKPL 938          

HSP 2 Score: 220.32 bits (560), Expect = 1.098e-58
Identity = 153/410 (37.32%), Postives = 225/410 (54.88%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSN-NHSAVSRSSGTLSSMKLKETKNK 1344
            G S  V   E  +   S    C V+LLD  V+ F + K+  G  LLD++F+ L+L ERD+FGLQ  D    + +  +WL+  K I+KQL    P    FRVKF+ + PS+++EEYTRYL FLQLK+DI   RL C ++  A+L SYA+QAELGDY+  +H  GY+SEF F+ N     E +++ LH +    SP +AE  YL+ AS LD YGV++  A       V IG  S G S++KN+ R+  F W          K + I  KS  F  Q +  +ES+KS   +  + + +   CK +W+ CV++HTFFR++ P P      A+  + GS F        +CGR    +++  ++R    DR F R+PS   K L+ R  S  +   VSR+S +   ++ +   N+
Sbjct:   26 GRSSDVGESEVARDRQSAQGVCIVLLLDNTVQAFRVNKQEQGQALLDIVFEHLQLTERDYFGLQLTDE---TSENQRWLDPNKPIRKQLKRVAPNNLSFRVKFFVSEPSKLQEEYTRYLYFLQLKQDILSGRLPCPQNAAALLASYAIQAELGDYSQSEHLPGYLSEFSFIPNPPEDFEKEVAKLHQQHNGLSPAQAEFNYLSAASSLDLYGVELHYARDQTTAEVYIGVMSAGISIYKNRVRVSHFPW---------VKIVKISFKSKQFFIQLR--KESSKSRESLLGFSMMNYRACKNVWKACVEHHTFFRLERPAPQQKSFFAHYFTLGSKF-------RYCGRTEAQSVQYGKERG-VKDRVFARSPS---KPLVRRLVSGMDWETVSRNSLSDDRLETQSLPNR 410          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Cavefish
Match: ptpn3 (protein tyrosine phosphatase non-receptor type 3 [Source:NCBI gene;Acc:103022005])

HSP 1 Score: 331.257 bits (848), Expect = 4.276e-98
Identity = 166/412 (40.29%), Postives = 249/412 (60.44%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKD 3159
            L++++  D++ ++GF V+   ++K P+ I+ +  N+PA  C P L  GDQ++ ING ++   T  +V+  IK S ES   ++ L VR     +            ++ E             P     + +  +ES+  LE  + +  +L QFE +YRKKPGL M  AK++EN  KNRY+D+ PYD TRV+L+     +YINAS  +++    G +  Y+AAQGPL  T   FW+  WEQ   +I+MLT L+E+GR KCH+YWP   E  ++G  Q+ C  EE   +  +  R+L +  T   ++R + H+QY++WPDHGVP    +F++FV  +R  R    EP+VVHCSAGIGRTGVLITMETA+  +E  KP+  ++IL ++R+QRA M+QT  QF FVCEAI++VY++
Sbjct:  442 LLVRISPDQDGKFGFNVKGGVDQKMPLAISHVNPNSPAGRCVPALLEGDQVLLINGRDISEHTHQQVVMFIKASRESHSKELALLVRRKGISLRAEPTLQIGGGLNLQEE----------MPPPPSHPSGESLEESMARLEKGLSSGTLLMQFEKLYRKKPGLAMSCAKQSENLDKNRYKDVLPYDITRVVLQAE-EDNYINAS--HVKTEPAGGVLHYVAAQGPLPHTCTHFWRSVWEQGATVIIMLTTLTERGRTKCHQYWPHPPEVKDYGYLQVCCHSEEC--NLAYVTRELTLTHTQLGQQRSITHLQYVAWPDHGVPEDSSDFLDFVQAMRSKRMD-TEPLVVHCSAGIGRTGVLITMETALILMENTKPVYPLEILTSLREQRAMMVQTSCQFSFVCEAILRVYRE 837          

HSP 2 Score: 155.221 bits (391), Expect = 3.782e-38
Identity = 105/320 (32.81%), Postives = 175/320 (54.69%), Query Frame = 1
Query:  151 EYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKS 1110
            ++ H   + + C V+  D  +  F++ K   GH L D   + L ++E+ +F LQ  +   SS +   WL+  K  KKQL G+ P+   FRV+F+ ++P+ ++ E TR+  FLQ+KKDI + RL C      +L SYA+Q+E GDY P+   +GY+ +  F+ +Q      K+  LH + K  S ++AE  YLN A  LD YGV++ +A   +   + +G +S G ++F N      F W ++ KISFK+K+         F+   + + E  +    + +  + +S  CK LW++CVD+HTF+  K    ++Q  + T+S
Sbjct:   22 KHTHMQRSSITCVVLFPDVTMHSFSVGKNDAGHLLFDQACEHLGIVEKHYFSLQISEDSSSSPR---WLDPNKPFKKQLKGTDPFYLIFRVRFFISDPNSLQHEQTRHFYFLQIKKDIREGRLKCPLSSGVVLASYAVQSEFGDYVPET-PAGYVDKIHFIPDQDKDFLFKVESLHPQHKGLSQSEAELCYLNTARTLDLYGVELHSARDANNPSLWVGIASGGVAMFCNLVCSSFFPWINVIKISFKRKRF--------FIHLRRKHGEVGQQ---VVSVSMPNSRACKNLWRSCVDHHTFYNRK----SAQAVSKTRS 322          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Cavefish
Match: ptpn20 (protein tyrosine phosphatase non-receptor type 20 [Source:ZFIN;Acc:ZDB-GENE-090313-90])

HSP 1 Score: 191.815 bits (486), Expect = 1.031e-52
Identity = 106/267 (39.70%), Postives = 155/267 (58.05%), Query Frame = 1
Query: 2320 FKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQ-IYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKE---ERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQT 3108
             K  ++ L+N ++  +++++F ++   KP    +  K  EN  KNRYRDI PYD+TRV +      DYINAS I M++        YI++QGPL  T + FWQM WE  + +I M+T   E+GR KCHKYWP+ ++  +E G +Q+  +++ Y     F I+   V R V KE      V+H+++ +WPDHG P    + + F+  +R   S    PI VHCSAGIGR GVLI  +  +  IE    IN+ +I++ MR QR  MIQT
Sbjct:  107 LKALIQILQNQLDQQELVKEFMALEHLKPLDNCLVGKAPENREKNRYRDILPYDETRVPVGER--QDYINASYIRMKVGTEEFF--YISSQGPLPSTQDCFWQMVWENKSDVIAMMTKEVERGRVKCHKYWPEKLHVPMETGHYQL--ILDNYQIQDYFHIK---VIRMVEKETGATHFVKHLKFTTWPDHGTPHSSKQLVRFIRYMRAVHSS--GPITVHCSAGIGRAGVLICTDVILSLIEKDLTINVSEIVREMRLQRYGMIQT 362          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Cavefish
Match: ptpn21 (protein tyrosine phosphatase non-receptor type 21 [Source:ZFIN;Acc:ZDB-GENE-080102-4])

HSP 1 Score: 199.904 bits (507), Expect = 7.858e-52
Identity = 104/295 (35.25%), Postives = 169/295 (57.29%), Query Frame = 1
Query: 2326 ESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVIL--KNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQI---YETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFR---------SGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDI 3168
            E  K LE  +E   +  ++E V +K+P      A+  EN  +NR++D+ PYD TRV L      ++ YINAS I + +   G    YIA+QGPL  T +DFWQM WEQ   +I M+TA  E GR K ++YWP++   + T+ +G F+I+      ++ G +A   L +   ++ +ER V H+QY  WPDHG P     F++++ +++  R              P++VHCSAG+GRTGV+I  E  +  +E  + +++  +L+ +R QR  M+QT +Q+ F+ + +I+  K+S +
Sbjct:  845 ERCKLLEQKLEQGMVFTEYEQVPKKRPSCDCSIAQLPENAERNRFQDVLPYDDTRVELVPTKENNTGYINASHIKVTVG--GEEWSYIASQGPLSHTCQDFWQMVWEQGIAIIAMVTAEEEGGREKSYRYWPRLGSRHNTVTYGRFKITTRFR--TDSGCYATTGLKIKHLLTGQERTVWHLQYTDWPDHGCPEDFKGFLSYLEEIQSVRRHTNSTSDPKNTNPPVLVHCSAGVGRTGVVILSEVMVACLEHNEMLDVPTVLKLLRHQRMIMVQTISQYTFIYKVLIQFLKNSRL 1135          

HSP 2 Score: 83.1889 bits (204), Expect = 1.211e-15
Identity = 73/240 (30.42%), Postives = 119/240 (49.58%), Query Frame = 1
Query:  178 LKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLT--GSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEF-----RFVKNQTPVLEL--KISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLG-FSVFKNKKRMHLFLW 867
            L  ++ LL+G    FTL  +S G   LD +   LEL E  +F L Y +         +W++  K +KKQL   G +P ++ F V FY    SQ+++E TRY  +LQLKKDI + R+ C+ +    L   A+QA+ GD+N +     ++ +F      +++++  V E   K++ L+   +     +AE  Y+    +++ YG + F A       + IG    G F   KN +   LF W
Sbjct:   23 LVTRIQLLNGEFVEFTLSVESTGQECLDAVAQRLELREITYFSLWYFNKQ----NQQRWIDLEKPLKKQLDKYGLEPTVY-FGVVFYVPTVSQLQQEITRYQYYLQLKKDILEGRIPCSIEQAIRLAGLAVQADFGDFN-RYDSQEFLQKFVLFPIEWIQDERVVEEATQKVALLYQSYRGLPVPEAEMLYMQEVEKMEAYGQESFQAKDNQGADILIGSCLDGIFVKHKNGRAPLLFRW 256          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 363.614 bits (932), Expect = 1.271e-109
Identity = 183/419 (43.68%), Postives = 261/419 (62.29%), Query Frame = 1
Query: 1924 LMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTP-------AQFKFVCEAIIKVYKD 3159
            ++++++ D   R+GF V+   ++K  + ++ +   TPAD+C PRLN GDQ+I ING +V   T D+V+  I+ S+ES  G+++L +RP+    E    +S + DF      +   SS                + S++ L  +++    L QFE +YRKKPG+++  AK + N S+NRYRD+ PYD TRV+L  +G+ DYINA+ INM+I  +  IN+YIA QGPL  T   FWQM WEQ   L++MLT L+E+GRPKCH+YWP +  +  +G F + C  +   E      R L +    + EER V  +QY++WPDHGVP     F+ FV  VR  R  H +P+VVHCSAGIGRTGVLITMETA+C +E  + +  +DI++TMRDQRA MIQTP        Q+KFVCEAI++VY +
Sbjct:  536 VLVRMKPDDQGRFGFNVKGGVDQKMLVTVSRVAPGTPADLCVPRLNEGDQVILINGRDVSEHTHDQVVQFIRASTESHSGELVLLIRPSAVYEELERADS-EPDFQYIPEKTRECSSPGERHV---------VRTSMQQLREALDTGQALLQFEQLYRKKPGMSLGMAKMSCNSSRNRYRDVLPYDATRVVL--SGNEDYINANYINMEITSSSTINRYIACQGPLPSTCAHFWQMVWEQGCSLVIMLTTLTERGRPKCHQYWPDLPGSETYGGFFVLC--DSEEESEASIERKLTLRNVENNEERGVTQLQYVAWPDHGVPDDSSHFLGFVRDVRT-RRDHAQPVVVHCSAGIGRTGVLITMETALCLMECNESVYPLDIVRTMRDQRAMMIQTPPCHTRGQCQYKFVCEAILRVYDE 939          

HSP 2 Score: 208.764 bits (530), Expect = 9.485e-56
Identity = 139/405 (34.32%), Postives = 217/405 (53.58%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP--PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTN-RKQLLSRNNSNNHSAVSRSSGTLSSMKL 1326
            GG+Y V   E  +     +  C + LLD         K   G  LLD +F  L+L E D+FGLQ+ D    S +  +WL+  K ++KQ+  S PYIF+FRVKF+  +PS+++EEYTRY  FLQL+ DI + RL C  +  A+L SY +Q+ELGDY+  +H  GY+S+ RF+  Q    E +++ LH +    +P  AE  YLN+A  +++YGV++  A       + +G ++ G +V+ N  R+  F W          K + I  K  HF  Q +  +E N++   +  + L +   CKTLW+ CV++HTFFR+  P  P +    A   S GS F        + GR  M T++  ++RS   +R F R+PS    ++ +S     +++A + S+  L +  L
Sbjct:   10 GGTYNVRTSELARDRHRTEALCHINLLDNTAITLRANKSEAGKALLDAVFAHLDLAETDYFGLQFADD---STETPRWLDPTKPLRKQIKRSSPYIFNFRVKFFVTDPSKLQEEYTRYHYFLQLRNDILEARLPCPHNTAALLASYIVQSELGDYSETEHLPGYLSDLRFLPRQGLDFEKEVAKLHKQHVGMTPADAEFNYLNVAKNVEFYGVELHYARDQSNVEIMVGVTAGGVNVYNNGVRISNFPW---------IKIVKIFFKLKHFFVQLR--KEQNETRENIIGFNLGNYRACKTLWKACVEHHTFFRMARPASPPHLGFLAQYFSLGSKF-------RYSGRTEMQTVQYGKERS-NRNRNFARSPSQRFPRRTISGKEWGSNAATAGSAERLETQSL 392          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006520.1 (pep scaffold:Pmarinus_7.0:GL476919:12935:65469:-1 gene:ENSPMAG00000005841.1 transcript:ENSPMAT00000006520.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 2.672e-50
Identity = 101/299 (33.78%), Postives = 164/299 (54.85%), Query Frame = 1
Query: 2317 PFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVIL--KNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQI---YETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINF---VYKVRKFRSGHFE-------PIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDI 3168
            P  E  K L+  +E   +  ++E V +K+       A  +EN  +NR++D+ PY++ R+ L    +  + Y+NAS I  Q+  +G    YIA QGPL  T +DFWQM WE+   +I M+T   E G+ K H+YWP++   +  + +G F+++      ++ G +A   L +   +   ER V H+QY  WPDHG P     F+ +   +  VR+  +   E       P+VVHCSAG+GRTGV+I  E  +  +E  + +++ D+L  +R QR  M+QT  Q+ FV +A+I+  + S +
Sbjct:  887 PMDERCKMLQERLEQGMVFTEYERVLKKRAQADCSTATLSENHDRNRFKDVVPYEENRIELLPSKDNPTGYVNASRI--QVTVSGEEWHYIATQGPLPSTCQDFWQMVWEEGVNVIAMVTQEEEGGKSKSHRYWPKLGSRHSAVTYGKFKVTTKFR--TDFGCYATTGLKLKHLLDGHERTVWHLQYTDWPDHGCPDHVQGFLGYLEEIKSVRRHTNNMLEASKPANPPVVVHCSAGVGRTGVVILTEMMIACLEHNEKLDVPDVLAILRTQRMLMVQTITQYTFVYQALIQFLRSSRL 1181          

HSP 2 Score: 88.1965 bits (217), Expect = 7.612e-18
Identity = 76/241 (31.54%), Postives = 120/241 (49.79%), Query Frame = 1
Query:  172 NDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTG-SQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKS---GYISEFRFVKNQTPVLE----LKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLG-FSVFKNKKRMHLFLW 867
            N    ++ LLD +V   TL  +S G   L+     LEL E   FGL Y +      +  +W++  K ++KQL   +Q  + HF V FY  +  Q+++E TRY  +LQLKKDI + +L C+ +    L S A+QA+ GDY+  Q +     YI  F  V  Q   L+    +K++  H  ++     +AE  Y+    +LD +G + F A       + IG +  G F  +K++K   L+ W
Sbjct:   21 NCFVIRIKLLDTSVIECTLSVESTGQECLEAAAQRLELRELAHFGLWYSNKQ----QQLRWVDLEKPLRKQLDKFAQEALLHFGVLFYVPSEIQLQQEVTRYQYYLQLKKDIIEGKLPCSVEQSVRLASLAVQADFGDYDQYQSQEFLRDYIL-FPMVWAQDDSLQEEMTVKVAIQHQNLRGLIAEQAELVYIREVEKLDGFGHESFPAKESTGTDLTIGTAFQGIFVKYKSEKAPALYKW 256          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006037.1 (pep scaffold:Pmarinus_7.0:GL477253:2:79428:1 gene:ENSPMAG00000005380.1 transcript:ENSPMAT00000006037.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 2.770e-50
Identity = 103/290 (35.52%), Postives = 158/290 (54.48%), Query Frame = 1
Query: 2341 LENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVIL--KNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQI---YETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFR---------SGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDI 3168
            LE  V    +  ++E + R +P      A+  +N  +NR+ D+ PY+QTRV L    +  + YINAS + +++   G    YIA QGPL  T +DFWQM WEQ   +I M+T   E GR KCH+YWP++     +  +GD++++      ++ G +A   L V    S +ER   H+ Y  WPDHG P     F+ F+ +V+  R              P+VVHCSAG+GR+GVLI  E  +  +E    +++   L  +R QR  M+QT AQ++FV +A+I+   +S +
Sbjct:  862 LEKRVARGLVSAEYECIPRTRPDPVYSTAELPDNQERNRFGDVLPYEQTRVELLPSKDNPTGYINASHVRVRVG--GEQWHYIATQGPLPNTCQDFWQMIWEQGVSVIAMVTPEQESGRQKCHRYWPKLGSKRNSANYGDYRVTTKFR--TDSGSYATTGLKVKHLPSGQERTAWHLHYPDWPDHGCPEDVQRFLAFLEEVQSVRRHTNSMLPPHTASPPVVVHCSAGVGRSGVLILTEITIAGLEHNVQLDVPQALGVLRGQRMLMVQTLAQYQFVYQALIQFLNNSRL 1147          

HSP 2 Score: 67.781 bits (164), Expect = 1.259e-11
Identity = 55/193 (28.50%), Postives = 96/193 (49.74%), Query Frame = 1
Query:  298 FFGLQYKDSHPSSGKYYKWLNGAKSIKKQLT--GSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEF-----RFVKNQTPVLEL--KISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLG-FSVFKNKK 846
             FGL Y+  H    +  +W    K +KKQL   G +  + +F V F   + +  ++E TRY  +LQLKK + + +L C  +    L + ++QA  GD++ Q+    ++ ++      + ++   V EL  K++  H K +   P +AE  Y+  A +L+ YG + F+A       V +G S  G F   +N+K
Sbjct:   26 LFGLWYRTRH----RQMRWAEMEKPLKKQLEKHGCE-SVVNFGVMFCVPSCALPQQEATRYQYYLQLKKAVVEGQLLCTFEQGVRLAALSVQANFGDHD-QRESQDFLRDYVLFPLAWSQDDRIVEELTQKVAAFHQKHRGMRPAEAELLYIQEAEKLEGYGEESFSAKDTSGSDVLLGTSYNGVFVRHRNEK 212          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ptpn2b (protein tyrosine phosphatase non-receptor type 2b [Source:ZFIN;Acc:ZDB-GENE-030909-8])

HSP 1 Score: 176.792 bits (447), Expect = 5.485e-50
Identity = 101/254 (39.76%), Postives = 140/254 (55.12%), Query Frame = 1
Query: 2413 TMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIE-FGDFQISCLVEEYSEDGGFAIRDLMVY----RTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFE--PIVVHCSAGIGRTGVLITMETAMCFIEARK----PINLVDILQTMRDQRASMIQTPAQFKFVCEAI 3141
            T   AK+ EN  +NRYRD+SP+D +RV L+  G  DYINAS++ +          YI AQ PL  T   FWQM WEQ +  IVML    E    KC KYWP+  +  + F D  ++ L EE +    F +R+L ++    R  + E R+V H  Y  WPD GVP     F++F+++VR   S   E  P+VVHCSAGIGR+G    ++T +  +E  +    P ++  +L  MR  R  +IQTP Q +F   AI
Sbjct:   24 TCKAAKRPENSRRNRYRDVSPFDHSRVRLQR-GDGDYINASLVQVPQAQRS----YILAQAPLPNTCGHFWQMVWEQKSRAIVMLNRTVENNVKKCEKYWPKRRDAPKSFRDSSVTLLGEERTP--FFTVRELQLHFLPVRACAGETRKVLHFHYTMWPDFGVPESPTHFLDFLFRVRASASLSPELGPLVVHCSAGIGRSGTFCLVDTCLALVERTREGLVPPDVRQVLLQMRHARMGLIQTPEQLRFSYLAI 270          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009934.1 (pep scaffold:Pmarinus_7.0:GL479331:74:24469:1 gene:ENSPMAG00000008984.1 transcript:ENSPMAT00000009934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.578 bits (475), Expect = 9.617e-49
Identity = 94/273 (34.43%), Postives = 149/273 (54.58%), Query Frame = 1
Query: 2341 LENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQI-YETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYK 3156
            L+  +      ++F+ +    P    + A   EN  +NRYR++ P+D TRV L      DYINAS + ++  D  +   Y+A QGPL  T+  FWQM WEQ   ++ MLT  +E GR KCH+YWP+      E G +++  ++E+      F IR +M+ +  +   +RV  +Q+  WPDHG PA     + F+   R+ +     P+V HCSAG+GR+G LI ++  +  I+     N+ DI++ MR QR  M+QT  Q+ F  +A ++  +
Sbjct:  780 LQEHIAQQGPEKEFQRLCNLTPRDGCLVASAVENRDRNRYRNVLPFDATRVALSGR-EDDYINASHVALRAGDAAL--AYVACQGPLPHTAAHFWQMVWEQRARVLAMLTLETELGRAKCHRYWPESRSRATEVGPYRL--VLEQQQTLKSFCIRVIMITKLETGIRQRVTQLQFTQWPDHGAPASAGPLVRFLRFARRLQEPG--PLVTHCSAGVGRSGALICLDAVLAHIDHGLEFNIADIVREMRTQRYGMVQTLEQYIFCYKAALETLQ 1045          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 108.612 bits (270), Expect = 6.046e-26
Identity = 81/275 (29.45%), Postives = 124/275 (45.09%), Query Frame = 1
Query: 2440 NFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGM-INKYIAAQGPLLRTSEDFWQMCWEQ---NTYLIVMLTALSEQGRPKCHKYWPQ--IYETIEFG-----------------DFQISCLVEEYSEDGGFAIRDLMVYRT--VSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPI----------------NLVD-ILQTMRDQRASMIQTPAQFKFVCEA 3138
            N ++NRY +I PY++ RV LK    +DYINAS + + +    +    YIA QGP  +T + FWQMC+     +  +IVM+T L E  R KC++YWP+  + +T+                    D +I   V  +     + + D+ +  T  +    + V H  +  W D   P      +          S    PI+VHCSAG+GRTG  I ++  M      K I                +L++ I+  +R QR  M+QT  QF F+  A
Sbjct:   52 NDARNRYVNIMPYERNRVHLKTLSGNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIE-FVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAHSHSLNS-RGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHA 324          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 56.225 bits (134), Expect = 2.423e-8
Identity = 37/118 (31.36%), Postives = 56/118 (47.46%), Query Frame = 1
Query: 2446 SKNRYRDISPYDQTRVILK-----------NNGSSD------YINASIINM---QINDNGMIN---------KYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYW 2712
            +KNRY+DI PY+ +RVILK           ++ +SD      YINA+ +++    +  N             +YIA Q P+  T  DF+         L++ LT   E G  KC++YW
Sbjct:  529 AKNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMPSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYW 646          

HSP 2 Score: 54.6842 bits (130), Expect = 7.560e-8
Identity = 37/159 (23.27%), Postives = 71/159 (44.65%), Query Frame = 1
Query: 2755 SCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPA----------VHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMC-----------FIEARKPINLVD----ILQTMRDQRASMIQTPAQFKFVCEAIIKVYK 3156
            +C  ++  +D    IR +++     ++   +  +Q  +WPD G             V    I+ ++    +++     I+VHCSAG GRTG L T+++ +            F++ + P  L D     +   R QR SM+Q   QF F+ + ++  ++
Sbjct:  722 ACDDDDDDDDDAILIRKILLTYHDQEKPYELLQIQVKNWPDLGTLLNPISILQAINVKNHIIDTLFARNYYQNDQLPTILVHCSAGCGRTGTLCTIDSILSNFEMFEMLQKEFVKLKYPAKLFDPISWTINIFRKQRISMVQNINQFIFIYDCLLFYFR 880          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW8])

HSP 1 Score: 363.614 bits (932), Expect = 5.238e-110
Identity = 186/489 (38.04%), Postives = 297/489 (60.74%), Query Frame = 1
Query: 1750 KLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYM---------VECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISC-LVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL*IN 3186
            KLD++NF  S          L++S N       A+K+G+   L  + S   +      + +++  D+  R+GF V+  ++   P+I++ I + TPAD+C P+L  GD++I ING+ +  L   E++ +I++ S+S    +IL +RPN +             +TV    ++    ++  E +++++S +      + +  K S++ L  ++E+ D+L  F+ +YRKKPG+ M +A+K EN  KNRYRDI PYD+TRV L     SDYINA+ +NM++  +G++ +YIAAQGPL +T  DFWQM WEQ + L++MLT   E+GR KCH+YWP+  +T  FG+ ++ C  + ++S    +  R++ V  T +   R +  +QY++WPDH VP    +F+ FV+ VR +R G   P VVHCSAG+GR+GVL+ +ETA   IE  +P+  +++++ MRDQR S+IQTP QF FVCEA +K Y D  +R L I+
Sbjct:  418 KLDRTNFKRS----------LSTSANVG-----ATKSGLTPELQANGSTPQEGL----ITVRMEPDKEGRFGFNVQGGADINLPVIVSKIARGTPADLCMPQLQEGDEIIFINGQAMKGLIHQEIVDLIRSVSQSRSNTLILTIRPNVFAPNGSRSLDDSPVHTVSVEQYNAQELKHEKEVEAALVSKREKQQQRDCEGLKVSIEQLRENLESGDLLVYFQELYRKKPGMAMDDARKPENLPKNRYRDILPYDETRVKLFKG--SDYINANFVNMEVPSHGIVLRYIAAQGPLEKTCGDFWQMIWEQESTLVIMLTTTMERGRVKCHQYWPEGEDTWTFGNLEVVCNKIRDFSP--SYVYREMYVTDTTTLRSRVIIQLQYLAWPDHDVPDDATDFLEFVHSVRHYREGTSTPAVVHCSAGVGRSGVLMFIETAFGMIEGAEPVYPLELVRRMRDQRGSLIQTPGQFLFVCEATLKAYDDEVVRPLPIS 883          

HSP 2 Score: 184.882 bits (468), Expect = 6.738e-48
Identity = 116/322 (36.02%), Postives = 177/322 (54.97%), Query Frame = 1
Query:  124 GSYYVAAREEYKHHASN--DLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPS---SGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP 1074
            G Y V   E  +   +N   ++C V LLD +     + K + G  LL+ +F  L++ E+ +FGLQY    P     G   +WL   K I+KQ  G+ PYIF+F V+F+ ++PS++ E+ TRY  +LQ+K+DI   RL C  D  A L SY LQAELGDY+P+ H  GY+SEFRF+ +QT   E + ++ H      +P  AE  +L +A  LD YGVD+  A   D   + +G S+LG +V+ NK +++ F W          K + +  K   F  Q +   + N+ +  +  + + +   CK LW+ CV+YH+F+R   P
Sbjct:   15 GMYSVRGSELARTGNTNPQKIRCVVELLDDSEFIIDVDKNAKGTVLLNEVFRHLDIQEKHYFGLQYVSDSPDNMVGGAKEQWLQDDKIIRKQKKGTPPYIFYFCVRFFVSDPSKLVEDLTRYYFYLQIKRDILTGRLPCLYDTAAELSSYILQAELGDYDPKLHLDGYVSEFRFIPDQTDDFEERAAEFHKHHIGQTPADAEFNFLEVAKTLDLYGVDLHCAKDHDGTDLFLGVSALGLTVYHNKCKINFFPW---------SKIVKVCFKRKRFFIQIR--PDWNEWTDNIIGFQMLTYRSCKNLWKVCVEYHSFYRTHYP 325          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Nematostella
Match: EDO38304 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC7])

HSP 1 Score: 197.208 bits (500), Expect = 2.053e-56
Identity = 101/263 (38.40%), Postives = 152/263 (57.79%), Query Frame = 1
Query: 2374 QQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQ-IYETIEFGD-FQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYK 3156
            ++F+ +   KP       K   N  KNRYR++ PY+ TRV L  +   DYINA+ I + ++D+     YIA QGPL  T++DFWQM WEQ   ++ M+T   E G+ KCH+YWP    + ++ G  F++S L +   +   F  RD+ V    S +   + H+ ++ WPDHGVP    E + FV  +R   +    P+VVHCSAGIGRTG LI ++ A+  +E  KP ++   ++ +R+QR  MIQT  Q+ F  +A ++V K
Sbjct:   34 EEFKDLREIKPTDGCDSGKNQANTDKNRYRNVLPYEATRVRLSGSSGEDYINANHIRVLVDDD--TYHYIATQGPLPNTTKDFWQMIWEQGVEVVAMVTLDKEGGKVKCHRYWPDNTNQPLKLGGRFEVSLLKQTNYDS--FVQRDIAVKHLQSGKSIEIAHLNFVKWPDHGVPRSPVEMVQFVAYMRSLATSQ-APVVVHCSAGIGRTGALIAVDVALGLMERDKPFDINQTIRDLREQRQGMIQTKDQYIFCYKACLEVLK 291          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Nematostella
Match: EDO48949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI09])

HSP 1 Score: 181.415 bits (459), Expect = 7.155e-51
Identity = 105/278 (37.77%), Postives = 151/278 (54.32%), Query Frame = 1
Query: 2332 LKFLENSVENDDIL-QQFESV--YRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILK---NNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQI-YETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMC-FIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAI 3141
            L ++E+ + N + L +++E++  Y  +P +  +  K+ +N  KNRY D+ PYD  RV L+   N   SDYINAS I      N     YIA QGPL  T  DFWQM WEQ   +IV LT LS+ G P+CH+YWP+  +ET    +     LV E+     + +R   +    + E R V    ++SWPD  VP      + F  KV K   G   PIVVHCS G+GRTG  I ++  +   +   K I++   ++ +RDQR  M++T AQF+F   A+
Sbjct:   18 LSYMEDHLSNKNRLNKEWEALCNYEAEPSVADL-GKQDKNVRKNRYSDVLPYDHNRVSLRETANATGSDYINASFITDHDPRNP---AYIATQGPLAHTVSDFWQMVWEQGVVVIVNLTRLSDLGLPQCHRYWPEDGHETYHIYEVH---LVSEHIWCDDYLVRSFYLKNLQTSETRTVTQFHFLSWPDLNVPTTPKPLLEFRRKVNKCFRGRSCPIVVHCSGGVGRTGCYILIDLVLNKMMRGAKEIDIAATVEHLRDQRPHMVKTKAQFEFALTAV 288          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Nematostella
Match: EDO30224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E3])

HSP 1 Score: 177.948 bits (450), Expect = 2.367e-48
Identity = 124/388 (31.96%), Postives = 198/388 (51.03%), Query Frame = 1
Query:  292 RDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIR-TPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNS 1452
            +++FGL+Y D        + WL G +SIK+Q+ G  P  F+F VKFYP NP+ ++E+ TRY   LQL++D+   R+ C+  + A+L SY +QAELGD +P++H+  Y+S+ +F   Q P L  KI   H K    +P+ AE +YL+   +L  YG D++ A   + + V I  S+ G  VF+N ++MH F+W  I  I FK KK ++ +++    D +K        S  +Y +   S    K +W+ CV++H FFR+K P            K +NFF I     + GR         Q ++R  +   +R  PS +R  + S+  S      +R S  +     KE K+    +T     Q+  +       D KP+T + + D +
Sbjct:   46 KEYFGLRYIDEKDGQ---FNWLEGDRSIKRQM-GKAPLHFYFAVKFYPENPTTLREDITRYQFVLQLREDLLKGRIQCSNPIHALLASYVMQAELGDLHPEEHEVAYLSDLKFFPKQPPELRQKIEAFHRKHVGMTPSDAEFQYLDNVRKLPLYGRDMYQAWGDEGQAVTIAISAWGVEVFQNNRQMHRFVWPKIISIGFKSKKFSLTLRAPSEDDYYK--------STTIY-FKCGSQRAAKRVWKVCVEHHAFFRLKEP--------VPLPKNTNFFKIGSKFRYSGR--------TQHQARNNESVGVREQPSFDR--VSSKRFSLRVLDSNRKSMLIDDDAKKEPKSPEHPVTPVEPAQEEKKE------DEKPVTDSQEPDQT 396          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Nematostella
Match: EDO41632 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S419])

HSP 1 Score: 168.703 bits (426), Expect = 3.103e-47
Identity = 93/252 (36.90%), Postives = 140/252 (55.56%), Query Frame = 1
Query: 2425 AKKTENFSKNRYRDISPYDQTRVILKNN-GSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWP-----QIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRK--FRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDI---LQTMRDQRASMIQTPAQFKFVCEAIIK 3147
            AK   N   NRYRD+ PYD +R+IL++    +DYINA+++        +  +YI AQGPL  T++ FWQM WE N+  ++ML  + E+ + KC +YWP          +E   FQI  + E  SE+  F +R L +    +KE R V H  Y++WPD GVP     F++F+++ R     S    P V+HCSAGIGR+G  + +++ +  +     +N VD+   L   R  R  +IQTP Q +F   AI++
Sbjct:    1 AKLPANRPLNRYRDVLPYDHSRIILESTQNGTDYINANLVEFP----ELGKRYILAQGPLPHTADHFWQMVWENNSKAVIMLNKVMEKNQIKCFQYWPCGERYAHVNCLELDSFQIKYITENRSEE--FTVRILELENKKTKETRVVYHYHYLTWPDFGVPKAPGYFLSFLFECRNAGVLSSDVGPAVIHCSAGIGRSGTFVMIDSILAEVSTGN-LNAVDLGERLLAARQYRVGLIQTPDQLRFTSIAILE 245          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Medaka
Match: ptpn4a (protein tyrosine phosphatase non-receptor type 4 [Source:NCBI gene;Acc:101171899])

HSP 1 Score: 412.92 bits (1060), Expect = 1.193e-126
Identity = 201/422 (47.63%), Postives = 285/422 (67.54%), Query Frame = 1
Query: 1912 YDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPN-NYMVECNTVESSDWDFS-ITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIR 3171
            +DN ++IK+R D + R+GF V+   ++K PII++ +   T AD+C PRLN GDQ++ ING ++   T D+V+  IK S ES  G++IL VRPN NY V     ES + DF  I E           +  D    +    ++S+  L   + +  +L QF+ +YRK+PG+TM+ AK  +N SKNRYRDISPYD TRV+LK+  + DYINA+ INM+I  + +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP    +  +GDF ++CL EE S    F +R++ +    S ++R +  +QY++WPDHGVP    +F++FV  VR  R+G  +P+VVHCSAGIGRTGVLITMETA+C +E  +P+  +DI++TMRDQRA MIQTP+Q++FVCEAI+KVY++  ++
Sbjct:  516 HDNLVLIKMRPDEHGRFGFNVKGGVDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGRDISDHTHDQVVMFIKASCESHSGELILLVRPNANYDVVEEKAES-EPDFQYIPEK----------TPQDPAQVDQHALRDSMSVLREGLSSGAVLSQFDQLYRKRPGMTMLCAKLPQNVSKNRYRDISPYDATRVLLKS--TDDYINANYINMEIPASSLINRYIACQGPLPTTCSDFWQMTWEQASSMVVMLTTQVERGRVKCHQYWPNPDSSATYGDFAVTCLNEEGS--AAFLVREMTLTDVKSGQQRELTQIQYLAWPDHGVPDDSTDFLDFVALVRSKRAGQDQPVVVHCSAGIGRTGVLITMETALCLMECGQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGLVQ 922          

HSP 2 Score: 206.453 bits (524), Expect = 4.681e-54
Identity = 136/373 (36.46%), Postives = 197/373 (52.82%), Query Frame = 1
Query:  121 GGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVP-PNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPS 1236
            G SY V A E  +      + C V+LLD +V+ F + K   G  LLD +F  LEL ERD+FGL   D    +    +WL+  K I+KQL    P+   FRVKF+  +PS+++EEYTRY  FLQ+K+DI   RL C  +  A+L SYA+Q+ELGDYN  +H SGY+SE+ F+         ++S  H +    +P +AE  YLN A  L+ YGV++  A       + +G  S G  V++N+ R +LF W          K + I  KS  F  Q +      + + L +  V   +  CK LW+ CV++HTFFR++ P P      A+  S GS +        +CGR  + +++   K     DR F R+PS
Sbjct:   10 GRSYNVRATELERDRQHTQVVCNVLLLDNSVQAFRVSKSDHGQVLLDAVFRHLELTERDYFGLHVADD---ASDAPRWLDPNKPIRKQLKRGSPHSLSFRVKFFVTDPSKLQEEYTRYQYFLQIKQDILTGRLPCPNNTAALLASYAVQSELGDYNEAEHSSGYLSEYCFIPAPPQDFHKEVSKHHQQHSGLTPAQAEFNYLNTARTLELYGVELHYARDQRNAEILMGVMSAGVVVYQNRVRKNLFQW---------LKIVKISFKSKQFFIQLRREATETRETLLGFNMVNYRA--CKNLWKACVEHHTFFRLEQPIPPQKNFFAHYFSLGSKY-------RYCGRTEVQSVQ-YGKEKAVKDRVFARSPS 360          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Medaka
Match: ptpn4a (protein tyrosine phosphatase non-receptor type 4 [Source:NCBI gene;Acc:101171899])

HSP 1 Score: 420.239 bits (1079), Expect = 1.123e-125
Identity = 201/422 (47.63%), Postives = 285/422 (67.54%), Query Frame = 1
Query: 1912 YDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPN-NYMVECNTVESSDWDFS-ITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIR 3171
            +DN ++IK+R D + R+GF V+   ++K PII++ +   T AD+C PRLN GDQ++ ING ++   T D+V+  IK S ES  G++IL VRPN NY V     ES + DF  I E           +  D    +    ++S+  L   + +  +L QF+ +YRK+PG+TM+ AK  +N SKNRYRDISPYD TRV+LK+  + DYINA+ INM+I  + +IN+YIA QGPL  T  DFWQM WEQ + ++VMLT   E+GR KCH+YWP    +  +GDF ++CL EE S    F +R++ +    S ++R +  +QY++WPDHGVP    +F++FV  VR  R+G  +P+VVHCSAGIGRTGVLITMETA+C +E  +P+  +DI++TMRDQRA MIQTP+Q++FVCEAI+KVY++  ++
Sbjct:  991 HDNLVLIKMRPDEHGRFGFNVKGGVDQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGRDISDHTHDQVVMFIKASCESHSGELILLVRPNANYDVVEEKAES-EPDFQYIPEK----------TPQDPAQVDQHALRDSMSVLREGLSSGAVLSQFDQLYRKRPGMTMLCAKLPQNVSKNRYRDISPYDATRVLLKS--TDDYINANYINMEIPASSLINRYIACQGPLPTTCSDFWQMTWEQASSMVVMLTTQVERGRVKCHQYWPNPDSSATYGDFAVTCLNEEGS--AAFLVREMTLTDVKSGQQRELTQIQYLAWPDHGVPDDSTDFLDFVALVRSKRAGQDQPVVVHCSAGIGRTGVLITMETALCLMECGQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGLVQ 1397          

HSP 2 Score: 188.734 bits (478), Expect = 3.771e-48
Identity = 127/346 (36.71%), Postives = 188/346 (54.34%), Query Frame = 1
Query:  205 GNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVK--VPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPS 1236
            G+    +LQK   G  LLD +F  LEL ERD+FGL   D    +    +WL+  K I+KQL    P+   FRVKF+  +PS+++EEYTRY  FLQ+K+DI   RL C  +  A+L SYA+Q+ELGDYN  +H SGY+SE+ F+         ++S  H +    +P +AE  YLN A  L+ YGV++  A       + +G  S G  V++N+ R +LF W  I KISFK K+         F  Q +      + + L +  V   +  CK LW+ CV++HTFFR++  +PP         K+  +++F +     +CGR  + +++   K     DR F R+PS
Sbjct:  513 GDWSPGSLQKSDHGQVLLDAVFRHLELTERDYFGLHVADD---ASDAPRWLDPNKPIRKQLKRGSPHSLSFRVKFFVTDPSKLQEEYTRYQYFLQIKQDILTGRLPCPNNTAALLASYAVQSELGDYNEAEHSSGYLSEYCFIPAPPQDFHKEVSKHHQQHSGLTPAQAEFNYLNTARTLELYGVELHYARDQRNAEILMGVMSAGVVVYQNRVRKNLFQWLKIVKISFKSKQ---------FFIQLRREATETRETLLGFNMVNYRA--CKNLWKACVEHHTFFRLEQPIPPQ--------KNFFAHYFSLGSKYRYCGRTEVQSVQ-YGKEKAVKDRVFARSPS 835          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Medaka
Match: ptpn3 (protein tyrosine phosphatase non-receptor type 3 [Source:NCBI gene;Acc:101169482])

HSP 1 Score: 318.931 bits (816), Expect = 2.108e-93
Identity = 164/428 (38.32%), Postives = 251/428 (58.64%), Query Frame = 1
Query: 1903 DRFYDNDLM-IKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIIL--------KVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKD 3159
            D   D DLM I +  D   ++GF V+   ++K P+ ++ I  ++PA    P+L  GD ++ ING ++   T D+V+  I+ S ES    + L        +V P+  +    T+     D      G                  +   +ES++ LE  +++  +   FE++YR+KPG++   ++  EN  KNRYRD+ PYD TRV+L++    DYINAS I +   ++G+  +YIAAQGPL +T   FWQ  WEQ  + ++MLT L+E+GR KCH+YWP   +  ++G   + C  EE   +  +  R   +  T   +ER + H+QY++WPDHGVP    +F+ FV  VR+ R    EP++VHCSAGIGRTGVLI META+  ++  +P+  ++I++TMRDQRA M+QT +QF+FVCEAI++VYK+
Sbjct:  458 DALGDGDLMLICITPDHEGKFGFNVKGGVDQKMPLSVSHIKPDSPAGRSEPKLMEGDLIVLINGRDISEHTHDQVVMFIRASRESHSRQLALLIKRKGSGRVAPSLQLPPTLTLTIPSHDSKPQSPGQSE--------------RVKTLEESMRQLERGIQSGTLCFHFENLYRRKPGMSQDCSRLPENQEKNRYRDVLPYDATRVVLQSQ--EDYINASHITVAPPESGVCLQYIAAQGPLPQTCTHFWQTVWEQQIHTVIMLTTLTERGRTKCHQYWPHPPKAKDYGHMSVECHSEEC--NLAYVTRRFTLKHTQLGDERAITHLQYVAWPDHGVPDDPSDFLQFVSSVRETRDK--EPLMVHCSAGIGRTGVLIIMETALTLMDGGQPVFPLEIVKTMRDQRAMMVQTTSQFQFVCEAILRVYKE 865          

HSP 2 Score: 154.451 bits (389), Expect = 6.543e-38
Identity = 108/302 (35.76%), Postives = 167/302 (55.30%), Query Frame = 1
Query:  175 DLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYY------KWLNGAKSIKKQLTG-SQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFF 1059
            DL C V LLDG +E F + K+  G  LL L+FD L L ER  F LQ ++S  +   +       +WL   K +KKQ+ G   P+  +FRV+F+ ++P+ ++ + TR+L FLQ++ DI + RL C  +   +L SYA+Q+E+GD+ P +   GY+S+  F+  Q      K+ DLH + K    + AE  +LN A  L+ YGV++  A+  +   + +G +S G ++F N      F W  I KISFK+K+  + +K  H        E  +   PL+    L     CK LW++CVD+H+FF
Sbjct:    5 DLLCLVQLLDGTIETFRVSKQDEGEVLLSLVFDHLGLQERQLFSLQIRESSTAIASFTANTHSPRWLEPEKPLKKQIKGLVSPFYLNFRVRFFISDPNSLQHDQTRHLYFLQIRSDIREGRLQCPLNAAVVLASYAVQSEIGDHCPSR-APGYLSKCHFMPEQNEDFLSKVEDLHPQHKGLKQSDAELCFLNTARTLELYGVELHAAMDTNNTPLMVGLTSSGVAIFCNMVCSSFFPWGKIIKISFKRKRFFLHLKQKH-------GETQDCEVPLL----LLCPKTCKNLWRSCVDHHSFF 294          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Medaka
Match: ptpn3 (protein tyrosine phosphatase non-receptor type 3 [Source:NCBI gene;Acc:101169482])

HSP 1 Score: 243.047 bits (619), Expect = 4.980e-67
Identity = 141/428 (32.94%), Postives = 217/428 (50.70%), Query Frame = 1
Query: 1903 DRFYDNDLM-IKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIIL--------KVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKD 3159
            D   D DLM I +  D   ++GF V+   ++K P+ ++ I  ++PA    P+L  GD ++ ING ++   T D+V+  I+ S ES    + L        +V P+  +    T+     D      G                  +   +ES++ LE  +++  +   FE++YR+KPG++   ++  EN  KNRYRD+ PYD TRV+L++    DYINAS I                                                   KCH+YWP   +  ++G   + C  EE   +  +  R   +  T   +ER + H+QY++WPDHGVP    +F+ FV  VR+ R    EP++VHCSAGIGRTGVLI META+  ++  +P+  ++I++TMRDQRA M+QT +QF+FVCEAI++VYK+
Sbjct:  458 DALGDGDLMLICITPDHEGKFGFNVKGGVDQKMPLSVSHIKPDSPAGRSEPKLMEGDLIVLINGRDISEHTHDQVVMFIRASRESHSRQLALLIKRKGSGRVAPSLQLPPTLTLTIPSHDSKPQSPGQSE--------------RVKTLEESMRQLERGIQSGTLCFHFENLYRRKPGMSQDCSRLPENQEKNRYRDVLPYDATRVVLQSQ--EDYINASHITT-------------------------------------------------KCHQYWPHPPKAKDYGHMSVECHSEEC--NLAYVTRRFTLKHTQLGDERAITHLQYVAWPDHGVPDDPSDFLQFVSSVRETRDK--EPLMVHCSAGIGRTGVLIIMETALTLMDGGQPVFPLEIVKTMRDQRAMMVQTTSQFQFVCEAILRVYKE 816          

HSP 2 Score: 154.836 bits (390), Expect = 4.921e-38
Identity = 108/302 (35.76%), Postives = 167/302 (55.30%), Query Frame = 1
Query:  175 DLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYY------KWLNGAKSIKKQLTG-SQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFF 1059
            DL C V LLDG +E F + K+  G  LL L+FD L L ER  F LQ ++S  +   +       +WL   K +KKQ+ G   P+  +FRV+F+ ++P+ ++ + TR+L FLQ++ DI + RL C  +   +L SYA+Q+E+GD+ P +   GY+S+  F+  Q      K+ DLH + K    + AE  +LN A  L+ YGV++  A+  +   + +G +S G ++F N      F W  I KISFK+K+  + +K  H        E  +   PL+    L     CK LW++CVD+H+FF
Sbjct:    5 DLLCLVQLLDGTIETFRVSKQDEGEVLLSLVFDHLGLQERQLFSLQIRESSTAIASFTANTHSPRWLEPEKPLKKQIKGLVSPFYLNFRVRFFISDPNSLQHDQTRHLYFLQIRSDIREGRLQCPLNAAVVLASYAVQSEIGDHCPSR-APGYLSKCHFMPEQNEDFLSKVEDLHPQHKGLKQSDAELCFLNTARTLELYGVELHAAMDTNNTPLMVGLTSSGVAIFCNMVCSSFFPWGKIIKISFKRKRFFLHLKQKH-------GETQDCEVPLL----LLCPKTCKNLWRSCVDHHSFF 294          
BLAST of Tyrosine-protein phosphatase vs. Ensembl Medaka
Match: ptpn20 (protein tyrosine phosphatase non-receptor type 20 [Source:ZFIN;Acc:ZDB-GENE-090313-90])

HSP 1 Score: 200.675 bits (509), Expect = 2.321e-56
Identity = 111/279 (39.78%), Postives = 159/279 (56.99%), Query Frame = 1
Query: 2323 KESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYET-IEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYK 3156
            K  ++ L++ ++  +++++F ++   KP    +  K  EN  KNRYRDI PYD+TRV L  N   DYINAS I MQ+        YI+ QGPL  T   FWQM WE  + +I M+T   E+GR KCHKYWP+  +  ++ G  Q+    ++Y E   F I+ + +    + E   V H+++  WPDHGVP    E + F+  +R     H  PI VHCSAGIGRTGVLI  +  +  IE    IN+ DI++ MR QR  MIQT  Q+ F  +  ++V +
Sbjct:   81 KALVQILQHQLDQQELVKEFMALEHLKPSDDCLVGKAPENREKNRYRDILPYDKTRVKLGEN--QDYINASYIRMQVGAEEFF--YISCQGPLPSTVPAFWQMIWENKSDVIAMMTQELERGRIKCHKYWPEKQDVPLDTGKHQLFLENQQYLE--YFHIKVIRIVEVKTGETHFVHHLKFTHWPDHGVPHCSEELVRFIRYMRALH--HRGPITVHCSAGIGRTGVLICTDIILNLIERDLNINVSDIVKEMRLQRHGMIQTKEQYLFCYKVWLEVLQ 351          
BLAST of Tyrosine-protein phosphatase vs. Planmine SMEST
Match: SMESG000022143.1 (SMESG000022143.1)

HSP 1 Score: 2003.41 bits (5189), Expect = 0.000e+0
Identity = 1020/1021 (99.90%), Postives = 1021/1021 (100.00%), Query Frame = 1
Query:  115 MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCLLDLIFDTLELLERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCN+DMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWSSIFKISFKKKKITIQIKSTHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGSESKSSIISSKPDILSSNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL
Sbjct:    1 MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCLLDLIFDTLELLERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNQDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWSSIFKISFKKKKITIQIKSTHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGSESKSSIISSKPDILSSNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 1021          
BLAST of Tyrosine-protein phosphatase vs. Planmine SMEST
Match: SMESG000022143.1 (SMESG000022143.1)

HSP 1 Score: 1988 bits (5149), Expect = 0.000e+0
Identity = 1019/1046 (97.42%), Postives = 1020/1046 (97.51%), Query Frame = 1
Query:  115 MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIR-------------------------TPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCLLDLIFDTLELLERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCN+DMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWSSIFKISFKKKKITIQIKSTHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFI                          TPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGSESKSSIISSKPDILSSNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL
Sbjct:    1 MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCLLDLIFDTLELLERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNQDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWSSIFKISFKKKKITIQIKSTHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFISEPSNILSIIRFVIQRYAYICEVVFMTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGSESKSSIISSKPDILSSNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 1046          
BLAST of Tyrosine-protein phosphatase vs. Planmine SMEST
Match: SMESG000022143.1 (SMESG000022143.1)

HSP 1 Score: 1966.43 bits (5093), Expect = 0.000e+0
Identity = 1002/1021 (98.14%), Postives = 1008/1021 (98.73%), Query Frame = 1
Query:  115 MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWXXXXXXXXXXXXXXXXXXXXHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 3177
            MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCLLDLIFDTLELLERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCN+DMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMK  S  +AE EYL    ++DYYG  ++  LTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWSSIFKISFKKKKITIQIKSTHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGSESKSSIISSKPDILSSNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL
Sbjct:    1 MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCLLDLIFDTLELLERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNQDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKQLSQGEAEFEYLRTVCQMDYYGALLYTCLTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWSSIFKISFKKKKITIQIKSTHFVDQFKNNEESNKSSPLMYTYVLSSSPLCKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRRTMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLSSMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDGNEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPLNYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKSNFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFYDNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNTVESSDWDFSITENGSESKSSIISSKPDILSSNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVYKDSDIRAL 1021          
BLAST of Tyrosine-protein phosphatase vs. Planmine SMEST
Match: SMESG000022143.1 (SMESG000022143.1)

HSP 1 Score: 400.208 bits (1027), Expect = 5.688e-132
Identity = 203/223 (91.03%), Postives = 209/223 (93.72%), Query Frame = 1
Query:  115 MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCXXXXXXXXXXXXXRDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAEREYLNIASELDYYGVDIFNALTL 783
            MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCLLDLIFDTLELLERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCN+DMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMK  S  +AE EYL    ++DYYG  ++  L L
Sbjct:    1 MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCLLDLIFDTLELLERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNQDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKQLSQGEAEFEYLRTVCQMDYYGALLYTCLVL 223          
BLAST of Tyrosine-protein phosphatase vs. Planmine SMEST
Match: SMESG000023435.1 (SMESG000023435.1)

HSP 1 Score: 330.102 bits (845), Expect = 4.079e-102
Identity = 179/427 (41.92%), Postives = 269/427 (63.00%), Query Frame = 1
Query: 1891 SHSTDRFYDNDLMIKLRCDR-NRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNVGDQLISINGENVDHLTQDEVISIIKNSSESGCGDII-LKVRPNNYMVECNTVESSDWDFSITENGXXXXXXXXXXXXXXXXXNLDPFKESLKFLENSVENDDILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQI---NDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFG-DFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAIIKVY 3153
            + STD+  D D  +++     + +YGFT++   + KSP+I+  +G NT AD CFP+L  GDQ+I IN E  D LT DE+  IIK++      +++ L V+P  Y+         + D   + N +E     +   P     N    + ++K LE+S+++   +Q FE +Y++K GLTM EAKK+EN +KNRY+DI PYDQTR+++KN   SDYINA+II + I    ++  + KYIA+QGP++ TS DF  M WE  + L+VMLT L E+GR KC+KYWP   ET++     QI C  E+  +   F +R+  + +  S E R+  H+QYI+WPDH VP    +F+ F+  +R+ RS   EPIVVHCSAGIGRTGV+ITM+ A+ ++E ++  +++ I++ +R+QRA +IQ+  Q++FVC AII  Y
Sbjct:   49 TQSTDKLIDTDTRVEIAMRPIDSKYGFTIKGGCDSKSPVIVTKVGPNTAADQCFPKLCEGDQIIKINDEFADELTNDEIKEIIKSTGSMKKDNVLNLVVKPRLYL---------NVDEHASSNNTEEDEDSLPPLPRKNLVN--DIRLTIKSLEDSLKDGSAVQVFEKLYKQKQGLTMNEAKKSENINKNRYKDILPYDQTRIVIKN---SDYINANIIKVDIPKSPNSTTVFKYIASQGPMVHTSSDFITMIWENKSELVVMLTDLLEKGRSKCYKYWPDQGETLKLQHGLQIFCESEKCID--TFVLREFRLKK--SNETRKFTHLQYINWPDHDVPIKMDDFLAFMKMIRQIRSSRSEPIVVHCSAGIGRTGVVITMDIAISYLEMKQSFSVLSIVKDIRNQRAMLIQSQKQYEFVCRAIIYYY 457          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPN42.663e-12446.71protein tyrosine phosphatase non-receptor type 4 [... [more]
PTPN34.050e-10942.82protein tyrosine phosphatase non-receptor type 3 [... [more]
PTPN31.199e-10842.82protein tyrosine phosphatase non-receptor type 3 [... [more]
PTPN32.923e-10742.82protein tyrosine phosphatase non-receptor type 3 [... [more]
PTPN41.692e-6850.70protein tyrosine phosphatase non-receptor type 4 [... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-11.520e-12544.92Tyrosine-protein phosphatase 1 [Source:UniProtKB/... [more]
ptp-11.520e-12544.92Tyrosine-protein phosphatase 1 [Source:UniProtKB/... [more]
ptp-11.520e-12544.92Tyrosine-protein phosphatase 1 [Source:UniProtKB/... [more]
ptp-17.117e-12544.92Tyrosine-protein phosphatase 1 [Source:UniProtKB/... [more]
ptp-17.117e-12544.92Tyrosine-protein phosphatase 1 [Source:UniProtKB/... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptpmeg1.927e-6836.54gene:FBgn0261985 transcript:FBtr0306563[more]
Ptpmeg1.927e-6836.54gene:FBgn0261985 transcript:FBtr0306559[more]
Ptpmeg1.927e-6836.54gene:FBgn0261985 transcript:FBtr0306560[more]
Ptpmeg1.927e-6836.54gene:FBgn0261985 transcript:FBtr0306561[more]
Ptpmeg1.927e-6836.54gene:FBgn0261985 transcript:FBtr0306562[more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn4a0.000e+037.60protein tyrosine phosphatase non-receptor type 4a ... [more]
ptpn4a0.000e+037.50protein tyrosine phosphatase non-receptor type 4a ... [more]
ptpn4a0.000e+037.64protein tyrosine phosphatase non-receptor type 4a ... [more]
ptpn4a0.000e+037.02protein tyrosine phosphatase non-receptor type 4a ... [more]
ptpn4a0.000e+036.72protein tyrosine phosphatase non-receptor type 4a ... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mon23.448e-10842.11MON2 homolog, regulator of endosome-to-Golgi traff... [more]
mon21.285e-10643.32MON2 homolog, regulator of endosome-to-Golgi traff... [more]
mon25.219e-10643.32MON2 homolog, regulator of endosome-to-Golgi traff... [more]
mon24.004e-10244.36MON2 homolog, regulator of endosome-to-Golgi traff... [more]
mon28.441e-10244.36MON2 homolog, regulator of endosome-to-Golgi traff... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptpn45.093e-12646.82protein tyrosine phosphatase, non-receptor type 4 ... [more]
Ptpn38.194e-10840.81protein tyrosine phosphatase, non-receptor type 3 ... [more]
Ptpn45.564e-5937.00protein tyrosine phosphatase, non-receptor type 4 ... [more]
Ptpn146.644e-5034.78protein tyrosine phosphatase, non-receptor type 14... [more]
Epb41l51.340e-4938.44erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WU22|PTN4_MOUSE3.563e-12546.82Tyrosine-protein phosphatase non-receptor type 4 O... [more]
sp|P29074|PTN4_HUMAN1.279e-12346.71Tyrosine-protein phosphatase non-receptor type 4 O... [more]
sp|P28191|PTP1_CAEEL2.782e-11944.92Tyrosine-protein phosphatase 1 OS=Caenorhabditis e... [more]
sp|A2ALK8|PTN3_MOUSE5.732e-10740.81Tyrosine-protein phosphatase non-receptor type 3 O... [more]
sp|P26045|PTN3_HUMAN1.404e-10642.82Tyrosine-protein phosphatase non-receptor type 3 O... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A498ND050.000e+037.69Tyrosine-protein phosphatase OS=Labeo rohita OX=84... [more]
F1QBE00.000e+037.60Tyrosine-protein phosphatase OS=Danio rerio OX=795... [more]
B3DHD00.000e+037.50Tyrosine-protein phosphatase OS=Danio rerio OX=795... [more]
A0A2R8QJY80.000e+037.50Tyrosine-protein phosphatase OS=Danio rerio OX=795... [more]
A0A5S6QT600.000e+035.95Uncharacterized protein OS=Trichuris muris OX=7041... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn4a2.029e-12947.64protein tyrosine phosphatase non-receptor type 4a ... [more]
ptpn4b1.131e-12446.88protein tyrosine phosphatase non-receptor type 4b ... [more]
ptpn34.276e-9840.29protein tyrosine phosphatase non-receptor type 3 [... [more]
ptpn201.031e-5239.70protein tyrosine phosphatase non-receptor type 20 ... [more]
ptpn217.858e-5235.25protein tyrosine phosphatase non-receptor type 21 ... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001312.11.271e-10943.68pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
ENSPMAT00000006520.12.672e-5033.78pep scaffold:Pmarinus_7.0:GL476919:12935:65469:-1 ... [more]
ENSPMAT00000006037.12.770e-5035.52pep scaffold:Pmarinus_7.0:GL477253:2:79428:1 gene:... [more]
ptpn2b5.485e-5039.76protein tyrosine phosphatase non-receptor type 2b ... [more]
ENSPMAT00000009934.19.617e-4934.43pep scaffold:Pmarinus_7.0:GL479331:74:24469:1 gene... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PTP16.046e-2629.45Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP32.423e-831.36Phosphotyrosine-specific protein phosphatase; invo... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448235.238e-11038.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383042.053e-5638.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489497.155e-5137.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302242.367e-4831.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416323.103e-4736.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn4a1.193e-12647.63protein tyrosine phosphatase non-receptor type 4 [... [more]
ptpn4a1.123e-12547.63protein tyrosine phosphatase non-receptor type 4 [... [more]
ptpn32.108e-9338.32protein tyrosine phosphatase non-receptor type 3 [... [more]
ptpn34.980e-6732.94protein tyrosine phosphatase non-receptor type 3 [... [more]
ptpn202.321e-5639.78protein tyrosine phosphatase non-receptor type 20 ... [more]
back to top
BLAST of Tyrosine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022143.10.000e+099.90SMESG000022143.1[more]
SMESG000022143.10.000e+097.42SMESG000022143.1[more]
SMESG000022143.10.000e+098.14SMESG000022143.1[more]
SMESG000022143.15.688e-13291.03SMESG000022143.1[more]
SMESG000023435.14.079e-10241.92SMESG000023435.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004511 ID=SMED30004511|Name=Tyrosine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=3301bp
TCCGATCTGTTTTTCAAAATTTTCGTTTGCATTTATATTTAATAAATCTG
TTTTTTACTTTTCTTATGATACTAAATATGTATTTATAATTTTCATTGCT
TATATTCATTGAAAATGCTTGGAGGAAGTTATTATGTAGCAGCTAGGGAA
GAATATAAGCATCATGCTAGTAATGACTTGAAGTGCCAAGTTGTTCTTCT
TGATGGTAATGTAGAATTCTTCACCTTACAAAAAAAATCGTGTGGTCACT
GTCTTTTGGACTTAATTTTTGATACTCTTGAATTATTGGAAAGAGATTTT
TTTGGATTGCAATATAAAGATTCTCATCCATCTAGTGGAAAATATTATAA
ATGGTTAAATGGTGCCAAATCAATAAAAAAGCAGTTAACAGGGAGTCAGC
CTTATATTTTCCACTTTAGAGTGAAATTTTATCCCAATAATCCTAGTCAA
ATGAAAGAAGAATATACAAGGTATCTACTTTTCTTGCAATTGAAGAAAGA
TATATTTGATGAAAGATTGCACTGCAATAAAGATATGGTAGCTATATTAG
GAAGTTATGCTTTGCAAGCTGAATTAGGTGATTATAATCCTCAACAACAT
AAATCCGGGTACATTTCTGAATTCAGATTTGTAAAAAATCAAACTCCTGT
ATTAGAATTGAAGATATCGGATCTCCATATGAAAATGAAAAATTTTTCTC
CAACCAAAGCCGAAAGGGAATATTTGAATATTGCTAGTGAATTGGATTAT
TATGGTGTTGATATTTTCAATGCATTGACTCTCGATAAAGAAATTGTGCA
AATTGGGCCTTCTTCGTTAGGATTCAGTGTTTTCAAAAATAAGAAGAGAA
TGCATTTGTTTTTATGGAGCAGTATCTTTAAAATTTCATTCAAAAAGAAG
AAAATTACTATTCAAATTAAAAGCACACATTTTGTCGATCAGTTCAAAAA
TAACGAGGAATCTAATAAATCCTCTCCTCTTATGTATACATATGTTCTCA
GTTCTTCTCCTTTGTGTAAAACCTTGTGGCAAAATTGTGTTGATTATCAC
ACATTTTTTCGTGTAAAAGTTCCGCCAAATAATTCTCAAATCAAAGCCAA
CACAAAATCCAAAGGATCTAATTTCTTCGGAATCTCAATCACACCAGCAT
TTTGCGGTCGCCGTACTATGCCAACTATTGAAGATATTCAAAAACGATCT
CGCACAACAGATAGAACATTTATTAGGACTCCTAGCACAAATAGAAAGCA
ATTGCTTTCCAGGAATAATTCTAATAACCATTCTGCTGTTAGTCGCAGTT
CAGGAACTCTATCATCAATGAAATTAAAAGAGACAAAAAACAAAATTCAG
TTACTGACAAAGTTTAATTCATTCCAAGATCGATCTCAATCTCCATCTCA
CAATTCTTTGGATTATAAACCTTTAACTGCAACATTTGACAGTGATAACA
GTAGTGTAGATGGCAATGAAATAGATTTATATGAATACAAGGACGGATTT
CATGATTCTGGAACATTCTTTCTCTCAGACAATTATCTCAACGACCATCG
CGACAAAGATAGGTCTATATCTGTCGAAAGAAATAGTTACAGGACTGATT
TGGCTTCACCCCTAAACTATATTTATCGCTCAAGTGAAAATAATAAGAAT
TCACGATTTGAAAAAGAAAAATCTATCGACGAGTCATCAAATAATGTATC
TGATAAATTAATTTGTTCAAATTCAAGTATGGAATCATTATCAGAAATAA
AGTTGGACAAATCGAATTTTTCTGCTTCCAATGAAAAACGAATTCCATAT
TTTTCCCGATTAGCCAGTAGTGTAAATTTTAATAAATTCAAACCTTTCGC
ATCGAAAAATGGTATCATAAAGTCTTTGCATATTGATCGCAGCCATAGCA
CTGATAGATTTTATGATAATGATTTAATGATAAAATTACGGTGCGATCGT
AATCGAAGGTATGGGTTCACGGTTCGGAGCACTTCAGAACGGAAGTCACC
TATAATTATCAACTTTATTGGAAAGAATACTCCAGCAGATATGTGTTTTC
CTCGTTTAAATGTTGGAGATCAACTAATATCAATCAATGGGGAAAATGTT
GACCATTTAACTCAGGATGAGGTTATTTCAATTATAAAAAACAGTTCTGA
ATCCGGTTGTGGTGATATCATTCTCAAAGTTCGACCGAATAACTACATGG
TTGAGTGTAATACCGTTGAATCTTCCGATTGGGATTTTTCAATTACTGAA
AATGGATCTGAAAGTAAATCTTCCATTATCAGTTCCAAACCAGATATTTT
GTCTTCTAATCTCGATCCCTTTAAAGAATCATTGAAATTTTTAGAAAATT
CAGTCGAAAATGATGATATTCTTCAGCAATTTGAGAGTGTTTATCGAAAA
AAACCAGGACTTACGATGATGGAAGCGAAAAAAACCGAAAATTTTTCCAA
AAATCGCTATAGAGATATTTCACCTTATGATCAAACTCGAGTAATTTTGA
AAAATAATGGCTCTTCGGATTATATAAATGCTAGTATTATAAATATGCAA
ATAAATGATAACGGAATGATAAACAAATATATTGCTGCTCAAGGTCCACT
ATTAAGGACTTCAGAAGACTTTTGGCAGATGTGTTGGGAACAGAATACTT
ATTTAATTGTAATGCTTACTGCACTGTCTGAGCAAGGTCGTCCAAAATGC
CATAAATATTGGCCACAAATATACGAAACAATAGAATTTGGAGATTTTCA
AATCAGTTGCCTAGTCGAGGAATATTCAGAAGATGGGGGTTTTGCGATCA
GAGATTTGATGGTTTATCGAACAGTGAGCAAAGAGGAAAGACGAGTTCAA
CACATGCAATACATTAGTTGGCCAGATCATGGAGTGCCTGCTGTCCATTA
TGAATTTATCAACTTTGTATACAAAGTTAGGAAATTCAGATCAGGACATT
TTGAACCGATTGTTGTCCATTGTTCAGCGGGAATAGGAAGAACTGGTGTC
CTAATAACAATGGAAACTGCTATGTGTTTTATCGAAGCTAGAAAACCGAT
AAACCTTGTCGACATTCTTCAAACCATGAGAGATCAAAGAGCTAGCATGA
TACAAACACCAGCTCAGTTCAAATTCGTTTGTGAGGCAATAATAAAAGTG
TATAAAGACAGTGATATCAGAGCATTATAAATAAATTACTTCCAGAGCAA
TATATTTCCTTTAATATTAGTTCCGATGACTTTGTGTTTTTTTTATAAAT
TATCGTGTTTAATCATAAAAGAATGATTATTCATTTTCAAGTTTTTTACA
C
back to top

protein sequence of SMED30004511-orf-1

>SMED30004511-orf-1 ID=SMED30004511-orf-1|Name=SMED30004511-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1022bp
MLGGSYYVAAREEYKHHASNDLKCQVVLLDGNVEFFTLQKKSCGHCLLDL
IFDTLELLERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFH
FRVKFYPNNPSQMKEEYTRYLLFLQLKKDIFDERLHCNKDMVAILGSYAL
QAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLHMKMKNFSPTKAE
REYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFL
WSSIFKISFKKKKITIQIKSTHFVDQFKNNEESNKSSPLMYTYVLSSSPL
CKTLWQNCVDYHTFFRVKVPPNNSQIKANTKSKGSNFFGISITPAFCGRR
TMPTIEDIQKRSRTTDRTFIRTPSTNRKQLLSRNNSNNHSAVSRSSGTLS
SMKLKETKNKIQLLTKFNSFQDRSQSPSHNSLDYKPLTATFDSDNSSVDG
NEIDLYEYKDGFHDSGTFFLSDNYLNDHRDKDRSISVERNSYRTDLASPL
NYIYRSSENNKNSRFEKEKSIDESSNNVSDKLICSNSSMESLSEIKLDKS
NFSASNEKRIPYFSRLASSVNFNKFKPFASKNGIIKSLHIDRSHSTDRFY
DNDLMIKLRCDRNRRYGFTVRSTSERKSPIIINFIGKNTPADMCFPRLNV
GDQLISINGENVDHLTQDEVISIIKNSSESGCGDIILKVRPNNYMVECNT
VESSDWDFSITENGSESKSSIISSKPDILSSNLDPFKESLKFLENSVEND
DILQQFESVYRKKPGLTMMEAKKTENFSKNRYRDISPYDQTRVILKNNGS
SDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVM
LTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMV
YRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIV
VHCSAGIGRTGVLITMETAMCFIEARKPINLVDILQTMRDQRASMIQTPA
QFKFVCEAIIKVYKDSDIRAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR035963FERM_2
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
IPR000299FERM_domain
IPR029071Ubiquitin-like_domsf
IPR000242PTPase_domain
IPR019749Band_41_domain
IPR003595Tyr_Pase_cat
IPR018980FERM_PH-like_C
IPR001478PDZ
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR018979FERM_N
IPR011993PH-like_dom_sf
IPR029021Prot-tyrosine_phosphatase-like
IPR019748FERM_central
IPR019747FERM_CS
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0008092cytoskeletal protein binding
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 909..926
score: 48.92
coord: 979..994
score: 26.29
coord: 802..809
score: 71.03
coord: 948..966
score: 67.89
coord: 995..1005
score: 46.04
coord: 822..842
score: 59.92
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 751..1014
e-value: 4.7E-101
score: 351.7
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 776..1010
e-value: 1.6E-76
score: 256.9
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 752..1012
score: 48.858
IPR019749Band 4.1 domainPRINTSPR00935BAND41coord: 55..67
score: 51.92
coord: 124..137
score: 50.3
coord: 137..157
score: 46.83
coord: 198..214
score: 45.47
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 18..218
e-value: 1.7E-58
score: 210.4
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 614..693
e-value: 1.4E-11
score: 54.5
IPR001478PDZ domainPFAMPF00595PDZcoord: 612..679
e-value: 6.2E-11
score: 42.5
IPR001478PDZ domainPROSITEPS50106PDZcoord: 605..679
score: 15.199
IPR018980FERM, C-terminal PH-like domainSMARTSM01196FERM_C_3coord: 224..323
e-value: 2.9E-17
score: 73.3
IPR018980FERM, C-terminal PH-like domainPFAMPF09380FERM_Ccoord: 228..321
e-value: 1.3E-15
score: 57.5
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 910..1011
e-value: 2.3E-36
score: 136.8
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 21..104
e-value: 1.6E-22
score: 81.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 372..401
NoneNo IPR availablePANTHERPTHR45706:SF4TYROSINE-PROTEIN PHOSPHATASEcoord: 11..1018
NoneNo IPR availablePANTHERPTHR45706FAMILY NOT NAMEDcoord: 11..1018
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 605..690
e-value: 1.62447E-17
score: 76.0662
NoneNo IPR availableCDDcd14541PTPc-N3_4coord: 802..1015
e-value: 2.59166E-120
score: 364.728
NoneNo IPR availableCDDcd17100FERM_F1_PTPN3_likecoord: 21..106
e-value: 1.92655E-26
score: 101.614
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 211..330
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 592..692
e-value: 1.9E-17
score: 65.1
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 600..693
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 110..218
e-value: 7.3E-18
score: 65.1
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 118..210
e-value: 4.2232E-28
score: 106.947
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 213..317
e-value: 7.4E-20
score: 73.1
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 26..91
e-value: 4.2E-11
score: 42.6
IPR014352FERM/acyl-CoA-binding protein superfamilyGENE3DG3DSA:1.20.80.10coord: 105..210
e-value: 1.7E-35
score: 123.6
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 736..1020
e-value: 5.2E-98
score: 329.8
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 735..1014
IPR019747FERM conserved sitePROSITEPS00660FERM_1coord: 80..109
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 951..961
IPR000299FERM domainPROSITEPS50057FERM_3coord: 22..319
score: 72.054
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 929..1003
score: 19.339
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 109..213
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 20..107