E3 ubiquitin-protein ligase MIB2

Overview
NameE3 ubiquitin-protein ligase MIB2
Smed IDSMED30004508
Length (bp)2842
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase MIB2 (SMED30004508) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase MIB2 (SMED30004508) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase MIB2 (SMED30004508) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase MIB2 (SMED30004508) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004508

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30004508SMESG000017279.1 dd_Smed_v4_6545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004508SMESG000017279.1 dd_Smed_v4_5196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004508SMESG000017279.1 dd_Smed_v4_5196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004508SMESG000017279.1 dd_Smed_v4_6545_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004508SMESG000017279.1 dd_Smed_v4_6545_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004508SMESG000017279.1 dd_Smed_v4_5196_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004508SMESG000017279.1 dd_Smed_v4_5196_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: MIB1 (mindbomb E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:21086])

HSP 1 Score: 281.952 bits (720), Expect = 6.457e-80
Identity = 206/732 (28.14%), Postives = 361/732 (49.32%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASS---------NEGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V    S   +  +      +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A++++GD A+H A   D+  + ++L    AD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + +  LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++I+N N QTALH+AV +++   +++LV  GA++D+ D +GDTPLH A+R H++  +++   +  +  +  +   S          +G++K     +A +L    A   I+NK  ++P+D C DP+L + L+  +  ++S ++ ++                          S   +    E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANIVRSG-DAAQGAEGGTSQ--------FQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASG--ERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSR--------------------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 57.7658 bits (138), Expect = 1.087e-7
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQY------DTRQ-------DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L +       D  Q         ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 3 Score: 51.6026 bits (122), Expect = 8.285e-6
Identity = 40/176 (22.73%), Postives = 75/176 (42.61%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXK------VMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGK 751
            G+ YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++    +       +      V +  + E +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K
Sbjct:  224 GSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSK 399          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 229.565 bits (584), Expect = 5.349e-62
Identity = 185/723 (25.59%), Postives = 325/723 (44.95%), Query Frame = 2
Query:  686 DGDMYVSRLGMEWMINPKCIGKRNENKFK--------------------SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDR-LELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAES--VNALLD-AGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQ----STASSNEGSDK---PEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2740
            DG   V R+G +  ++ KC+G+     +                     S+  + GD V+   D   ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +        + +GN    L+ +R+  + V T    +G   L +A   G +++++LL++ RA ++  ++ G+TALH A   ++ +   +L++ G   +A N+ + T + +A   G +++ R L   R  D+++ ++ +DT LH A+      S  V  L +    D+ A N++ F   H  + +G+   +   L R   ++V+++K+D F ALHLA  NNH    ++L++  + D+N+RN  LQ+ LH+AV Q ++  + +LV+ G  ++  D  GDT LH+A++ H +  +   G   G  G  Q      AS   GS +      +A +L  + A     N   ++P+D        K     A+R  +               A GG  A PG        Q L T +  +  L        +   C++C +  + V F  C H   C+ CA  + +C  C+  +  K+R
Sbjct:  219 DGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------------------------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKN--QGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRALC-ERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGA-GGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKALQGCAQRFRER-------------QAGGG--AAPGPR------QTLGTPN-TVTNLHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 889          

HSP 2 Score: 61.6178 bits (148), Expect = 7.006e-9
Identity = 36/144 (25.00%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQY--DTR-----------QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E +                 G +G V+R+    ++ +Q+  +TR               +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:  282 DTDVLREMQEGHGGWNPRMAEFI-----------------GQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVA 408          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 230.335 bits (586), Expect = 5.809e-62
Identity = 190/744 (25.54%), Postives = 332/744 (44.62%), Query Frame = 2
Query:  623 GWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFK--------------------SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDR-LELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAES--VNALLD-AGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQ----STASSNEGSDK---PEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2740
            GW    ++  G  V  V    DG   V R+G +  ++ KC+G+     +                     S+  + GD V+   D   ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +        + +GN    L+ +R+  + V T    +G   L +A   G +++++LL++ RA ++  ++ G+TALH A   ++ +   +L++ G   +A N+ + T + +A   G +++ R L   R  D+++ ++ +DT LH A+      S  V  L +    D+ A N++ F   H  + +G+   +   L R   ++V+++K+D F ALHLA  NNH    ++L++  + D+N+RN  LQ+ LH+AV Q ++  + +LV+ G  ++  D  GDT LH+A++ H +  +   G   G  G  Q      AS   GS +      +A +L  + A     N   ++P+D        K     A+R  +               A GG  A PG        Q L T +  +  L        +   C++C +  + V F  C H   C+ CA  + +C  C+  +  K+R
Sbjct:  290 GW----DVETGRSVASV-TWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------------------------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKN--QGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRAL-CERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGA-GGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKALQGCAQRFRER-------------QAGGG--AAPGPR------QTLGTPN-TVTNLHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 976          

HSP 2 Score: 61.6178 bits (148), Expect = 6.787e-9
Identity = 36/144 (25.00%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQY--DTR-----------QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E +                 G +G V+R+    ++ +Q+  +TR               +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:  369 DTDVLREMQEGHGGWNPRMAEFI-----------------GQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVA 495          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 229.18 bits (583), Expect = 1.244e-61
Identity = 190/744 (25.54%), Postives = 332/744 (44.62%), Query Frame = 2
Query:  623 GWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFK--------------------SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDR-LELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAES--VNALLD-AGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQ----STASSNEGSDK---PEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2740
            GW    ++  G  V  V    DG   V R+G +  ++ KC+G+     +                     S+  + GD V+   D   ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +        + +GN    L+ +R+  + V T    +G   L +A   G +++++LL++ RA ++  ++ G+TALH A   ++ +   +L++ G   +A N+ + T + +A   G +++ R L   R  D+++ ++ +DT LH A+      S  V  L +    D+ A N++ F   H  + +G+   +   L R   ++V+++K+D F ALHLA  NNH    ++L++  + D+N+RN  LQ+ LH+AV Q ++  + +LV+ G  ++  D  GDT LH+A++ H +  +   G   G  G  Q      AS   GS +      +A +L  + A     N   ++P+D        K     A+R  +               A GG  A PG        Q L T +  +  L        +   C++C +  + V F  C H   C+ CA  + +C  C+  +  K+R
Sbjct:  304 GW----DVETGRSVASV-TWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------------------------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKN--QGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRAL-CERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGA-GGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKALQGCAQRFRER-------------QAGGG--AAPGPR------QTLGTPN-TVTNLHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 990          

HSP 2 Score: 61.6178 bits (148), Expect = 7.741e-9
Identity = 36/144 (25.00%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQY--DTR-----------QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E +                 G +G V+R+    ++ +Q+  +TR               +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:  383 DTDVLREMQEGHGGWNPRMAEFI-----------------GQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVA 509          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 226.868 bits (577), Expect = 4.894e-61
Identity = 177/674 (26.26%), Postives = 310/674 (45.99%), Query Frame = 2
Query:  773 SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDR-LELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAES--VNALLD-AGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQ----STASSNEGSDK---PEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2740
            S+  + GD V+   D   ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +        + +GN    L+ +R+  + V T    +G   L +A   G +++++LL++ RA ++  ++ G+TALH A   ++ +   +L++ G   +A N+ + T + +A   G +++ R L   R  D+++ ++ +DT LH A+      S  V  L +    D+ A N++ F   H  + +G+   +   L R   ++V+++K+D F ALHLA  NNH    ++L++  + D+N+RN  LQ+ LH+AV Q ++  + +LV+ G  ++  D  GDT LH+A++ H +  +   G   G  G  Q      AS   GS +      +A +L  + A     N   ++P+D        K     A+R  +               A GG  A PG        Q L T +  +  L        +   C++C +  + V F  C H   C+ CA  + +C  C+  +  K+R
Sbjct:  304 SQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------------------------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKN--QGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRAL-CERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGA-GGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKALQGCAQRFRER-------------QAGGG--AAPGPR------QTLGTPN-TVTNLHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 925          

HSP 2 Score: 61.6178 bits (148), Expect = 6.626e-9
Identity = 36/144 (25.00%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQY--DTR-----------QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E +                 G +G V+R+    ++ +Q+  +TR               +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:  318 DTDVLREMQEGHGGWNPRMAEFI-----------------GQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVA 444          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 128.257 bits (321), Expect = 1.231e-29
Identity = 77/252 (30.56%), Postives = 131/252 (51.98%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            G  PL IA + GH +V +LL+EK AN+N +  +  + LH+A +  +  + +LL+++GA ++++  + +TP+  AA +G   +  LL   + A +S         LH+A +  H ++   LL   A +  V        H+ A  G+ R+ ++ L R      NS+  + F  LH+A   N    + +LLKY+A I     +  T LH+A     +N +  L+++GA  DV    G+TPLH+A R +  D V+
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP--NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVR 475          

HSP 2 Score: 124.02 bits (310), Expect = 2.151e-28
Identity = 96/311 (30.87%), Postives = 145/311 (46.62%), Query Frame = 2
Query: 1325 QIMGQSDHSDESDE------PDNDRTKTFFNALKI----GNLNEVRKLVDSVG--TSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRN-ADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMD 2218
             +  Q DH D +        P +D T  +   L +    G++   + L+D      S  L G  PL IA     I VV+LL++ RA I A  E+G T LH+A       I   L+ +GA+ + +     TP+ LAA A   D+ R+L   RN A +     E  T LH+A +  + + V  LL AGA+  A    N++  H+ A+ G E +  + L     K + ++K   F  LHLA    +   +R+LL+    ++I   N  T LH+A          +L+E GA       NG TPLHIA + + M+
Sbjct:  331 HMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI--RNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG--FTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQME 637          

HSP 3 Score: 122.865 bits (307), Expect = 5.272e-28
Identity = 94/327 (28.75%), Postives = 156/327 (47.71%), Query Frame = 2
Query: 1430 RKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDIT-RLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN-------EGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            R  VD V    L     PL +A + GH+ V KLL+++ A+ N++  NG T LHIA +K++ K+ +LL+   A + A   + +TP+ +AA  G+++I   LL    N D+     E  T LHLA +    + V  L+  GA + A   +     H+ ++ GN  I+ + L+       N+   D ++ LH+A     E    +LL + AD  +      T LH+A     L  +++L+E+G  +D+   N  TPLH+A   ++     K   LL  +G     A+ N              ++A  LL+ KA  + K++   TP+   
Sbjct:  349 RAPVDDVTVDYLT----PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN----DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLS 663          

HSP 4 Score: 121.324 bits (303), Expect = 1.558e-27
Identity = 83/266 (31.20%), Postives = 135/266 (50.75%), Query Frame = 2
Query: 1436 LVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            L+D     TLL  +G  PL +A   G+++VV+LL+E+   ++ + +N  T LH+A   +  K+  LL+  GA   A   N  TP+ +AA    M+I   L   + AD +  +    T LHL+ +  H E    L++ G+D+ A  N    A HL AQ  +  + ++ L   G +I NS+ +  +  LH+A        ++ L++  AD+  +     T LH A  Q + NC++ L+E GA  +   A G TPL IA R+  +  V+
Sbjct:  543 LLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK-ADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQI-LYNNGAEI-NSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVE 805          

HSP 5 Score: 110.538 bits (275), Expect = 3.398e-24
Identity = 79/305 (25.90%), Postives = 139/305 (45.57%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK---KRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            PL IA   G+ D+V LL++  AN NA   +  + LHIA ++ + ++  +L++  AD         TP+ LA+  G++++ RLL   R   + I      T LH+A    + +    LL+ GA  +A     +   H+ A++    I    L+ +     N++    F  LHL+    H+    +L++  +D+  + NN  TA+H+   + ++   +IL   GAEI+     G TPLH+A     ++ VK   + G  +G       T           +   YLL+  A  + +    +TP+   
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL-LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 6 Score: 110.153 bits (274), Expect = 4.538e-24
Identity = 81/279 (29.03%), Postives = 141/279 (50.54%), Query Frame = 2
Query: 1382 TKTFFNALKIGNLNEVRKLVDSVGT---STLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALL--DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR 2203
            + +F  A + G+L +V +L+ + GT   ++   G+  L +A   GH +VV+ LI+++A ++A    G+TALHIA    +  I  +L+  GA+VN Q+ N  TP+ +AA     ++ + L     A+ ++   +  T L +A++  H   V  LL  D+   +R        A H+ A++ +     + L+ E    V S+    F  LH+A    HE   ++LL+  A++N +  +  + LH+A      N   +L+ +GA ID    +  TPLH A R
Sbjct:   34 SASFLRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYL-LKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR------LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSG--FTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAAR 302          

HSP 7 Score: 56.6102 bits (135), Expect = 1.057e-7
Identity = 40/117 (34.19%), Postives = 62/117 (52.99%), Query Frame = 2
Query: 1880 AFHLVAQRGN-ERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            +F   A+ G+ E++LE+   R G  I N+   +   +LHLA    H   +R L+K +A ++       TALHIA        + ILVE GA ++V   NG TPL++A + +  + VK
Sbjct:   36 SFLRAARAGDLEKVLELL--RAGTDI-NTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK 149          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 128.257 bits (321), Expect = 1.231e-29
Identity = 77/252 (30.56%), Postives = 131/252 (51.98%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            G  PL IA + GH +V +LL+EK AN+N +  +  + LH+A +  +  + +LL+++GA ++++  + +TP+  AA +G   +  LL   + A +S         LH+A +  H ++   LL   A +  V        H+ A  G+ R+ ++ L R      NS+  + F  LH+A   N    + +LLKY+A I     +  T LH+A     +N +  L+++GA  DV    G+TPLH+A R +  D V+
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP--NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVR 475          

HSP 2 Score: 124.02 bits (310), Expect = 2.151e-28
Identity = 96/311 (30.87%), Postives = 145/311 (46.62%), Query Frame = 2
Query: 1325 QIMGQSDHSDESDE------PDNDRTKTFFNALKI----GNLNEVRKLVDSVG--TSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRN-ADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMD 2218
             +  Q DH D +        P +D T  +   L +    G++   + L+D      S  L G  PL IA     I VV+LL++ RA I A  E+G T LH+A       I   L+ +GA+ + +     TP+ LAA A   D+ R+L   RN A +     E  T LH+A +  + + V  LL AGA+  A    N++  H+ A+ G E +  + L     K + ++K   F  LHLA    +   +R+LL+    ++I   N  T LH+A          +L+E GA       NG TPLHIA + + M+
Sbjct:  331 HMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI--RNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG--FTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQME 637          

HSP 3 Score: 122.865 bits (307), Expect = 5.272e-28
Identity = 94/327 (28.75%), Postives = 156/327 (47.71%), Query Frame = 2
Query: 1430 RKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDIT-RLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN-------EGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            R  VD V    L     PL +A + GH+ V KLL+++ A+ N++  NG T LHIA +K++ K+ +LL+   A + A   + +TP+ +AA  G+++I   LL    N D+     E  T LHLA +    + V  L+  GA + A   +     H+ ++ GN  I+ + L+       N+   D ++ LH+A     E    +LL + AD  +      T LH+A     L  +++L+E+G  +D+   N  TPLH+A   ++     K   LL  +G     A+ N              ++A  LL+ KA  + K++   TP+   
Sbjct:  349 RAPVDDVTVDYLT----PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN----DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLS 663          

HSP 4 Score: 121.324 bits (303), Expect = 1.558e-27
Identity = 83/266 (31.20%), Postives = 135/266 (50.75%), Query Frame = 2
Query: 1436 LVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            L+D     TLL  +G  PL +A   G+++VV+LL+E+   ++ + +N  T LH+A   +  K+  LL+  GA   A   N  TP+ +AA    M+I   L   + AD +  +    T LHL+ +  H E    L++ G+D+ A  N    A HL AQ  +  + ++ L   G +I NS+ +  +  LH+A        ++ L++  AD+  +     T LH A  Q + NC++ L+E GA  +   A G TPL IA R+  +  V+
Sbjct:  543 LLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK-ADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQI-LYNNGAEI-NSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVE 805          

HSP 5 Score: 110.538 bits (275), Expect = 3.398e-24
Identity = 79/305 (25.90%), Postives = 139/305 (45.57%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK---KRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            PL IA   G+ D+V LL++  AN NA   +  + LHIA ++ + ++  +L++  AD         TP+ LA+  G++++ RLL   R   + I      T LH+A    + +    LL+ GA  +A     +   H+ A++    I    L+ +     N++    F  LHL+    H+    +L++  +D+  + NN  TA+H+   + ++   +IL   GAEI+     G TPLH+A     ++ VK   + G  +G       T           +   YLL+  A  + +    +TP+   
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL-LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 6 Score: 110.153 bits (274), Expect = 4.538e-24
Identity = 81/279 (29.03%), Postives = 141/279 (50.54%), Query Frame = 2
Query: 1382 TKTFFNALKIGNLNEVRKLVDSVGT---STLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALL--DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR 2203
            + +F  A + G+L +V +L+ + GT   ++   G+  L +A   GH +VV+ LI+++A ++A    G+TALHIA    +  I  +L+  GA+VN Q+ N  TP+ +AA     ++ + L     A+ ++   +  T L +A++  H   V  LL  D+   +R        A H+ A++ +     + L+ E    V S+    F  LH+A    HE   ++LL+  A++N +  +  + LH+A      N   +L+ +GA ID    +  TPLH A R
Sbjct:   34 SASFLRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYL-LKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR------LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSG--FTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAAR 302          

HSP 7 Score: 56.6102 bits (135), Expect = 1.057e-7
Identity = 40/117 (34.19%), Postives = 62/117 (52.99%), Query Frame = 2
Query: 1880 AFHLVAQRGN-ERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            +F   A+ G+ E++LE+   R G  I N+   +   +LHLA    H   +R L+K +A ++       TALHIA        + ILVE GA ++V   NG TPL++A + +  + VK
Sbjct:   36 SFLRAARAGDLEKVLELL--RAGTDI-NTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK 149          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 127.872 bits (320), Expect = 1.451e-29
Identity = 77/252 (30.56%), Postives = 131/252 (51.98%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            G  PL IA + GH +V +LL+EK AN+N +  +  + LH+A +  +  + +LL+++GA ++++  + +TP+  AA +G   +  LL   + A +S         LH+A +  H ++   LL   A +  V        H+ A  G+ R+ ++ L R      NS+  + F  LH+A   N    + +LLKY+A I     +  T LH+A     +N +  L+++GA  DV    G+TPLH+A R +  D V+
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP--NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVR 475          

HSP 2 Score: 124.02 bits (310), Expect = 2.516e-28
Identity = 96/311 (30.87%), Postives = 145/311 (46.62%), Query Frame = 2
Query: 1325 QIMGQSDHSDESDE------PDNDRTKTFFNALKI----GNLNEVRKLVDSVG--TSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRN-ADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMD 2218
             +  Q DH D +        P +D T  +   L +    G++   + L+D      S  L G  PL IA     I VV+LL++ RA I A  E+G T LH+A       I   L+ +GA+ + +     TP+ LAA A   D+ R+L   RN A +     E  T LH+A +  + + V  LL AGA+  A    N++  H+ A+ G E +  + L     K + ++K   F  LHLA    +   +R+LL+    ++I   N  T LH+A          +L+E GA       NG TPLHIA + + M+
Sbjct:  331 HMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI--RNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG--FTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQME 637          

HSP 3 Score: 122.479 bits (306), Expect = 6.112e-28
Identity = 94/327 (28.75%), Postives = 156/327 (47.71%), Query Frame = 2
Query: 1430 RKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDIT-RLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN-------EGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            R  VD V    L     PL +A + GH+ V KLL+++ A+ N++  NG T LHIA +K++ K+ +LL+   A + A   + +TP+ +AA  G+++I   LL    N D+     E  T LHLA +    + V  L+  GA + A   +     H+ ++ GN  I+ + L+       N+   D ++ LH+A     E    +LL + AD  +      T LH+A     L  +++L+E+G  +D+   N  TPLH+A   ++     K   LL  +G     A+ N              ++A  LL+ KA  + K++   TP+   
Sbjct:  349 RAPVDDVTVDYLT----PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN----DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLS 663          

HSP 4 Score: 120.939 bits (302), Expect = 1.984e-27
Identity = 83/266 (31.20%), Postives = 135/266 (50.75%), Query Frame = 2
Query: 1436 LVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            L+D     TLL  +G  PL +A   G+++VV+LL+E+   ++ + +N  T LH+A   +  K+  LL+  GA   A   N  TP+ +AA    M+I   L   + AD +  +    T LHL+ +  H E    L++ G+D+ A  N    A HL AQ  +  + ++ L   G +I NS+ +  +  LH+A        ++ L++  AD+  +     T LH A  Q + NC++ L+E GA  +   A G TPL IA R+  +  V+
Sbjct:  543 LLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK-ADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQI-LYNNGAEI-NSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVE 805          

HSP 5 Score: 110.153 bits (274), Expect = 4.402e-24
Identity = 79/305 (25.90%), Postives = 139/305 (45.57%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK---KRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            PL IA   G+ D+V LL++  AN NA   +  + LHIA ++ + ++  +L++  AD         TP+ LA+  G++++ RLL   R   + I      T LH+A    + +    LL+ GA  +A     +   H+ A++    I    L+ +     N++    F  LHL+    H+    +L++  +D+  + NN  TA+H+   + ++   +IL   GAEI+     G TPLH+A     ++ VK   + G  +G       T           +   YLL+  A  + +    +TP+   
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL-LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 6 Score: 109.768 bits (273), Expect = 5.446e-24
Identity = 81/279 (29.03%), Postives = 141/279 (50.54%), Query Frame = 2
Query: 1382 TKTFFNALKIGNLNEVRKLVDSVGT---STLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALL--DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR 2203
            + +F  A + G+L +V +L+ + GT   ++   G+  L +A   GH +VV+ LI+++A ++A    G+TALHIA    +  I  +L+  GA+VN Q+ N  TP+ +AA     ++ + L     A+ ++   +  T L +A++  H   V  LL  D+   +R        A H+ A++ +     + L+ E    V S+    F  LH+A    HE   ++LL+  A++N +  +  + LH+A      N   +L+ +GA ID    +  TPLH A R
Sbjct:   34 SASFLRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYL-LKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR------LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSG--FTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAAR 302          

HSP 7 Score: 56.225 bits (134), Expect = 1.292e-7
Identity = 40/117 (34.19%), Postives = 62/117 (52.99%), Query Frame = 2
Query: 1880 AFHLVAQRGN-ERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            +F   A+ G+ E++LE+   R G  I N+   +   +LHLA    H   +R L+K +A ++       TALHIA        + ILVE GA ++V   NG TPL++A + +  + VK
Sbjct:   36 SFLRAARAGDLEKVLELL--RAGTDI-NTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK 149          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 127.872 bits (320), Expect = 1.451e-29
Identity = 77/252 (30.56%), Postives = 131/252 (51.98%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            G  PL IA + GH +V +LL+EK AN+N +  +  + LH+A +  +  + +LL+++GA ++++  + +TP+  AA +G   +  LL   + A +S         LH+A +  H ++   LL   A +  V        H+ A  G+ R+ ++ L R      NS+  + F  LH+A   N    + +LLKY+A I     +  T LH+A     +N +  L+++GA  DV    G+TPLH+A R +  D V+
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP--NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVR 475          

HSP 2 Score: 124.02 bits (310), Expect = 2.516e-28
Identity = 96/311 (30.87%), Postives = 145/311 (46.62%), Query Frame = 2
Query: 1325 QIMGQSDHSDESDE------PDNDRTKTFFNALKI----GNLNEVRKLVDSVG--TSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRN-ADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMD 2218
             +  Q DH D +        P +D T  +   L +    G++   + L+D      S  L G  PL IA     I VV+LL++ RA I A  E+G T LH+A       I   L+ +GA+ + +     TP+ LAA A   D+ R+L   RN A +     E  T LH+A +  + + V  LL AGA+  A    N++  H+ A+ G E +  + L     K + ++K   F  LHLA    +   +R+LL+    ++I   N  T LH+A          +L+E GA       NG TPLHIA + + M+
Sbjct:  331 HMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI--RNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG--FTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQME 637          

HSP 3 Score: 122.479 bits (306), Expect = 6.112e-28
Identity = 94/327 (28.75%), Postives = 156/327 (47.71%), Query Frame = 2
Query: 1430 RKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDIT-RLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN-------EGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            R  VD V    L     PL +A + GH+ V KLL+++ A+ N++  NG T LHIA +K++ K+ +LL+   A + A   + +TP+ +AA  G+++I   LL    N D+     E  T LHLA +    + V  L+  GA + A   +     H+ ++ GN  I+ + L+       N+   D ++ LH+A     E    +LL + AD  +      T LH+A     L  +++L+E+G  +D+   N  TPLH+A   ++     K   LL  +G     A+ N              ++A  LL+ KA  + K++   TP+   
Sbjct:  349 RAPVDDVTVDYLT----PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN----DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLS 663          

HSP 4 Score: 120.939 bits (302), Expect = 1.984e-27
Identity = 83/266 (31.20%), Postives = 135/266 (50.75%), Query Frame = 2
Query: 1436 LVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            L+D     TLL  +G  PL +A   G+++VV+LL+E+   ++ + +N  T LH+A   +  K+  LL+  GA   A   N  TP+ +AA    M+I   L   + AD +  +    T LHL+ +  H E    L++ G+D+ A  N    A HL AQ  +  + ++ L   G +I NS+ +  +  LH+A        ++ L++  AD+  +     T LH A  Q + NC++ L+E GA  +   A G TPL IA R+  +  V+
Sbjct:  543 LLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK-ADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQI-LYNNGAEI-NSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVE 805          

HSP 5 Score: 110.153 bits (274), Expect = 4.402e-24
Identity = 79/305 (25.90%), Postives = 139/305 (45.57%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK---KRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            PL IA   G+ D+V LL++  AN NA   +  + LHIA ++ + ++  +L++  AD         TP+ LA+  G++++ RLL   R   + I      T LH+A    + +    LL+ GA  +A     +   H+ A++    I    L+ +     N++    F  LHL+    H+    +L++  +D+  + NN  TA+H+   + ++   +IL   GAEI+     G TPLH+A     ++ VK   + G  +G       T           +   YLL+  A  + +    +TP+   
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL-LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 6 Score: 109.768 bits (273), Expect = 5.446e-24
Identity = 81/279 (29.03%), Postives = 141/279 (50.54%), Query Frame = 2
Query: 1382 TKTFFNALKIGNLNEVRKLVDSVGT---STLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALL--DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR 2203
            + +F  A + G+L +V +L+ + GT   ++   G+  L +A   GH +VV+ LI+++A ++A    G+TALHIA    +  I  +L+  GA+VN Q+ N  TP+ +AA     ++ + L     A+ ++   +  T L +A++  H   V  LL  D+   +R        A H+ A++ +     + L+ E    V S+    F  LH+A    HE   ++LL+  A++N +  +  + LH+A      N   +L+ +GA ID    +  TPLH A R
Sbjct:   34 SASFLRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYL-LKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR------LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSG--FTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAAR 302          

HSP 7 Score: 56.225 bits (134), Expect = 1.292e-7
Identity = 40/117 (34.19%), Postives = 62/117 (52.99%), Query Frame = 2
Query: 1880 AFHLVAQRGN-ERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            +F   A+ G+ E++LE+   R G  I N+   +   +LHLA    H   +R L+K +A ++       TALHIA        + ILVE GA ++V   NG TPL++A + +  + VK
Sbjct:   36 SFLRAARAGDLEKVLELL--RAGTDI-NTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK 149          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 127.872 bits (320), Expect = 1.520e-29
Identity = 77/252 (30.56%), Postives = 131/252 (51.98%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            G  PL IA + GH +V +LL+EK AN+N +  +  + LH+A +  +  + +LL+++GA ++++  + +TP+  AA +G   +  LL   + A +S         LH+A +  H ++   LL   A +  V        H+ A  G+ R+ ++ L R      NS+  + F  LH+A   N    + +LLKY+A I     +  T LH+A     +N +  L+++GA  DV    G+TPLH+A R +  D V+
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP--NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVR 475          

HSP 2 Score: 123.635 bits (309), Expect = 3.150e-28
Identity = 96/311 (30.87%), Postives = 145/311 (46.62%), Query Frame = 2
Query: 1325 QIMGQSDHSDESDE------PDNDRTKTFFNALKI----GNLNEVRKLVDSVG--TSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRN-ADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMD 2218
             +  Q DH D +        P +D T  +   L +    G++   + L+D      S  L G  PL IA     I VV+LL++ RA I A  E+G T LH+A       I   L+ +GA+ + +     TP+ LAA A   D+ R+L   RN A +     E  T LH+A +  + + V  LL AGA+  A    N++  H+ A+ G E +  + L     K + ++K   F  LHLA    +   +R+LL+    ++I   N  T LH+A          +L+E GA       NG TPLHIA + + M+
Sbjct:  331 HMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI--RNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG--FTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQME 637          

HSP 3 Score: 122.479 bits (306), Expect = 7.086e-28
Identity = 94/327 (28.75%), Postives = 156/327 (47.71%), Query Frame = 2
Query: 1430 RKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDIT-RLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN-------EGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            R  VD V    L     PL +A + GH+ V KLL+++ A+ N++  NG T LHIA +K++ K+ +LL+   A + A   + +TP+ +AA  G+++I   LL    N D+     E  T LHLA +    + V  L+  GA + A   +     H+ ++ GN  I+ + L+       N+   D ++ LH+A     E    +LL + AD  +      T LH+A     L  +++L+E+G  +D+   N  TPLH+A   ++     K   LL  +G     A+ N              ++A  LL+ KA  + K++   TP+   
Sbjct:  349 RAPVDDVTVDYLT----PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN----DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLS 663          

HSP 4 Score: 120.939 bits (302), Expect = 1.923e-27
Identity = 83/266 (31.20%), Postives = 135/266 (50.75%), Query Frame = 2
Query: 1436 LVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            L+D     TLL  +G  PL +A   G+++VV+LL+E+   ++ + +N  T LH+A   +  K+  LL+  GA   A   N  TP+ +AA    M+I   L   + AD +  +    T LHL+ +  H E    L++ G+D+ A  N    A HL AQ  +  + ++ L   G +I NS+ +  +  LH+A        ++ L++  AD+  +     T LH A  Q + NC++ L+E GA  +   A G TPL IA R+  +  V+
Sbjct:  543 LLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK-ADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQI-LYNNGAEI-NSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVE 805          

HSP 5 Score: 110.153 bits (274), Expect = 4.638e-24
Identity = 79/305 (25.90%), Postives = 139/305 (45.57%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK---KRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            PL IA   G+ D+V LL++  AN NA   +  + LHIA ++ + ++  +L++  AD         TP+ LA+  G++++ RLL   R   + I      T LH+A    + +    LL+ GA  +A     +   H+ A++    I    L+ +     N++    F  LHL+    H+    +L++  +D+  + NN  TA+H+   + ++   +IL   GAEI+     G TPLH+A     ++ VK   + G  +G       T           +   YLL+  A  + +    +TP+   
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL-LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 6 Score: 109.768 bits (273), Expect = 5.360e-24
Identity = 81/279 (29.03%), Postives = 141/279 (50.54%), Query Frame = 2
Query: 1382 TKTFFNALKIGNLNEVRKLVDSVGT---STLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALL--DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR 2203
            + +F  A + G+L +V +L+ + GT   ++   G+  L +A   GH +VV+ LI+++A ++A    G+TALHIA    +  I  +L+  GA+VN Q+ N  TP+ +AA     ++ + L     A+ ++   +  T L +A++  H   V  LL  D+   +R        A H+ A++ +     + L+ E    V S+    F  LH+A    HE   ++LL+  A++N +  +  + LH+A      N   +L+ +GA ID    +  TPLH A R
Sbjct:   34 SASFLRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYL-LKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR------LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSG--FTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAAR 302          

HSP 7 Score: 56.225 bits (134), Expect = 1.202e-7
Identity = 40/117 (34.19%), Postives = 62/117 (52.99%), Query Frame = 2
Query: 1880 AFHLVAQRGN-ERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            +F   A+ G+ E++LE+   R G  I N+   +   +LHLA    H   +R L+K +A ++       TALHIA        + ILVE GA ++V   NG TPL++A + +  + VK
Sbjct:   36 SFLRAARAGDLEKVLELL--RAGTDI-NTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK 149          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0333578)

HSP 1 Score: 271.166 bits (692), Expect = 5.903e-76
Identity = 201/699 (28.76%), Postives = 336/699 (48.07%), Query Frame = 2
Query:  791 GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRL-ELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECV----EATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDS----------------VGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVK-IVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETK-----------------ILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKT-----CIICYDRPINVTF-GCGHVA-CDVCANNLYECHICRESIENKIRL 2743
            GD V +  D++ ++ LQ  HGGW + M  C      V  I    D+ V  +      +NP +LTK     ++PT A  +              F  GD V++ ++   IK LQ+GHGEW +AMQ  LGK+G+V+ V  + DLKV++       NP  V     +T SD    P I +   +L+ I+ +    + S     D T+ F  A   G      + +                  V  + +  G   L  A   GHI+V+++L+    ++  ++++GD A+H A   D+  + ++L   GAD+NA+N  + T + +A + G +++ + L T      S+ +SE DT LH A+   H E ++ LLD GADI   NN  FNA H  A +GN   +++ L +     IV  +KDD + ALHLA  NNH     +L+   KA+++ +N NLQTALH+AV ++++  +K+LV+ GA++++ D +GDTPLH A+R H++  +K+   + G   +     ++N        +A +L    A   +KN+  +TP+D C DP+L + L      R + + E                    L       +    L A         S+  +   +    E+ Q + +   + +     C++C D   +  F  CGHV+ C+ CA  + +C ICRE++ ++ ++
Sbjct:  232 GDKVTVDLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKV----SSPTTAPPE--------------FQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSS-ERLSAILKKLFEPNVS----GDATEEFVKAAANGFAARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHAVDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVKTLLT-LGCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQTALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLHEALRHHTLSQLKQLQDVEGFGKLLMGLRNANN-KKASASIACFLAANGADLTLKNRKQQTPLDLCPDPNLCKTLVKCYNERKTDDSELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAA--SSTFPAASSSSIFALNGIANEMSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSREKI 903          

HSP 2 Score: 96.6709 bits (239), Expect = 5.415e-20
Identity = 54/171 (31.58%), Postives = 87/171 (50.88%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSR-LGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSP 1075
            KV +  + E++++LQ  HGGW + M   +     +V I +D D+ V+   G  W  NP  + K +       + + GDIV+IC D++ IK LQ+ HG W ++M+   GKI +VQ +    D+KV V      YNP+ + K   + A+  +       S  L  +  K+F P
Sbjct:  234 KVTVDLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSSERLSAILKKLFEP 404          

HSP 3 Score: 64.6994 bits (156), Expect = 3.818e-10
Identity = 22/62 (35.48%), Postives = 45/62 (72.58%), Query Frame = 2
Query: 2561 EELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            +++++L+Q++QD++++  C +C+DR  N+ F CGH  C +C + +  C ICR+++E +I L+
Sbjct: 1054 DDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1115          

HSP 4 Score: 60.077 bits (144), Expect = 1.058e-8
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQ-SLGSCAIVKGPSGNVYRLNSELLIQYDTR----QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTS 532
            D+E ++  Q  HGGW   M ECL+    +V        +V   SGN +  N  +L +  +      + ++G  V +  + E  K LQ  +GEW+D M   LGK   + Q + D ++K++    ++  N  A+    CK  S
Sbjct:  240 DLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAV----CKVAS 376          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0075520)

HSP 1 Score: 271.166 bits (692), Expect = 1.275e-75
Identity = 201/699 (28.76%), Postives = 336/699 (48.07%), Query Frame = 2
Query:  791 GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRL-ELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECV----EATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDS----------------VGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVK-IVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETK-----------------ILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKT-----CIICYDRPINVTF-GCGHVA-CDVCANNLYECHICRESIENKIRL 2743
            GD V +  D++ ++ LQ  HGGW + M  C      V  I    D+ V  +      +NP +LTK     ++PT A  +              F  GD V++ ++   IK LQ+GHGEW +AMQ  LGK+G+V+ V  + DLKV++       NP  V     +T SD    P I +   +L+ I+ +    + S     D T+ F  A   G      + +                  V  + +  G   L  A   GHI+V+++L+    ++  ++++GD A+H A   D+  + ++L   GAD+NA+N  + T + +A + G +++ + L T      S+ +SE DT LH A+   H E ++ LLD GADI   NN  FNA H  A +GN   +++ L +     IV  +KDD + ALHLA  NNH     +L+   KA+++ +N NLQTALH+AV ++++  +K+LV+ GA++++ D +GDTPLH A+R H++  +K+   + G   +     ++N        +A +L    A   +KN+  +TP+D C DP+L + L      R + + E                    L       +    L A         S+  +   +    E+ Q + +   + +     C++C D   +  F  CGHV+ C+ CA  + +C ICRE++ ++ ++
Sbjct:  343 GDKVTVDLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKV----SSPTTAPPE--------------FQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSS-ERLSAILKKLFEPNVS----GDATEEFVKAAANGFAARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHAVDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVKTLLT-LGCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQTALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLHEALRHHTLSQLKQLQDVEGFGKLLMGLRNANN-KKASASIACFLAANGADLTLKNRKQQTPLDLCPDPNLCKTLVKCYNERKTDDSELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAA--SSTFPAASSSSIFALNGIANEMSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSREKI 1014          

HSP 2 Score: 96.6709 bits (239), Expect = 6.260e-20
Identity = 54/171 (31.58%), Postives = 87/171 (50.88%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSR-LGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSP 1075
            KV +  + E++++LQ  HGGW + M   +     +V I +D D+ V+   G  W  NP  + K +       + + GDIV+IC D++ IK LQ+ HG W ++M+   GKI +VQ +    D+KV V      YNP+ + K   + A+  +       S  L  +  K+F P
Sbjct:  345 KVTVDLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSSERLSAILKKLFEP 515          

HSP 3 Score: 65.0846 bits (157), Expect = 3.339e-10
Identity = 22/62 (35.48%), Postives = 45/62 (72.58%), Query Frame = 2
Query: 2561 EELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            +++++L+Q++QD++++  C +C+DR  N+ F CGH  C +C + +  C ICR+++E +I L+
Sbjct: 1165 DDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1226          

HSP 4 Score: 60.077 bits (144), Expect = 1.160e-8
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQ-SLGSCAIVKGPSGNVYRLNSELLIQYDTR----QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTS 532
            D+E ++  Q  HGGW   M ECL+    +V        +V   SGN +  N  +L +  +      + ++G  V +  + E  K LQ  +GEW+D M   LGK   + Q + D ++K++    ++  N  A+    CK  S
Sbjct:  351 DLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAV----CKVAS 487          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336840)

HSP 1 Score: 210.305 bits (534), Expect = 9.240e-56
Identity = 162/541 (29.94%), Postives = 259/541 (47.87%), Query Frame = 2
Query:  791 GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLE--LVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIM--GQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDA-GADIRAVNNKNFNAFHLVAQRGN----ERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPED-----LAIYLLKKKARTDIKNKN 2362
            GD V++C ++  + +LQQ HGGW   M     K+  V  I   GD++V  +       ++P  L K                         V  F  GD V +IN+ +K+++LQKGHGEW+  M+  LGK+ KV  V  +GDL+++ +  G +  LNP+CV+   S   +  +    +  L+        +  S    +            G+L+ VR+ +D        +  G   + +A + G++D+V  LI K AN+NA ++ GD+ALH A   ++     +L+  GA+VN  N++  + + + A   +    R L    NA+++I +S  DTALH A+   + E V  L +A   D    NN+ FN  H  A +GN     RIL   L R+   +VN +KDD FAALHLA  N H   +  L+ + +A+++IRNN  QT   +AVSQ +   ++ LV    +++  D +GD  +H+ V   S        +      I +   S    S +PED     + IYL +   R ++ N N
Sbjct:  256 GDRVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVK-------------------------VVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVREL-LQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRIL--LLSRQ---LVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCVIKKSNLQSAAEPQPEEAPEIHKFYLSLVHSSIRPEDRLMYSILIYLSRAGCRVELNNAN 765          

HSP 2 Score: 108.227 bits (269), Expect = 1.726e-23
Identity = 129/541 (23.84%), Postives = 230/541 (42.51%), Query Frame = 2
Query:  449 GNVKIKYR----GRTFRINSKAIL--TDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSR--LGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV--DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVK----VFSPGDKVRLINNKHKIKR-LQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSD--CESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN-LNEVRKLVDSVGTSTLLEGVY--PLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLIN-KGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAG-ADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVF 2005
            GNV +KY     G  +  +   +L  T+  +  +  ++ +F  G++V +    + +  LQ+ HGGW   M   + +   + +I   GD+ V        W  +P  +        K    R GD+V I +D  K++QLQ+ HG W+  M    GKICKV  +   GD+++    D  E   NP    KC   + +P A   +  RS+++  L  +    V +P   +   +   K+ R   +GH ++V                            Q L++NP  V+       C      Q  V+ ++ ++ +  + +  D+  +    +  +    GN    +R L+        L   +   L I  +      V+ L++  AN+N ++  GDTALH A+ K+  ++ +LL N    D   +NN     +  AA  G++   R +       +++   +   ALHLA  N HA+ V  L+  G A++   NN+    F L   +G+  ++E  ++      VN++ +D   A+HL V 
Sbjct:  213 GNVDLKYITATCGGHYYKDHMPVLGQTEELQPVAPMVKPSFSVGDRVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAAL-------VKVVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNP----KCVKLERSPLATAAE--RSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVR---------------------------QYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGD----SALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSC--DVNAKDEDGDNAMHLCVI 707          

HSP 3 Score: 82.8037 bits (203), Expect = 9.784e-16
Identity = 104/469 (22.17%), Postives = 197/469 (42.00%), Query Frame = 2
Query: 1493 AVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKG-ADVNAQNNNKITPIMLAASAGSMD-ITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLV----AQRGNERILE---MFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV----RIHSMDTVKKRGKLLGIS-GIFQSTASSNEGSDK------PEDLA--IYLLKKKARTDIKNKNDKT-----------------------------PMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            A+ G  +   ++L+  R  +N ++++G  ALH+A      ++ + L+ +G A+++ +NN + TP +LA S G    I RL+  S   D++  + + D A+HL V         + L + A+ +       + F+L     + R  +R++    ++L R G ++   + ++  A++   + + H    +++   + +      NLQ    + VS    +  +     GAE     +NG  P  +A     +  + + + K   +  I  G   ST S++ G  K      P++++  +   KK  +  +   +  T                             PM   +P   +        RM K +   +   +  T   +G ++A P      +    L + D  L  L  ++ + E+   C IC +R  +V F CGH AC  CA  L  CH+CR++I  KI LY
Sbjct:  605 ALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLS--CDVNAKDEDGDNAMHLCVIK------KSNLQSAAEPQPEEAPEIHKFYLSLVHSSIRPEDRLMYSILIYLSRAGCRV---ELNNANASIFEWITDRH--IRQLIFGQQGEAESLPRNLQA---LEVSAGSADGEESSASAGAE-----SNGAGPGSVAAPPPPQRQTFELMPKPNDIPAIGVGASPSTPSASPGVKKLNSDATPQNVSPQVAPRKKAPKPPVTTSSSSTALEAGAAGPSTSPVIVPGPHECIVCNEILPMVRFEPCQHQIACEECGIRMKKCLRCAVAIERRLTV--SGRVVALPTSTSSPSDPTRLPSGDL-LRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          

HSP 4 Score: 53.5286 bits (127), Expect = 1.141e-6
Identity = 33/123 (26.83%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  149 QREHGGWNANMNECLT--GPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY--RGRTFRINSKAI 505
            Q+ HGGWN  M E L+  G    +   G   +      N +  +   L++  +    ++G  VT+I +A + ++LQ  +GEW + M + LGK  ++++ + DG+++I+    G  + +N K +
Sbjct:  272 QQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVKVVS---FRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCV 391          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0081142)

HSP 1 Score: 210.305 bits (534), Expect = 9.240e-56
Identity = 162/541 (29.94%), Postives = 259/541 (47.87%), Query Frame = 2
Query:  791 GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLE--LVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIM--GQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDA-GADIRAVNNKNFNAFHLVAQRGN----ERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPED-----LAIYLLKKKARTDIKNKN 2362
            GD V++C ++  + +LQQ HGGW   M     K+  V  I   GD++V  +       ++P  L K                         V  F  GD V +IN+ +K+++LQKGHGEW+  M+  LGK+ KV  V  +GDL+++ +  G +  LNP+CV+   S   +  +    +  L+        +  S    +            G+L+ VR+ +D        +  G   + +A + G++D+V  LI K AN+NA ++ GD+ALH A   ++     +L+  GA+VN  N++  + + + A   +    R L    NA+++I +S  DTALH A+   + E V  L +A   D    NN+ FN  H  A +GN     RIL   L R+   +VN +KDD FAALHLA  N H   +  L+ + +A+++IRNN  QT   +AVSQ +   ++ LV    +++  D +GD  +H+ V   S        +      I +   S    S +PED     + IYL +   R ++ N N
Sbjct:  256 GDRVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVK-------------------------VVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVREL-LQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRIL--LLSRQ---LVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCVIKKSNLQSAAEPQPEEAPEIHKFYLSLVHSSIRPEDRLMYSILIYLSRAGCRVELNNAN 765          

HSP 2 Score: 108.227 bits (269), Expect = 1.726e-23
Identity = 129/541 (23.84%), Postives = 230/541 (42.51%), Query Frame = 2
Query:  449 GNVKIKYR----GRTFRINSKAIL--TDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSR--LGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV--DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVK----VFSPGDKVRLINNKHKIKR-LQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSD--CESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN-LNEVRKLVDSVGTSTLLEGVY--PLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLIN-KGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAG-ADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVF 2005
            GNV +KY     G  +  +   +L  T+  +  +  ++ +F  G++V +    + +  LQ+ HGGW   M   + +   + +I   GD+ V        W  +P  +        K    R GD+V I +D  K++QLQ+ HG W+  M    GKICKV  +   GD+++    D  E   NP    KC   + +P A   +  RS+++  L  +    V +P   +   +   K+ R   +GH ++V                            Q L++NP  V+       C      Q  V+ ++ ++ +  + +  D+  +    +  +    GN    +R L+        L   +   L I  +      V+ L++  AN+N ++  GDTALH A+ K+  ++ +LL N    D   +NN     +  AA  G++   R +       +++   +   ALHLA  N HA+ V  L+  G A++   NN+    F L   +G+  ++E  ++      VN++ +D   A+HL V 
Sbjct:  213 GNVDLKYITATCGGHYYKDHMPVLGQTEELQPVAPMVKPSFSVGDRVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAAL-------VKVVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNP----KCVKLERSPLATAAE--RSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVR---------------------------QYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGD----SALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSC--DVNAKDEDGDNAMHLCVI 707          

HSP 3 Score: 82.8037 bits (203), Expect = 9.784e-16
Identity = 104/469 (22.17%), Postives = 197/469 (42.00%), Query Frame = 2
Query: 1493 AVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKG-ADVNAQNNNKITPIMLAASAGSMD-ITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLV----AQRGNERILE---MFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV----RIHSMDTVKKRGKLLGIS-GIFQSTASSNEGSDK------PEDLA--IYLLKKKARTDIKNKNDKT-----------------------------PMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            A+ G  +   ++L+  R  +N ++++G  ALH+A      ++ + L+ +G A+++ +NN + TP +LA S G    I RL+  S   D++  + + D A+HL V         + L + A+ +       + F+L     + R  +R++    ++L R G ++   + ++  A++   + + H    +++   + +      NLQ    + VS    +  +     GAE     +NG  P  +A     +  + + + K   +  I  G   ST S++ G  K      P++++  +   KK  +  +   +  T                             PM   +P   +        RM K +   +   +  T   +G ++A P      +    L + D  L  L  ++ + E+   C IC +R  +V F CGH AC  CA  L  CH+CR++I  KI LY
Sbjct:  605 ALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLS--CDVNAKDEDGDNAMHLCVIK------KSNLQSAAEPQPEEAPEIHKFYLSLVHSSIRPEDRLMYSILIYLSRAGCRV---ELNNANASIFEWITDRH--IRQLIFGQQGEAESLPRNLQA---LEVSAGSADGEESSASAGAE-----SNGAGPGSVAAPPPPQRQTFELMPKPNDIPAIGVGASPSTPSASPGVKKLNSDATPQNVSPQVAPRKKAPKPPVTTSSSSTALEAGAAGPSTSPVIVPGPHECIVCNEILPMVRFEPCQHQIACEECGIRMKKCLRCAVAIERRLTV--SGRVVALPTSTSSPSDPTRLPSGDL-LRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          

HSP 4 Score: 53.5286 bits (127), Expect = 1.141e-6
Identity = 33/123 (26.83%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  149 QREHGGWNANMNECLT--GPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY--RGRTFRINSKAI 505
            Q+ HGGWN  M E L+  G    +   G   +      N +  +   L++  +    ++G  VT+I +A + ++LQ  +GEW + M + LGK  ++++ + DG+++I+    G  + +N K +
Sbjct:  272 QQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVKVVS---FRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCV 391          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336841)

HSP 1 Score: 210.305 bits (534), Expect = 9.240e-56
Identity = 162/541 (29.94%), Postives = 259/541 (47.87%), Query Frame = 2
Query:  791 GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLE--LVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIM--GQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDA-GADIRAVNNKNFNAFHLVAQRGN----ERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPED-----LAIYLLKKKARTDIKNKN 2362
            GD V++C ++  + +LQQ HGGW   M     K+  V  I   GD++V  +       ++P  L K                         V  F  GD V +IN+ +K+++LQKGHGEW+  M+  LGK+ KV  V  +GDL+++ +  G +  LNP+CV+   S   +  +    +  L+        +  S    +            G+L+ VR+ +D        +  G   + +A + G++D+V  LI K AN+NA ++ GD+ALH A   ++     +L+  GA+VN  N++  + + + A   +    R L    NA+++I +S  DTALH A+   + E V  L +A   D    NN+ FN  H  A +GN     RIL   L R+   +VN +KDD FAALHLA  N H   +  L+ + +A+++IRNN  QT   +AVSQ +   ++ LV    +++  D +GD  +H+ V   S        +      I +   S    S +PED     + IYL +   R ++ N N
Sbjct:  256 GDRVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVK-------------------------VVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVREL-LQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRIL--LLSRQ---LVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCVIKKSNLQSAAEPQPEEAPEIHKFYLSLVHSSIRPEDRLMYSILIYLSRAGCRVELNNAN 765          

HSP 2 Score: 108.227 bits (269), Expect = 1.726e-23
Identity = 129/541 (23.84%), Postives = 230/541 (42.51%), Query Frame = 2
Query:  449 GNVKIKYR----GRTFRINSKAIL--TDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSR--LGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV--DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVK----VFSPGDKVRLINNKHKIKR-LQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSD--CESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN-LNEVRKLVDSVGTSTLLEGVY--PLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLIN-KGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAG-ADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVF 2005
            GNV +KY     G  +  +   +L  T+  +  +  ++ +F  G++V +    + +  LQ+ HGGW   M   + +   + +I   GD+ V        W  +P  +        K    R GD+V I +D  K++QLQ+ HG W+  M    GKICKV  +   GD+++    D  E   NP    KC   + +P A   +  RS+++  L  +    V +P   +   +   K+ R   +GH ++V                            Q L++NP  V+       C      Q  V+ ++ ++ +  + +  D+  +    +  +    GN    +R L+        L   +   L I  +      V+ L++  AN+N ++  GDTALH A+ K+  ++ +LL N    D   +NN     +  AA  G++   R +       +++   +   ALHLA  N HA+ V  L+  G A++   NN+    F L   +G+  ++E  ++      VN++ +D   A+HL V 
Sbjct:  213 GNVDLKYITATCGGHYYKDHMPVLGQTEELQPVAPMVKPSFSVGDRVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAAL-------VKVVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNP----KCVKLERSPLATAAE--RSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVR---------------------------QYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGD----SALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSC--DVNAKDEDGDNAMHLCVI 707          

HSP 3 Score: 82.8037 bits (203), Expect = 9.784e-16
Identity = 104/469 (22.17%), Postives = 197/469 (42.00%), Query Frame = 2
Query: 1493 AVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKG-ADVNAQNNNKITPIMLAASAGSMD-ITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLV----AQRGNERILE---MFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV----RIHSMDTVKKRGKLLGIS-GIFQSTASSNEGSDK------PEDLA--IYLLKKKARTDIKNKNDKT-----------------------------PMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            A+ G  +   ++L+  R  +N ++++G  ALH+A      ++ + L+ +G A+++ +NN + TP +LA S G    I RL+  S   D++  + + D A+HL V         + L + A+ +       + F+L     + R  +R++    ++L R G ++   + ++  A++   + + H    +++   + +      NLQ    + VS    +  +     GAE     +NG  P  +A     +  + + + K   +  I  G   ST S++ G  K      P++++  +   KK  +  +   +  T                             PM   +P   +        RM K +   +   +  T   +G ++A P      +    L + D  L  L  ++ + E+   C IC +R  +V F CGH AC  CA  L  CH+CR++I  KI LY
Sbjct:  605 ALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLS--CDVNAKDEDGDNAMHLCVIK------KSNLQSAAEPQPEEAPEIHKFYLSLVHSSIRPEDRLMYSILIYLSRAGCRV---ELNNANASIFEWITDRH--IRQLIFGQQGEAESLPRNLQA---LEVSAGSADGEESSASAGAE-----SNGAGPGSVAAPPPPQRQTFELMPKPNDIPAIGVGASPSTPSASPGVKKLNSDATPQNVSPQVAPRKKAPKPPVTTSSSSTALEAGAAGPSTSPVIVPGPHECIVCNEILPMVRFEPCQHQIACEECGIRMKKCLRCAVAIERRLTV--SGRVVALPTSTSSPSDPTRLPSGDL-LRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          

HSP 4 Score: 53.5286 bits (127), Expect = 1.141e-6
Identity = 33/123 (26.83%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  149 QREHGGWNANMNECLT--GPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY--RGRTFRINSKAI 505
            Q+ HGGWN  M E L+  G    +   G   +      N +  +   L++  +    ++G  VT+I +A + ++LQ  +GEW + M + LGK  ++++ + DG+++I+    G  + +N K +
Sbjct:  272 QQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVKVVS---FRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCV 391          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 281.182 bits (718), Expect = 8.908e-80
Identity = 213/741 (28.74%), Postives = 366/741 (49.39%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN--------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETK---------ILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGHV-ACDVCANNLYECHICRESIENK 2734
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + ++ LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++++N N QTALH+AV +++   +++LV   A++DV D +GDTPLH A+R H++  +++   +  +S +     S N        +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++          L+     +      +  P  HI   S    + K   +   ++++Q     + C++C D+   V F  CGH+ AC+ CA+ + +C  CR  +E +
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKV------APAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLI--CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERR 905          

HSP 2 Score: 171.4 bits (433), Expect = 4.399e-43
Identity = 185/739 (25.03%), Postives = 309/739 (41.81%), Query Frame = 2
Query:  590 EVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GMEWMINPKCIGKRN---------ENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND--TALHLAVKNFHAESVNALLDAG---ADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            E++++LQ  HGGW + M   +     +  I +D D+ V    G  W  NP  + K N           +  S +   GD+VQIC DI +IK LQ+ HG W  +M    GK+ +VQ I    D+KV V      YNP  +TK     +  T A G+R     L +L  K+F   +   +  N+  +K    G    +  ++ +L    K   VDVNG               +C   T     S+      V+ L  ++    HS + +  D D  +   +A   G+   V +++   G            PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  +  +L+  GADV   NNN    +  AA  G+    R+L +       +   ++D  TALHLA  N H E    L+  G    D++ VN +   A HL  +R + +I                                   +R+L++ +A +++++ +  T LH A+    L+ ++ L       D+ D +   P   +     M         LG  G  + +A+S         +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++                           +  L + +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  259 EIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGER-----LSQLLKKLFETQESGDI--NEELVKAAANGD---LAKVEDIL----KRPDVDVNG---------------QCAGHTAMQAASQ---NGHVDVLKLLL---KHSVDLEAEDKDGDRAVHHA-SFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQ--TALHLAVERQHTQI-----------------------------------VRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQ------DMQDVSKVEPWEPSKNTLIMG--------LGTQGAEKKSAAS---------IACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSR---------------------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 861          

HSP 3 Score: 67.0106 bits (162), Expect = 9.901e-11
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2564 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  970 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          

HSP 4 Score: 56.225 bits (134), Expect = 2.288e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 5 Score: 51.2174 bits (121), Expect = 7.637e-6
Identity = 53/241 (21.99%), Postives = 99/241 (41.08%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K               + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  224 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 459          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 280.411 bits (716), Expect = 2.189e-79
Identity = 213/748 (28.48%), Postives = 368/748 (49.20%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVE-----------ATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN--------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETK---------ILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGHV-ACDVCANNLYECHICRESIENK 2734
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V            A+ +     P +     +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + ++ LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++++N N QTALH+AV +++   +++LV   A++DV D +GDTPLH A+R H++  +++   +  +S +     S N        +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++          L+     +      +  P  HI   S    + K   +   ++++Q     + C++C D+   V F  CGH+ AC+ CA+ + +C  CR  +E +
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGAVLTESPSVP--AERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLI--CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERR 916          

HSP 2 Score: 166.392 bits (420), Expect = 1.354e-41
Identity = 185/745 (24.83%), Postives = 308/745 (41.34%), Query Frame = 2
Query:  590 EVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GMEWMINPKCIGKRN---------ENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSA------LEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND--TALHLAVKNFHAESVNALLDAG---ADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            E++++LQ  HGGW + M   +     +  I +D D+ V    G  W  NP  + K N           +  S +   GD+VQIC DI +IK LQ+ HG W  +M    GK+ +VQ I    D+KV V      YNP  +TK     +  T A G     S       L +L  K+F   +   +  N+  +K    G    +  ++ +L    K   VDVNG               +C   T     S+      V+ L  ++    HS + +  D D  +   +A   G+   V +++   G            PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  +  +L+  GADV   NNN    +  AA  G+    R+L +       +   ++D  TALHLA  N H E    L+  G    D++ VN +   A HL  +R + +I                                   +R+L++ +A +++++ +  T LH A+    L+ ++ L       D+ D +   P   +     M         LG  G  + +A+S         +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++                           +  L + +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  259 EIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGAVLTESPSVPAERLSQLLKKLFETQESGDI--NEELVKAAANGD---LAKVEDIL----KRPDVDVNG---------------QCAGHTAMQAASQ---NGHVDVLKLLL---KHSVDLEAEDKDGDRAVHHA-SFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQ--TALHLAVERQHTQI-----------------------------------VRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQ------DMQDVSKVEPWEPSKNTLIMG--------LGTQGAEKKSAAS---------IACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSR---------------------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 872          

HSP 3 Score: 67.0106 bits (162), Expect = 9.444e-11
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2564 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  981 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1041          

HSP 4 Score: 56.225 bits (134), Expect = 2.003e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 5 Score: 51.2174 bits (121), Expect = 7.527e-6
Identity = 39/176 (22.16%), Postives = 73/176 (41.48%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGK 751
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K
Sbjct:  224 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTK 399          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 278.1 bits (710), Expect = 1.171e-78
Identity = 213/749 (28.44%), Postives = 366/749 (48.87%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN----------------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETK---------ILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGHV-ACDVCANNLYECHICRESIENK 2734
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + ++ LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++++N N QTALH+AV +++   +++LV   A++DV D +GDTPLH A+R H++  +++   +  +S +     S N                +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++          L+     +      +  P  HI   S    + K   +   ++++Q     + C++C D+   V F  CGH+ AC+ CA+ + +C  CR  +E +
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKV------APAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTVRTEKCLKLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLI--CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERR 913          

HSP 2 Score: 172.94 bits (437), Expect = 1.201e-43
Identity = 185/739 (25.03%), Postives = 310/739 (41.95%), Query Frame = 2
Query:  590 EVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GMEWMINPKCIGKRN---------ENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND--TALHLAVKNFHAESVNALLDAG---ADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            E++++LQ  HGGW + M   +     +  I +D D+ V    G  W  NP  + K N           +  S +   GD+VQIC DI +IK LQ+ HG W  +M    GK+ +VQ I    D+KV V      YNP  +TK     +  T A G+R     L +L  K+F   +   +  N+  +K    G    +  ++ +L    K   VDVNG               +C   T     S+      V+ L  ++    HS + +  D D  +   +A   G+   V +++   G            PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  +  +L+  GADV   NNN    +  AA  G+    R+L +       +   ++D  TALHLA  N H E    L+  G    D++ VN +   A HL  +R + +I                                   +R+L++ +A +++++ +  T LH A+    L+ ++ L       D+ D +   P   +      +   K    LG  G  + +A+S         +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++                           +  L + +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  259 EIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGER-----LSQLLKKLFETQESGDI--NEELVKAAANGD---LAKVEDIL----KRPDVDVNG---------------QCAGHTAMQAASQ---NGHVDVLKLLL---KHSVDLEAEDKDGDRAVHHA-SFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQ--TALHLAVERQHTQI-----------------------------------VRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQ------DMQDVSKVEPWEPSKNTVRTEKCLKLIMGLGTQGAEKKSAAS---------IACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSR---------------------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 869          

HSP 3 Score: 67.0106 bits (162), Expect = 1.072e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2564 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  978 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1038          

HSP 4 Score: 55.8398 bits (133), Expect = 2.332e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 5 Score: 51.2174 bits (121), Expect = 7.651e-6
Identity = 53/241 (21.99%), Postives = 99/241 (41.08%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K               + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  224 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 459          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-050628-1])

HSP 1 Score: 179.874 bits (455), Expect = 4.200e-46
Identity = 182/679 (26.80%), Postives = 296/679 (43.59%), Query Frame = 2
Query:  773 SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSM-EFCSGKICKVQSILPSGDVKVNVDRL-ELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCES--------EPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAV-KNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLG---ISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKL--SVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2740
            S   ++GD V+   ++  ++Q+Q+ HGGW   M E   G +     I   GDV+V    +    ++P  LTK      +           S L +           V LI                V A    LG+VGKV  V  +GDL+V   GQ    NP C+ A   + ++             T+++ L +++ QS    E D P     +    A   G+  +VR+L+    D V      +G   L +A + GH++VVK+L++  ++I AK+E+GD ALH       F I D  +      + Q+   +  + +A +  +  I           + + +S  DT LH A+ K+F +      +    D    NN+ FN  H  A +GN+   EM L R   ++ + +K+D F+ALHLA  NNH     +LLK  + DINIRNN  QT L +AV+Q ++  + +LV +GA+++  D +GDT +H ++    + TV    +  G      +  S    N   +    +A +L ++ A     N   K+P+D    S  + L  S A   R+                V+ G      G     +S + + T    +  L   +  +     C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  198 SHSFQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEIRDGAL-----ITDRGDVRVQYSNIIRWTFHPGALTKARRTHTHTHTHTHTHTHQSYLAQ-----------VCLIG---------------VGAELLALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPGEVDANLMTVENASESSSTVISVLEKLLSQST---EQDNPG----RLVIEAAH-GSAAKVRELLQKHPDKVDIKN--QGKTALQVAAHQGHVEVVKVLLQANSSIEAKDEDGDAALHYTA----FGIADSRVITLNKAHYQHLKGLCSLHMAENR-TEHIVFQCVHVCVCVVCVQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILLKEGRCDINIRNNRNQTPLQLAVTQGHMALVALLVMEGADVNAEDEDGDTAMHTSLSRQQLTTVISSAEGDGAVLYGRLCSSGLMGNTELNVGAAIACFLAQEGADISYANHKGKSPLDLVTDSSVQTLIRSFAEKHRLH--------------AVSCG-----TGSSSSSSSLRRVHTTPNTMTNL--AVPSVTGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIRCQVTITKKIR 808          

HSP 2 Score: 87.8113 bits (216), Expect = 4.075e-17
Identity = 158/769 (20.55%), Postives = 277/769 (36.02%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGM-EWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGN-QANPTAARGQRRRSSA----LEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLL-INKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAG-ADIRAVNNKNFNAFHLVAQRGNERILEMF---------------------LKREGVKIVNSQKDDKFAALH-----LAVFNNHE-------GCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR-IHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            KV  +   ++++ +Q+ HGGW    N  + E  +   I   GD+ V    +  W  +P  + K       +         Q          L Q     V +     G++ KV  +   GD++V        +NP  L+   G   AN          SS     LEKL  +     +  RL+        ++  HG      + +     KV  +   G   +++   + ++                       ++ +++ Q++ S E+ + D D     + A  I    + R +  +      L+G+  L +A N     V + +      +  ++  GDT LH A+ KD   I ++L +    D   QNN     +  AA  G+   T ++ +       +   +  +ALHLA  N H +    LL  G  DI   NN+N     L   +G+  ++ +                      L R+ +  V S  +   A L+       +  N E        C   L +  ADI+  N+  ++ L +         ++   EK     V+   G +    ++R +H+         +  ++G  +    S        +LA+ +L    +  +  +     M  C              R    I  KI Q Q     +              NS QH       LE+L+ R + ME+  TC IC D  I + F CGH +C  C++ L  C ICR++I  +I+L+
Sbjct:  206 KVKCLLEVDILRQMQEGHGGW----NPKMAEIRDGALITDRGDVRVQYSNIIRWTFHPGALTKARRTHTHTHTHTHTHTHQ--------SYLAQVCLIGVGAELLALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPGEVDANLMTVENASESSSTVISVLEKLLSQSTEQDNPGRLV--------IEAAHGSAAKVRELLQKHPDKV-DIKNQGKTALQVAAHQGHV-----------------------EVVKVLLQANSSIEAKDEDGD-AALHYTAFGIA---DSRVITLNKAHYQHLKGLCSLHMAENRTEHIVFQCVHVCVCVVCVQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSRARQLADVKKEDGFSALHLAALNNHRDVAEILLKEGRCDINIRNNRNQTPLQLAVTQGHMALVALLVMEGADVNAEDEDGDTAMHTSLSRQQLTTVISSAEGDGAVLYGRLCSSGLMGNTELNVGAAIACF--LAQEGADISYANHKGKSPLDLVTDSSVQTLIRSFAEKHRLHAVSCGTGSSSSSSSLRRVHTTPNTMTNLAVPSVTGPSECLICS--------ELALLVLFSPCQHSVACEECAHRMKKCI-------------RCQVTITKKIRQDQTEVECSPS----------SENSEQH-----HLLEQLQSRYRQMEERITCPICIDNHIRLVFQCGHASCIDCSSALKTCPICRQTIRERIQLF 888          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 132.494 bits (332), Expect = 8.538e-31
Identity = 107/367 (29.16%), Postives = 181/367 (49.32%), Query Frame = 2
Query: 1391 FFNALKIGNLNEVRKLVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV---RIHSMDTVKKRGKLL------GISGIFQST---------------ASSNEGSDKPE------------DLAIYLLKKKARTDIKNKNDKTPM 2377
             + A +  +L+ VR L+++  + ++   +G  PL +A+  GH  VV LL+E     + K +    ALHIA +KD  K   LL+    + + ++ +  TP+ +AA  G++++  LL  +R A +      + T LH+A K  +   V  LLD G+ I A         H  A+ G+E+++EM L R G  I++  K+   + LH+A   +H  C+++LL++ A ++   N+  TALH+A    +    K++V+K A  +    NG TPLHIA    R+  M+ + K G  L      G++ I  +                AS N  + + E            D+  YLL+  A+ DIK K+D+T +
Sbjct:  145 LYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLL-LNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDR-GAPILSKTKNG-LSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTAL 504          

HSP 2 Score: 122.094 bits (305), Expect = 1.658e-27
Identity = 77/241 (31.95%), Postives = 128/241 (53.11%), Query Frame = 2
Query: 1484 LMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGA--DIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV 2200
            L +A + GH  V K++++K+AN NAK  NG T LHIA +K++ K+ +LL+  GA + A   + +TPI +AA  G  +I + L T   A  +  N   +TALH+A +    + V  LL  GA  DI+A +++   A H+ ++ G   I++  L++  +   N+     +  LHL+    H+    +LL+  + ++       T LH+A     L    +L++K A  D    +G TPLH+A 
Sbjct:  372 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL-THHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQ--TALHIASRLGKLEIVQQLLQKGALP--NAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAA 607          

HSP 3 Score: 117.857 bits (294), Expect = 2.676e-26
Identity = 93/331 (28.10%), Postives = 157/331 (47.43%), Query Frame = 2
Query: 1409 IGNLNEVRKLVDSVGT--STLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV---RIHSMDTVKKRGKLLGI---SGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPM 2377
            +G+ N V++L     +  +T + G   L +A   G IDVV+ L++  A ++ K ++  TALHIA +  K +I   L+ KGA  NA   +  TP+ L+A  G  +I  LL   + + LS    +  T LH+A K    E  N LL   A   A         H+ A   N+R+  + L +      +S   + +  LH+A   N       LL+Y A+ N       + LH+A  +  ++ + +L+ K A +++ + NG TPLH+A    +    + +   G  +     SG      + + G+ K   +A +LL+ +A+ + K KN  TP+
Sbjct:  444 MGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALL-LEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASP--HSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMK---MANFLLENQAKPNAKTKNGYTPL 768          

HSP 4 Score: 116.316 bits (290), Expect = 9.534e-26
Identity = 88/362 (24.31%), Postives = 178/362 (49.17%), Query Frame = 2
Query: 1328 IMGQSDHSDESDEPDNDRTKTFFNALKI----GNLNEVRKLVDSVGTSTLLE--GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK---KRGKL---LGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPM 2377
            ++ Q+DH+ + +      +K+ F  L I    GN+N    L++       +    + PL +A   G+ ++VKLL+++ + I AK ++G T LH   +    ++ ++L+++GA + ++  N ++P+ +A     ++  +LL    NA +    ++  TALH+A    H +    ++D  A+  A     F   H+  ++   +++E+ LK      + +  +     +H+A F  HE  ++ L  + A  N  N   +TALH+A     ++ ++ L++ GA++D+   +  T LHIA R+  ++ V+   ++G L      SG      S+ EG    +++A  LL++ +      K   TP+
Sbjct:  221 LLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL-LQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGAS--LQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGH---QEIAALLLEQGSSLSAATKKGFTPL 570          

HSP 5 Score: 114.39 bits (285), Expect = 3.760e-25
Identity = 82/284 (28.87%), Postives = 143/284 (50.35%), Query Frame = 2
Query: 1373 NDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLE-----GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALL--DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR 2203
            +D   ++  A + GNL    K++D + T   +      G+  L +A   GH++VV  L++  AN++A  + G+TALHIA    + ++   L+  GA+VNAQ+ N  TP+ +AA    +D+ R L    N+  SI   +  T L +A++  H + V+ LL  D    +R        A H+ A++ + +   + L+ +    V S+    F  LH+A    +     +LL   A ++    N  T LH+A  +   N +K+L+++G++I+    +G TPLH   R
Sbjct:   40 SDSNASYLRAARAGNL---EKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFL-LENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR------LPALHIAARKDDTKSAALLLQNDHNADVESKSG--FTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGAR 311          

HSP 6 Score: 113.62 bits (283), Expect = 6.378e-25
Identity = 81/298 (27.18%), Postives = 143/298 (47.99%), Query Frame = 2
Query: 1400 ALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNE 2287
            A ++G L  V++L+   ++  +    G  PL ++   GH ++  LL+E+ ++++A  + G T LH+A +  + ++ +LL+ K A  +A   + +TP+ +AA   +  +  LL   + A          T LH+A K    E    LL+ GA+   V  +  +  HL AQ G+  ++ + L ++    VN    +    LHLA  ++  G   VLL + A+I+ +  +  T LH+A     +     L+E  A+ +    NG TPLH A          ++G    I+ + Q  AS NE
Sbjct:  507 ASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVA-LLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQAN--VNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAA---------QQGHTHIINMLLQYGASPNE 792          

HSP 7 Score: 111.694 bits (278), Expect = 2.348e-24
Identity = 76/248 (30.65%), Postives = 127/248 (51.21%), Query Frame = 2
Query: 1394 FNALKIGNLNEVRKLV-DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKIL 2134
            +  L++ NL   +K   D+ G S    G+ PL +A +  +  V  LL+++ A+ ++  +NG T LHIA +K++ +I   L+  GA+ N      I+P+ LAA  GS+D+  LL T + A++++GN    T LHLA ++  A     LL+ GA+I A     +   H+    GN ++    L+ +     N++  + +  LH A    H   + +LL+Y A  N    N  TAL IA    Y++ +  L
Sbjct:  576 YGQLEVANLLLQKKAAPDAAGKS----GLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLT-KQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKP--NAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTL 816          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 275.404 bits (703), Expect = 1.117e-77
Identity = 207/732 (28.28%), Postives = 358/732 (48.91%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASS---------NEGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            +  +G   + R+G E M + KC+                G++N N+     L  GD+V I  +++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V    S   +  +      +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + +  LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++I+N N QTALH+AV +++   +++LV   A++D+ D +GDTPLH A+R H++  +++   +  +  +  +   S          +G++K     +A +L    A   I+NK  ++P+D C DP+L + L+  +  + S ++                      G H    S   +    E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLLIGDLVNIDLELEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSG-DAAQGAEGGTSP--------FQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATG--ERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRQDVDVNGQCAGHTAMQAASQNGHVDILKLLLKHSVDVEAEDKDGDRAVHHAAFGDEGTVVEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKKL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQV----------------------GSH----SPSMISNDSETLEE-------------CMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 166.777 bits (421), Expect = 1.469e-41
Identity = 198/799 (24.78%), Postives = 324/799 (40.55%), Query Frame = 2
Query:  590 EVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GMEWMINPKCIGKRN---------ENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKI------------------------------------TPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNS---------------QKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK-----KRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNK---NDKTPMDFCDPSLKEKLSVANARRMSKEIETK-ILQAQGPTTVAAGGLMAHP-GDHIDRNSAQHL-KTKD-----EELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            E++++LQ  HGGW + M   +     +  I +D D+ V    G  W  NP  + K N           +  +   + GD+VQIC D+++IK LQ+ HG W  +M    GK+ +VQ I    D+KV V      YNP  +++     +  + A G+R     L +L  K+F   +   L  N+  +K    G              V KV+ +         +  Q +++N +C   T     S+     ++  L +      HS + +  D D  +   +A   G+   V +++   G            PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  I  +L+  GADV   NNN                                      T + LAA    +++  LL    NA+L I N    TALHLAV+  H + V  L+ A A +   +       H   +      L      + V  V++               Q  +K +A  +A F         L    AD+ IRN   Q+ L +       N  K L +   E         +P  I+    +++        KR  L G  G     A+ +  S + +   I   + ++RT I+     +DK       P          A  M K ++ + +++ + P  +   G       D I   + Q L K KD      ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  259 EIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATGER-----LSQLLKKLFETQESGDL--NEELVKAAANG-------------DVAKVEDL---------LKRQDVDVNGQCAGHTAMQAASQNGHVDILKLLLK------HSVDVEAEDKDGDRAVHHA-AFGDEGTVVEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKKLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMGLGTQGAEKKSAASIACF---------LAANGADLTIRNKKGQSPLDLCPDP---NLCKALAKCHKEKSSGQVGSHSPSMISNDSETLEECMVCSDLKRDTLFGPCG---HIATCSLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVPFVMCCSGKGTEDVTDDIAGGNIQALQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          

HSP 3 Score: 55.8398 bits (133), Expect = 3.412e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQD-------------HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            ++E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +               ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 ELEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAV 397          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 275.018 bits (702), Expect = 2.578e-77
Identity = 209/743 (28.13%), Postives = 361/743 (48.59%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVE-----------ATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASS---------NEGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            +  +G   + R+G E M + KC+                G++N N+     L  GD+V I  +++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V            AT    +     + +V +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + +  LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++I+N N QTALH+AV +++   +++LV   A++D+ D +GDTPLH A+R H++  +++   +  +  +  +   S          +G++K     +A +L    A   I+NK  ++P+D C DP+L + L+  +  + S ++                      G H    S   +    E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLLIGDLVNIDLELEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSG-DAAQGAEGGTSP--------FQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATGGKLDYNLSFK-LVERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRQDVDVNGQCAGHTAMQAASQNGHVDILKLLLKHSVDVEAEDKDGDRAVHHAAFGDEGTVVEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKKL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQV----------------------GSH----SPSMISNDSETLEE-------------CMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 875          

HSP 2 Score: 66.6254 bits (161), Expect = 1.682e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2564 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  986 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1046          

HSP 3 Score: 55.8398 bits (133), Expect = 3.718e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQD-------------HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            ++E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +               ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 ELEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAV 397          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 270.396 bits (690), Expect = 3.150e-76
Identity = 209/761 (27.46%), Postives = 355/761 (46.65%), Query Frame = 2
Query:  686 DGDMYVSRLGMEWMINPKCI----------------GKRNE--NKFKSEK--LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVD-RLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEAT----DSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDA-GADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGS---DKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKL--SVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDH---------IDRNSAQH-----------------------------LKTKDEE--LEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            DG   V R+G +  ++ KCI                GK  E   K  SE+   + GD V+   D++ ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+++N   +K+LQ GHGEW + M   LG++GKV  V  +GD++V + GQ    NP C+ +     D++  +  + +   N L  I+ +      S + D +   +       GN  +VR+++        +  +G   L +A + G+++VVK+L++  ANI+ +++ GDTALH A   ++  +  +L++KGA+    NN K T + +A + G  ++ ++L    N  +++ +S  DT LH A+       +  L +    D    NN+ FN  H  A +GN   +   L+R   ++V+S+K+D F ALHLA  NNH+  + +L+K  + D+N+RNN  QT LH+AV+Q +++ + +LV +GA+++  D +GDTP+HI      + ++  + +  G S + +  AS   G+   +    +A +L    A  +  N   K+P+D         L  + A   R  + I   I       T  +    A P +          +     QH                             L+  D++  +EEL+ R + ME+  TC IC D  I + F CGH +C  C+ +L  C ICR+ I  +I+++
Sbjct:  222 DGTTNVYRVGHKGKVDLKCITDAPGGHYYRDHLPKLGKPAELQRKESSERHPFQHGDKVKCLLDVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQYNSETRWTFHPGALTK-------------------------QNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKL----LSQKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQGRTALQVASHLGYMEVVKVLLQANANIDLRDDEGDTALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNP-NCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILER-ARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNIELNVGSAMACFLALSGADINYANHRGKSPLDLIADGRITHLVKNFAQKFRYQRAILPYIHTTPNTMTNLSPCSAASPAECLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARKLRQGGLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 951          

HSP 2 Score: 65.4698 bits (158), Expect = 4.588e-10
Identity = 39/144 (27.08%), Postives = 74/144 (51.39%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQYD------------TRQD-HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D+E ++  Q  HGGWN  M E +                 G +G V+R+    ++ +QY+            T+Q+   +G  V +++N +  K+LQV +GEW+DDM + LG+  ++I+ F DG++++   G+++  N   + +
Sbjct:  285 DVEILREMQEGHGGWNPKMAEFI-----------------GQTGTVHRITERGDVRVQYNSETRWTFHPGALTKQNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTS 411          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 244.588 bits (623), Expect = 3.452e-67
Identity = 193/719 (26.84%), Postives = 338/719 (47.01%), Query Frame = 2
Query:  686 DGDMYVSRLGMEWMINPKCI----------------GKRNE--NKFKSEK--LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVD-RLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEAT----DSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDA-GADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGS---DKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVT-FGCGH-VACDVCANNLYECHICRESIENKIR 2740
            DG   V R+G +  ++ KCI                GK  E   K  SE+   + GD V+   D++ ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+++N   +K+LQ GHGEW + M   LG++GKV  V  +GD++V + GQ    NP C+ +     D++  +  + +   N L  I+ +      S + D +   +       GN  +VR+++        +  +G   L +A + G+++VVK+L++  ANI+ +++ GDTALH A   ++  +  +L++KGA+    NN K T + +A + G  ++ ++L    N  +++ +S  DT LH A+       +  L +    D    NN+ FN  H  A +GN   +   L+R   ++V+S+K+D F ALHLA  NNH+  + +L+K  + D+N+RNN  QT LH+AV+Q +++ + +LV +GA+++  D +GDTP+HI      + ++  + +  G S + +  AS   G+   +    +A +L    A  +  N   K+P+D     +++ L           +   I+    PT                  S + + T    +  L         E  C++C +  + V+ F C H + C+ C+  + +C  C+  I  K+R
Sbjct:  205 DGTTNVYRVGHKGKVDLKCITDAPGGHYYRDHLPKLGKPAELQRKESSERHPFQHGDKVKCLLDVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQYNSETRWTFHPGALTK-------------------------QNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKL----LSQKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQGRTALQVASHLGYMEVVKVLLQANANIDLRDDEGDTALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNP-NCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILER-ARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNIELNVGSAMACFLALSGADINYANHRGKSPLDLIVFPVQDLLCF--------HVSHAIISLDSPTVSC---------------SLRRVHTTPNTMTNLSPCSAASPAE--CLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARKLR 867          

HSP 2 Score: 158.303 bits (399), Expect = 6.229e-39
Identity = 186/765 (24.31%), Postives = 316/765 (41.31%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLG-MEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQ-ANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAM--QFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLIN-KGADVNAQNNNKITPIMLAASAGS-MDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAG-ADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNH--------EGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPL-------------HIAVRIHSMDTVKKRGKLLGI-------SGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            KV  + + E+++ +Q+ HGGW   M  FIG+   + +I + GD+ V       W  +P  + K+N           GD+V++ D++  +K+LQ  HG W + M    G+I KV  +   GD++V+V      +NP  LT  +  + AN       +   + L  +  K+ S                 QK   E   ++  +   G   KV+ +      KV I  Q           T     S      +V  L Q     D  D  DE D     T  +    GN   V +++ S G +  L        L IAVN G  +VV++L      IN ++  GDT LH A+  D   I ++L      D   QNN     +  +A  G+ + ++++L  +R   +     +  TALHLA  N H E V  L+  G  D+   NN+N    HL   +G+  ++ + +  EG   VN++ +D    +H+     H        EG    LL  K + +    N++  +  A++     C   L   GA+I+  +  G +PL             H++  I S+D+      L  +       + +   +A+S        +LA+ +     +  I           C+           +RRM K I+ ++  A+          +      ++ + +  +  + + +EEL+ R + ME+  TC IC D  I + F CGH +C  C+ +L  C ICR+ I  +I+++
Sbjct:  262 KVKCLLDVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQYNSETRWTFHPGALTKQN-------SFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKLLS-----------------QKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQG---------RTALQVASHLGYMEVVKVLLQANANIDLRD--DEGD-----TALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNPNCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILERARQL-VDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVT-EGAD-VNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLT-KLEASGLPGNIELNVGSAMA-----CF--LALSGADINYANHRGKSPLDLIVFPVQDLLCFHVSHAIISLDSPTVSCSLRRVHTTPNTMTNLSPCSAASPAECLVCSELAVLVSFFPCQHSI----------VCEEC---------SRRMKKCIKCQVCIARK---------LRQDSTEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 947          

HSP 3 Score: 65.4698 bits (158), Expect = 3.578e-10
Identity = 39/144 (27.08%), Postives = 74/144 (51.39%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQYD------------TRQD-HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D+E ++  Q  HGGWN  M E +                 G +G V+R+    ++ +QY+            T+Q+   +G  V +++N +  K+LQV +GEW+DDM + LG+  ++I+ F DG++++   G+++  N   + +
Sbjct:  268 DVEILREMQEGHGGWNPKMAEFI-----------------GQTGTVHRITERGDVRVQYNSETRWTFHPGALTKQNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTS 394          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 244.202 bits (622), Expect = 3.917e-67
Identity = 194/719 (26.98%), Postives = 339/719 (47.15%), Query Frame = 2
Query:  686 DGDMYVSRLGMEWMINPKCI----------------GKRNE--NKFKSEK--LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVD-RLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEAT----DSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDA-GADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGS---DKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVT-FGCGH-VACDVCANNLYECHICRESIENKIR 2740
            DG   V R+G +  ++ KCI                GK  E   K  SE+   + GD V+   D++ ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+++N   +K+LQ GHGEW + M   LG++GKV  V  +GD++V + GQ    NP C+ +     D++  +  + +   N L  I+ +      S + D +   +       GN  +VR+++        +  +G   L +A + G+++VVK+L++  ANI+ +++ GDTALH A   ++  +  +L++KGA+    NN K T + +A + G  ++ ++L    N  +++ +S  DT LH A+       +  L +    D    NN+ FN  H  A +GN   +   L+R   ++V+S+K+D F ALHLA  NNH+  + +L+K  + D+N+RNN  QT LH+AV+Q +++ + +LV +GA+++  D +GDTP+HI      + ++  + +  G S + +  AS   G+   +    +A +L    A  +  N   K+P+D         L    A++  +++E        PT                  S + + T    +  L         E  C++C +  + V+ F C H + C+ C+  + +C  C+  I  K+R
Sbjct:  205 DGTTNVYRVGHKGKVDLKCITDAPGGHYYRDHLPKLGKPAELQRKESSERHPFQHGDKVKCLLDVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQYNSETRWTFHPGALTK-------------------------QNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKL----LSQKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQGRTALQVASHLGYMEVVKVLLQANANIDLRDDEGDTALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNP-NCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILER-ARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNIELNVGSAMACFLALSGADINYANHRGKSPLDLIADGRITHLVKNFAQKFREQVEL-----DSPTVSC---------------SLRRVHTTPNTMTNLSPCSAASPAE--CLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARKLR 870          

HSP 2 Score: 159.458 bits (402), Expect = 2.378e-39
Identity = 184/762 (24.15%), Postives = 313/762 (41.08%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLG-MEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQ-ANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAM--QFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLIN-KGADVNAQNNNKITPIMLAASAGS-MDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAG-ADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNH--------EGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPS---LKEKLSV--------------ANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            KV  + + E+++ +Q+ HGGW   M  FIG+   + +I + GD+ V       W  +P  + K+N           GD+V++ D++  +K+LQ  HG W + M    G+I KV  +   GD++V+V      +NP  LT  +  + AN       +   + L  +  K+ S                 QK   E   ++  +   G   KV+ +      KV I  Q           T     S      +V  L Q     D  D  DE D     T  +    GN   V +++ S G +  L        L IAVN G  +VV++L      IN ++  GDT LH A+  D   I ++L      D   QNN     +  +A  G+ + ++++L  +R   +     +  TALHLA  N H E V  L+  G  D+   NN+N    HL   +G+  ++ + +  EG   VN++ +D    +H+     H        EG    LL  K + +    N++  +  A++     C   L   GA+I+  +  G +PL +             G++  +   F          D P    +    ++  T      + +P     P+   +  +L+V                +RRM K I+ ++  A+          +      ++ + +  +  + + +EEL+ R + ME+  TC IC D  I + F CGH +C  C+ +L  C ICR+ I  +I+++
Sbjct:  262 KVKCLLDVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQYNSETRWTFHPGALTKQN-------SFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKLLS-----------------QKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQG---------RTALQVASHLGYMEVVKVLLQANANIDLRD--DEGD-----TALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNPNCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILERARQL-VDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVT-EGAD-VNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLT-KLEASGLPGNIELNVGSAMA-----CF--LALSGADINYANHRGKSPLDLIA----------DGRITHLVKNFAQKFREQVELDSP---TVSCSLRRVHTTPNTMTNLSPCSAASPAECLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARK---------LRQDSTEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 950          

HSP 3 Score: 65.4698 bits (158), Expect = 4.358e-10
Identity = 39/144 (27.08%), Postives = 74/144 (51.39%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQYD------------TRQD-HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D+E ++  Q  HGGWN  M E +                 G +G V+R+    ++ +QY+            T+Q+   +G  V +++N +  K+LQV +GEW+DDM + LG+  ++I+ F DG++++   G+++  N   + +
Sbjct:  268 DVEILREMQEGHGGWNPKMAEFI-----------------GQTGTVHRITERGDVRVQYNSETRWTFHPGALTKQNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTS 394          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 283.108 bits (723), Expect = 1.801e-80
Identity = 208/736 (28.26%), Postives = 361/736 (49.05%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASS---------NEGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A++++GD A+H A   D+  + ++L    AD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + +  LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++I+N N QTALH+AV +++   +++LV  GA++D+ D +GDTPLH A+R H++  +++   +  +  +  +   S          +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  ++S ++ ++                          S   +    E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANIVRSG-DAAQGAEGGTSQ--------FQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKV------APAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSR--------------------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 57.7658 bits (138), Expect = 7.336e-8
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQY------DTRQ-------DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L +       D  Q         ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 3 Score: 51.6026 bits (122), Expect = 5.093e-6
Identity = 40/176 (22.73%), Postives = 75/176 (42.61%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXK------VMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGK 751
            G+ YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++    +       +      V +  + E +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K
Sbjct:  224 GSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSK 399          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 283.108 bits (723), Expect = 1.801e-80
Identity = 208/736 (28.26%), Postives = 361/736 (49.05%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASS---------NEGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A++++GD A+H A   D+  + ++L    AD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + +  LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++I+N N QTALH+AV +++   +++LV  GA++D+ D +GDTPLH A+R H++  +++   +  +  +  +   S          +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  ++S ++ ++                          S   +    E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANIVRSG-DAAQGAEGGTSQ--------FQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKV------APAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSR--------------------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 57.7658 bits (138), Expect = 7.336e-8
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQY------DTRQ-------DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L +       D  Q         ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 3 Score: 51.6026 bits (122), Expect = 5.093e-6
Identity = 40/176 (22.73%), Postives = 75/176 (42.61%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXK------VMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGK 751
            G+ YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++    +       +      V +  + E +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K
Sbjct:  224 GSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSK 399          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 223.402 bits (568), Expect = 7.106e-62
Identity = 155/547 (28.34%), Postives = 277/547 (50.64%), Query Frame = 2
Query: 1169 GKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASS---------NEGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            GKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A++++GD A+H A   D+  + ++L    AD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + +  LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++I+N N QTALH+AV +++   +++LV  GA++D+ D +GDTPLH A+R H++  +++   +  +  +  +   S          +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  ++S ++ ++                          S   +    E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:    2 GKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKV------APAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSR--------------------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 498          

HSP 2 Score: 130.568 bits (327), Expect = 8.742e-31
Identity = 179/682 (26.25%), Postives = 289/682 (42.38%), Query Frame = 2
Query:  884 GKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND--TALHLAVKNFHAESVNALL---DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL------KYKADINIRNNNLQTALHIAVSQK----YLNCMKILVEKGAEIDVTDANGDTPL----------------------HIAVRIHSM-----DTVK--------KRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNK---NDKTPMDFCDPSLKEKLSVANARRMSKEIETK-ILQAQGPTTVAAGGLMAH-PGDHIDRNSAQHL-KTKD-----EELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            GK+ +VQ I    D+KV V      YNP  ++K     +  + A G+R     L +L  K+F   +   L  N+  +K    G    V  ++ +L    K   VDVNG               +C   T     S+      V+ L  ++ Q+    E+++ D DR          G + EV     +   +       PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  I  +L+  GADV   NNN    +  AA  G+    R+L +       +   ++D  TALHLA  N H E    L+   +A  DI+ VN +   A HL  +R + +I+ + + R G K+ + Q  D    LH A+ ++    LR L       K  A      N L   L    ++K     + C   L   GA++ + +  G +PL                       +  R  SM     +T++        KR  L G  G     A+ +  S + +   I   + ++RT I+     +DK       P          A  M K ++ + +++ + P     GG  +  P D I   +   L K KD      ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:    2 GKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVAPAGSAISNASGER-----LSQLLKKLFETQESGDL--NEELVKAAANGD---VAKVEDLL----KRPDVDVNG---------------QCAGHTAMQAASQ---NGHVDILKLLLKQNVDV-EAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQT--ALHLAVERQHTQIVRLLV-RAGAKL-DIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACF--LAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCG---HIATCSLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVPFITCCGGKSSEDPSDEISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 641          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Match: Mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2679684])

HSP 1 Score: 204.912 bits (520), Expect = 4.991e-54
Identity = 149/577 (25.82%), Postives = 269/577 (46.62%), Query Frame = 2
Query: 1067 FSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVK-NFHAESVNALLD--AGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHS-MDTVKKRGKLLGISGIFQSTASSNEGSDKP--------EDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2740
            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +          +GN    L+ +R+  + V T    +G   L +A   G +++V+LL++ RA+++  ++ G+T LH     ++ +   +L++ G  V+A+N  + T + +A   G +++ ++L   R  D+++ ++  DT LH A+     A S+  +L    G D+ A N++ F   H  + +G+   +   L R   ++V+++K+D F ALHLA  NNH    +VL++  + D+N+RN  LQ+ LH+AV Q +L  + +LV+ G  ++  D  GDT LH+A++ H  +  V  R    G  G  Q   S  + S  P          +A +L  + A     N   ++P+D        K     A+R  +                                 +H+ +    +  L        +   C++C +  + + F  C H   C+ CA  + +C  C+  I  K+R
Sbjct:  292 FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRTQKSDPEHPGRLVVEAALGNVARALDLLRRHPEQVDTKN--QGRTALQVAAYLGQVELVRLLLQARASMDLPDDEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKILC-ERGCDVNLPDAHADTPLHSAISAGAGASSIVEVLTEVPGIDVTATNSQGFTLLHHASLKGHVLAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQVLIREGRCDVNVRNRKLQSPLHLAVQQAHLGLVPLLVDAGCSVNTEDEEGDTALHVALQRHQLLPLVADRAG--GDPGPLQ-LLSRLQASGLPGCTELTVGAAVACFLALEGADVSYANHRGRSPLDLATEGRVLKALQGCAQRFRERQAGGGGGVP--------------------PGPRHVLSTPNTVTNLHVSGTAGPEAAECLVCSELALLILFSPCQHRTVCEECARRMKKCIRCQVVISKKLR 841          

HSP 2 Score: 52.373 bits (124), Expect = 3.394e-6
Identity = 29/129 (22.48%), Postives = 51/129 (39.53%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E                                           +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:  268 DTDVLRDMQEGHGGWNPRMAE--------------------------------------HNSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVA 358          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Match: Mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2679684])

HSP 1 Score: 128.257 bits (321), Expect = 1.845e-31
Identity = 91/373 (24.40%), Postives = 169/373 (45.31%), Query Frame = 2
Query:  686 DGDMYVSRLGMEWMINPKCIGKRNENKFKSEKL--------------------RKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDR-LELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLL 1729
            DG   V R+G +  ++ +C+G+     +  E L                    ++GD V+   D   ++ +Q+ HGGW   M    G++  V  I   GDV+V  +      ++P  LTK                            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +          +GN    L+ +R+  + V T    +G   L +A   G +++V+LL++ RA+++  ++ G+T LH     ++ +   +L++ G  V+A+N  + T + +A   G +++ ++L
Sbjct:   30 DGTTNVYRVGHKGKVDLRCVGEAAGGFYYKEHLPKLGKPAELQRRVSADGQPFQRGDKVKCLLDTDVLRDMQEGHGGWNPRMAEFIGQMGTVHRITDRGDVRVQFNHETRWTFHPGALTKHNS-------------------------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRTQKSDPEHPGRLVVEAALGNVARALDLLRRHPEQVDTKN--QGRTALQVAAYLGQVELVRLLLQARASMDLPDDEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKIL 375          

HSP 2 Score: 79.7221 bits (195), Expect = 2.823e-15
Identity = 82/333 (24.62%), Postives = 145/333 (43.54%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVS-RLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLT--KCEGNQANPTAARGQRRRSS---ALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQ--LTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLL 1531
            KV  + +++V++++Q+ HGGW   M  FIG+   + +I   GD+ V       W  +P  + K N           GD+V++  D+  +K+LQ  HG W + M    G++ KV  +   G+++V V      ++P  L   + E +     A R +  +SS   AL+KL  +   P    RL+                   ++  LG V   +++D+            L  +PE V+ T +   +   +   + Q  L +++ Q+  S   D PD D   T  +   +GN  E  +++ S G +           L +AV  G ++VVK+L
Sbjct:   87 KVKCLLDTDVLRDMQEGHGGWNPRMAEFIGQMGTVHRITDRGDVRVQFNHETRWTFHPGALTKHNS-------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRTQKSDPEHPGRLV-------------------VEAALGNV--ARALDL------------LRRHPEQVD-TKNQGRTALQVAAYLGQVELVRLLLQARAS--MDLPD-DEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKIL 375          

HSP 3 Score: 66.2402 bits (160), Expect = 6.713e-11
Identity = 75/332 (22.59%), Postives = 138/332 (41.57%), Query Frame = 2
Query: 1025 RRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQ-KLNLNPECVEATDSDCESEPDIQTMVNQLTQIMG-QSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHID-----VVKLLIEKRANINAKEENGDTALHIAVQKDKFKI-----------------------CDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMF 1930
            +RR SA    + + F  GDKV+ + +   ++ +Q+GHG W   M   +G++G V  +   GD++V+   + +   +P  +   +S      D+  ++  L  +   Q+ H + +D+           A  +G + +V K+           G   L +AV G         +V    E+ AN++  E   +    ++V  DK +                         DLL      V+ +N  + T + +AA  G +++ RLL  +R A + + + E +T LH        E+   LL AG  + A N     A H+  QRG   ++++ 
Sbjct:   72 QRRVSA----DGQPFQRGDKVKCLLDTDVLRDMQEGHGGWNPRMAEFIGQMGTVHRITDRGDVRVQFNHETRWTFHPGALTKHNSFWVG--DVVRVIGDLDTVKRLQAGHGEWTDD----------MAPALGRVGKVVKVF----------GDGNLRVAVGGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRTQKSDPEHPGRLVVEAALGNVARALDLLRRHPEQVDTKNQGR-TALQVAAYLGQVELVRLLLQAR-ASMDLPDDEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKIL 375          

HSP 4 Score: 58.5362 bits (140), Expect = 2.138e-8
Identity = 36/144 (25.00%), Postives = 66/144 (45.83%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQY--DTRQDHK-----------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E +                 G  G V+R+    ++ +Q+  +TR               +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:   93 DTDVLRDMQEGHGGWNPRMAEFI-----------------GQMGTVHRITDRGDVRVQFNHETRWTFHPGALTKHNSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVA 219          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q80SY4|MIB1_MOUSE (E3 ubiquitin-protein ligase MIB1 OS=Mus musculus OX=10090 GN=Mib1 PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.260e-79
Identity = 208/736 (28.26%), Postives = 361/736 (49.05%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASS---------NEGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A++++GD A+H A   D+  + ++L    AD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + +  LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++I+N N QTALH+AV +++   +++LV  GA++D+ D +GDTPLH A+R H++  +++   +  +  +  +   S          +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  ++S ++ ++                          S   +    E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANIVRSG-DAAQGAEGGTSQ--------FQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKV------APAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSR--------------------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 57.7658 bits (138), Expect = 5.132e-7
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQY------DTRQ-------DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L +       D  Q         ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q86YT6|MIB1_HUMAN (E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 3.101e-79
Identity = 206/732 (28.14%), Postives = 361/732 (49.32%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASS---------NEGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V    S   +  +      +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A++++GD A+H A   D+  + ++L    AD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + +  LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++I+N N QTALH+AV +++   +++LV  GA++D+ D +GDTPLH A+R H++  +++   +  +  +  +   S          +G++K     +A +L    A   I+NK  ++P+D C DP+L + L+  +  ++S ++ ++                          S   +    E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANIVRSG-DAAQGAEGGTSQ--------FQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASG--ERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSR--------------------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 57.7658 bits (138), Expect = 5.220e-7
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQY------DTRQ-------DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L +       D  Q         ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q804S5|MIB1_DANRE (E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 6.724e-79
Identity = 213/741 (28.74%), Postives = 366/741 (49.39%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN--------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETK---------ILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGHV-ACDVCANNLYECHICRESIENK 2734
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + ++ LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++++N N QTALH+AV +++   +++LV   A++DV D +GDTPLH A+R H++  +++   +  +S +     S N        +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++          L+     +      +  P  HI   S    + K   +   ++++Q     + C++C D+   V F  CGH+ AC+ CA+ + +C  CR  +E +
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKV------APAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLI--CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERR 905          

HSP 2 Score: 171.4 bits (433), Expect = 3.320e-42
Identity = 185/739 (25.03%), Postives = 309/739 (41.81%), Query Frame = 2
Query:  590 EVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GMEWMINPKCIGKRN---------ENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND--TALHLAVKNFHAESVNALLDAG---ADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            E++++LQ  HGGW + M   +     +  I +D D+ V    G  W  NP  + K N           +  S +   GD+VQIC DI +IK LQ+ HG W  +M    GK+ +VQ I    D+KV V      YNP  +TK     +  T A G+R     L +L  K+F   +   +  N+  +K    G    +  ++ +L    K   VDVNG               +C   T     S+      V+ L  ++    HS + +  D D  +   +A   G+   V +++   G            PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  +  +L+  GADV   NNN    +  AA  G+    R+L +       +   ++D  TALHLA  N H E    L+  G    D++ VN +   A HL  +R + +I                                   +R+L++ +A +++++ +  T LH A+    L+ ++ L       D+ D +   P   +     M         LG  G  + +A+S         +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++                           +  L + +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  259 EIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGER-----LSQLLKKLFETQESGDI--NEELVKAAANGD---LAKVEDIL----KRPDVDVNG---------------QCAGHTAMQAASQ---NGHVDVLKLLL---KHSVDLEAEDKDGDRAVHHA-SFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQ--TALHLAVERQHTQI-----------------------------------VRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQ------DMQDVSKVEPWEPSKNTLIMG--------LGTQGAEKKSAAS---------IACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSR---------------------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 861          

HSP 3 Score: 67.0106 bits (162), Expect = 7.474e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2564 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  970 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          

HSP 4 Score: 56.225 bits (134), Expect = 1.727e-6
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q6GNY1|MIB1_XENLA (E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis OX=8355 GN=mib1 PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 1.646e-76
Identity = 204/731 (27.91%), Postives = 360/731 (49.25%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN----------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            +  +G   + R+G E M + KC+                G++N N+     L  GD+V I  +++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V    S   +  +      +L+Q++ +   + ES + + +  K   N   +  ++++ K  D V  +    G   +  A   GH+D++KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L    +   S+ +SE DT LH A+     + +  LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++I+N N QTALH+AV +++   +++LV   A++D+ D +GDTPLH A+R H++  +++   +  +  +  +T   +          +G++K     +A +L    A   ++NK  ++P+D C DP+L + L+  +  + S ++                      G H    S   +    E LEE             C++C D   +  FG CGH+A C +C+  + +C +C+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLLIGDLVNIDLELEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSG-DAAQGAEGGTSP--------FQVGDLVQICYDIERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATG--ERLSQLLKKLFETQESGDLNEELVKAAANG-DVAKVDDLLKRQD-VDVNGQCAGHTAMQAASQNGHVDILKLLLKHSVDVEAEDKDGDRAVHHAAFGDEGTVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKKL-LDFSCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLAVRNKKGQSPLDLCPDPNLCKTLAKCHKEKSSGQV----------------------GSH----SPSMINNDSETLEE-------------CMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLLCKEQVQSRTKI 864          

HSP 2 Score: 160.999 bits (406), Expect = 5.218e-39
Identity = 197/800 (24.62%), Postives = 321/800 (40.12%), Query Frame = 2
Query:  590 EVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GMEWMINPKCIGKRN---------ENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKI------------------------------------TPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNS----------------QKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK-----KRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNK---NDKTPMDFCDPSLKEKLSVANARRMSKEIETK-ILQAQGPTTVAAGGLMAHP-GDHIDRNSAQHL-KTKD-----EELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            E++++LQ  HGGW + M   +     +  I +D D+ V    G  W  NP  + K N           +  +   + GD+VQIC DI++IK LQ+ HG W  +M    GK+ +VQ I    D+KV V      YNP  +++     +  + A G+R     L +L  K+F   +   L  N+  +K    G    V+ +        K + VDVNG               +C   T     S+     ++  L +      HS + +  D D  +   +A   G+   V +++   G            PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  I  +L+  GADV   NNN                                      T + LAA    +++  LL    +A+L I N    TALHLAV+  H + V  L+ A A +   +       H   +      L      + V  V++                Q  +K +A  +A F         L    AD+ +RN   Q+ L +       N  K L +   E         +P  I     +++        KR  L G  G     A+ +  S + +   +   + ++RT I+     +DK       P          A  M K ++ + +++ + P  +   G       D I   +   L K KD      ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  259 EIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDIERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATGER-----LSQLLKKLFETQESGDL--NEELVKAAANGDVAKVDDLL-------KRQDVDVNG---------------QCAGHTAMQAASQNGHVDILKLLLK------HSVDVEAEDKDGDRAVHHA-AFGDEGTVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKKLLDFSCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTTWEPSKNTLIMGLGTQGAEKKSAASIACF---------LAANGADLAVRNKKGQSPLDLCPDP---NLCKTLAKCHKEKSSGQVGSHSPSMINNDSETLEECMVCSDLKRDTLFGPCG---HIATCSLCSPRVKKCLLCKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVPFVMCCSGKGTEDVADDIAGGNIPALQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1007          

HSP 3 Score: 56.225 bits (134), Expect = 1.619e-6
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQD-------------HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            ++E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +               ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 ELEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDIERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAV 397          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q9VUX2|MIB_DROME (E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3)

HSP 1 Score: 271.166 bits (692), Expect = 1.278e-74
Identity = 201/699 (28.76%), Postives = 336/699 (48.07%), Query Frame = 2
Query:  791 GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRL-ELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECV----EATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDS----------------VGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVK-IVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETK-----------------ILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKT-----CIICYDRPINVTF-GCGHVA-CDVCANNLYECHICRESIENKIRL 2743
            GD V +  D++ ++ LQ  HGGW + M  C      V  I    D+ V  +      +NP +LTK     ++PT A  +              F  GD V++ ++   IK LQ+GHGEW +AMQ  LGK+G+V+ V  + DLKV++       NP  V     +T SD    P I +   +L+ I+ +    + S     D T+ F  A   G      + +                  V  + +  G   L  A   GHI+V+++L+    ++  ++++GD A+H A   D+  + ++L   GAD+NA+N  + T + +A + G +++ + L T      S+ +SE DT LH A+   H E ++ LLD GADI   NN  FNA H  A +GN   +++ L +     IV  +KDD + ALHLA  NNH     +L+   KA+++ +N NLQTALH+AV ++++  +K+LV+ GA++++ D +GDTPLH A+R H++  +K+   + G   +     ++N        +A +L    A   +KN+  +TP+D C DP+L + L      R + + E                    L       +    L A         S+  +   +    E+ Q + +   + +     C++C D   +  F  CGHV+ C+ CA  + +C ICRE++ ++ ++
Sbjct:  343 GDKVTVDLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKV----SSPTTAPPE--------------FQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSS-ERLSAILKKLFEPNVS----GDATEEFVKAAANGFAARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHAVDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVKTLLT-LGCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQTALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLHEALRHHTLSQLKQLQDVEGFGKLLMGLRNANN-KKASASIACFLAANGADLTLKNRKQQTPLDLCPDPNLCKTLVKCYNERKTDDSELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAA--SSTFPAASSSSIFALNGIANEMSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSREKI 1014          

HSP 2 Score: 96.6709 bits (239), Expect = 6.275e-19
Identity = 54/171 (31.58%), Postives = 87/171 (50.88%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSR-LGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSP 1075
            KV +  + E++++LQ  HGGW + M   +     +V I +D D+ V+   G  W  NP  + K +       + + GDIV+IC D++ IK LQ+ HG W ++M+   GKI +VQ +    D+KV V      YNP+ + K   + A+  +       S  L  +  K+F P
Sbjct:  345 KVTVDLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSSERLSAILKKLFEP 515          

HSP 3 Score: 65.0846 bits (157), Expect = 3.347e-9
Identity = 22/62 (35.48%), Postives = 45/62 (72.58%), Query Frame = 2
Query: 2561 EELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            +++++L+Q++QD++++  C +C+DR  N+ F CGH  C +C + +  C ICR+++E +I L+
Sbjct: 1165 DDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1226          

HSP 4 Score: 60.077 bits (144), Expect = 1.163e-7
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQ-SLGSCAIVKGPSGNVYRLNSELLIQYDTR----QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTS 532
            D+E ++  Q  HGGW   M ECL+    +V        +V   SGN +  N  +L +  +      + ++G  V +  + E  K LQ  +GEW+D M   LGK   + Q + D ++K++    ++  N  A+    CK  S
Sbjct:  351 DLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAV----CKVAS 487          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A0L8FX87 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22005289mg PE=4 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 1.161e-88
Identity = 242/790 (30.63%), Postives = 393/790 (49.75%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GME---WMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCE-----GNQANPTAARGQRRR--------SSALEKLEVKV---------FSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECV-EATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALL-DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPED----LAIYLLKKKARTDIKNKNDKTPMD-FCDPSLKEKL----SVANARRMSKEIETK-------ILQAQGPTTVAAGGLMAHPGDHI-------DRNSAQH-------LKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            +V +  +   +K LQ+ HGGW   M  FIG+ V IV+ + + D  + +  G+    W  NPK + K        +K   GD V+I DDI+++K+ Q NHGGW   M    GKI  V+   P GD+ V+V     ++NP+  TK       G + + T+      +        S  L+ ++  +         F  G+ V++I +  K+K  Q+ HG WV+ M  +LGK  +VK V  NG L V + G+  ++NP+C  + + S  +SE D +++ + + Q+   S  +   D         F      G+   VR+ +    D +       G   L +A   GH D+V +L+E  A++  ++++GDTAL+ +    + +I +LL++KGA  NA N N+ T + +A +  S+   R+L    +A ++I +S  DTALH A++  + E ++ L+ D+  D +  N + FN  H  A RGN       L++    IVN +KDD F ALHLA  N H      LL   +A+INI+N++ QT L +A +Q ++  +++L+ KGAE++V D +G+  LH+AV   ++   K   K++           S  G D+ E     +A YL+ K A    KN+ D  P+D   D SL EKL    S++  +    +IE +       +L +    TV     +  P  H+        R   +H       +  K    +  ++RI+++E+  TC IC DRP N+ F CGH  C  C  +L ECH+C + I+ K+ LY
Sbjct:   15 RVSMYEDINTIKLLQEGHGGWNPFMANFIGQ-VGIVQGVNNVDDVIVKFEGLSKNLWRFNPKALTK-------IDKFSVGDAVKILDDIEQVKRYQINHGGWSPDMTSVLGKIGSVKIAFPDGDLFVSVSGKIFLFNPLCCTKVPQSMKVGEEDDATSIMEVMEQFFNLKTGFSGLLQSMQGIMGDSERQDDQFLVGETVKIIEDIQKVKAYQEKHGGWVDDMVSILGKTARVKLVLPNGALLVSVSGKMCSINPKCCRKVSRSVDDSESDSESVDDMMQQLFNMSFGATVLD--------GFVKEAAKGHTRNVREFIKNHRDEIDKKC--SGKTALQVASYKGHKDIVLMLLEAGADLELQDDDGDTALNFSAIGGETEIMELLLSKGAKTNALNKNRHTALHIAVNKESVKCVRIL-VKHSAPINIQDSLGDTALHDAIRKENEEIIDMLISDSRIDFKIRNKRGFNTLHYAAIRGNNFATVSILQK-CQDIVNVKKDDGFTALHLAALNGHREVANTLLSVGRAEINIKNSSGQTPLFLAATQGHIGLIELLILKGAEVNVEDEDGNICLHLAVSRQNVSISKDDLKII-------ENIRSQLGLDESERAEVVIACYLVHKGANPYYKNRQDVMPLDIMSDQSLIEKLVKVASLSTEQPCGAQIEERRSNNKDCMLCSNKQATV-----LFQPCCHVLICEHCNVRVPVKHCLQCKVLIADKITIHDPQQKRIEELEERVTCPICMDRPRNMAFECGHTVCKECGESLKECHMCSKPIQKKLNLY 772          

HSP 2 Score: 129.413 bits (324), Expect = 7.520e-27
Identity = 153/611 (25.04%), Postives = 263/611 (43.04%), Query Frame = 2
Query:  317 IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQD-GNVKIKYRGRT---FRINSKAILTDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCI----------------------------------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVG--TSTLLEGVY-PLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKG-ADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAG-ADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAV 2002
            +G  V++ E+    K LQ  +G W+  M N +G+ V I+Q   +  +V +K+ G +   +R N KA          +   + F  G+ V ++ + E +K  Q +HGGW   M   +G+   +     DGD++VS  G  ++ NP C                                         G   +++ + ++   G+ V+I +DIQK+K  Q+ HGGWV+ M    GK  +V+ +LP+G + V+V       NP    K         +       S +++ +  ++F+      +++    +K   KGH    N  +F                    I   +  ++ +C   T     S    + +V  L +    +D   + D+ D     T  N   IG   E+ +L+ S G  T+ L +  +  L IAVN   +  V++L++  A IN ++  GDTALH A++K+  +I D+LI+    D   +N      +  AA  G+   T  +       +++   +  TALHLA  N H E  N LL  G A+I   N+       L A +G+  ++E+ + + G + VN + +D    LHLAV
Sbjct:   12 VGDRVSMYEDINTIKLLQEGHGGWNPFMANFIGQ-VGIVQGVNNVDDVIVKFEGLSKNLWRFNPKA----------LTKIDKFSVGDAVKILDDIEQVKRYQINHGGWSPDMTSVLGKIGSVKIAFPDGDLFVSVSGKIFLFNPLCCTKVPQSMKVGEEDDATSIMEVMEQFFNLKTGFSGLLQSMQGIMGDSERQDDQFLVGETVKIIEDIQKVKAYQEKHGGWVDDMVSILGKTARVKLVLPNGALLVSVSGKMCSINPKCCRKVS------RSVDDSESDSESVDDMMQQLFNMSFGATVLDG--FVKEAAKGHTR--NVREF--------------------IKNHRDEIDKKCSGKTALQVASYKGHKDIVLMLLE--AGADLELQDDDGD-----TALNFSAIGGETEIMELLLSKGAKTNALNKNRHTALHIAVNKESVKCVRILVKHSAPINIQDSLGDTALHDAIRKENEEIIDMLISDSRIDFKIRNKRGFNTLHYAAIRGNNFATVSILQKCQDIVNVKKDDGFTALHLAALNGHREVANTLLSVGRAEINIKNSSGQTPLFLAATQGHIGLIELLILK-GAE-VNVEDEDGNICLHLAV 572          

HSP 3 Score: 116.701 bits (291), Expect = 7.171e-23
Identity = 150/572 (26.22%), Postives = 245/572 (42.83%), Query Frame = 2
Query:  791 GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLE---LVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAV---------------NGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKI---CDLLINKGADVNAQNNNKITPIMLAASAGSMDITRL--------LATSRNADLSIGNSEND--------TALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILV-EKGAEIDVTDANGDTPLHI-AVRIHSMDTVKKRGKLLGISGIFQS---TASSNEGSDKPEDLAIYLLK-KKARTDIKNKNDKTPM 2377
            GD V + +DI  IK LQ+ HGGW   M    G++  VQ +    DV V  + L      +NP  LTK                         +  FS GD V+++++  ++KR Q  HG W   M  VLGK+G VK    +GDL V + G+    NP C       C   P  Q+M       +G+ D +    E      + FFN LK G    ++ +   +G S   +  + +   V               +GG +D +  ++ K A +     NG  AL ++V      I   C   +++  D +  ++  +  +M      S   T L           +RN    I N  ++        TAL +A    H + V  LL+AGAD+   ++    A +  A  G   I+E+ L + G K  N+   ++  ALH+AV      C+R+L+K+ A INI+++   TALH A+ ++    + +L+ +   +  + +  G   LH  A+R ++  TV    K   I  + +    TA      +   ++A  LL   +A  +IKN + +TP+
Sbjct:   13 GDRVSMYEDINTIKLLQEGHGGWNPFMANFIGQVGIVQGVNNVDDVIVKFEGLSKNLWRFNPKALTK-------------------------IDKFSVGDAVKILDDIEQVKRYQINHGGWSPDMTSVLGKIGSVKIAFPDGDLFVSVSGKIFLFNPLC-------CTKVP--QSMK------VGEEDDATSIMEV----MEQFFN-LKTGFSGLLQSMQGIMGDSERQDDQFLVGETVKIIEDIQKVKAYQEKHGGWVDDMVSILGKTARVKLVLPNG--ALLVSVSGKMCSINPKCCRKVSRSVDDSESDSESVDDMMQQLFNMSFGATVLDGFVKEAAKGHTRNVREFIKNHRDEIDKKCSGKTALQVASYKGHKDIVLMLLEAGADLELQDDDGDTALNFSAIGGETEIMELLLSK-GAK-TNALNKNRHTALHIAVNKESVKCVRILVKHSAPINIQDSLGDTALHDAIRKENEEIIDMLISDSRIDFKIRNKRGFNTLHYAAIRGNNFATVSILQKCQDIVNVKKDDGFTALHLAALNGHREVANTLLSVGRAEINIKNSSGQTPL 535          

HSP 4 Score: 81.2629 bits (199), Expect = 8.810e-12
Identity = 71/261 (27.20%), Postives = 117/261 (44.83%), Query Frame = 2
Query:  122 KDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSC--AIVK--GPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM-------------------LIRNSE-------------VMKNLQK------DHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSE 778
            +D+ TIK+ Q  HGGWN  M     G   +VQ + +    IVK  G S N++R N + L + D      +G  V ++++ E+ KR Q+ +G WS DM ++LGK   +   F DG++ +   G+ F  N     T   +   +  E+      +VM                   ++ +SE             +++++QK       HGGW + M   +G+   +  +L +G + VS  G    INPKC  K + +   SE
Sbjct:   20 EDINTIKLLQEGHGGWNPFMAN-FIGQVGIVQGVNNVDDVIVKFEGLSKNLWRFNPKALTKIDK---FSVGDAVKILDDIEQVKRYQINHGGWSPDMTSVLGKIGSVKIAFPDGDLFVSVSGKIFLFNP-LCCTKVPQSMKVGEEDDATSIMEVMEQFFNLKTGFSGLLQSMQGIMGDSERQDDQFLVGETVKIIEDIQKVKAYQEKHGGWVDDMVSILGKTARVKLVLPNGALLVSVSGKMCSINPKCCRKVSRSVDDSE 275          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A498NZI9 (E3 ubiquitin-ligase mib1 isoform X1 OS=Labeo rohita OX=84645 GN=ROHU_002127 PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 7.397e-84
Identity = 242/883 (27.41%), Postives = 419/883 (47.45%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVE-----------ATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN--------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETK---------ILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGHV-ACDVCANNLYECHICRESIENK 2734
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V              G RN        L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V            A+ +     P +     +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  K TP+ +A + G + + + L        S+ +SE DT LH A+     + ++ LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A+++I+N N QTALH+AV +++   +++LV   A++DV D +GDTPLH A+R H++  +++   +  +S +     S N        +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++          L+     +      +  P  HI   S    + K   +   ++++Q     + C++C D+   V F  CGH+ AC+ CA+ + +C  CR  +E +
Sbjct:  214 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMYETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGCSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEN------------GNRNPGG-----LQIGDLVNIDLDLEIVQSLQHGHGGWTDGMYETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGCSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGAVLTESPSVP--AERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRKQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSANLDIQNANQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGAELTIRNKKGQSPLDLCPDPSLCKALTKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLI--CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERR 1053          

HSP 2 Score: 118.242 bits (295), Expect = 4.681e-23
Identity = 142/582 (24.40%), Postives = 240/582 (41.24%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVK---------IMGQKLN--LNPECVEATDSDCESEPD--IQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGT---------STLLEGVYPL--MIAVNGGHIDVVKLLIEKRANINAKEE-NGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIM-----LAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFA--ALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGI 2251
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV+          +G  +N  L+ E V++         D   +T+    T      DH      P  +R    FN   +   N VR    + G            L++  Y +  +  +  GH +  + ++     +   ++   D+ L + V    +      + K A   +   N    ++     + A   S  + +L  T  + D+      N+  +  A     A+  + L     D+         A    +Q G+  +L++ LK      V+ + +DK    A+H A F +    + VL +  AD+N RN   QT LHIAV++ +L  +K L++ G    + D+ GDTPLH A+        KKR  +L +
Sbjct:  186 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMYETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGCSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVENGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMYETLTTTGTVCGIDEDHDIVVQYPSGNRWT--FNPAVLTKANVVRSGEVAAGAEGGCSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGAVLTESPSVPAERLSQLLKKLFETQESGDI------NEELVKAAANGDLAKVEDILKRPDVDVNG-QCAGHTAMQAASQNGHVDVLKLLLKHN----VDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRKQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAIS-------KKRDDMLSV 729          

HSP 3 Score: 67.0106 bits (162), Expect = 2.188e-7
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2564 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct: 1165 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1225          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A1S3II44 (E3 ubiquitin-protein ligase MIB2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106164494 PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 6.060e-83
Identity = 223/705 (31.63%), Postives = 343/705 (48.65%), Query Frame = 2
Query:  779 KLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCE------SEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNL-NEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLD-AGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMD-FCDPSLKEKL-------------SVANARRMSKEIE------------------------TKILQAQGP--TTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            + R GD V++  D+  +K +Q+ HGGW   M    GK+  V  I   GDV+V                 EG Q   T   G      AL K  V+ FS  D V++  N H++++LQ GHGEW ++M+  LGK+GKV  V  +GDL+V +  Q    NP C        E      +  + +     LT ++ Q       D    DR         I N+ N V K  D V   +   G   L +A + GHI++VKLL+   AN+  ++E+GDTALH A   ++ +I + L++KGA++NA NN   + + +A +   +D  R+L      D++I +S  DTALH  +   + E ++ L +  G D    N + FN  H  A +GN+   E  L +   ++ + +KDD F+ALHLA  N H+    +LL + +ADI IRNN  QT L +AVSQ +   +++LV KGA+++V D +GDT LH+A+   ++ T      +L  + I      + + ++    +A YL ++ A    KN   KTP+D   DP ++E+L                N+    K  E                         K L+   P  + VAAGG    P     ++S+      + + +EL+ ++Q+MED   C IC DR  ++ F CGH AC +CA  L  CH+CR+ I  +I L+
Sbjct:  247 QFRVGDKVKVDLDLDILKAMQEGHGGWNPKMAEFIGKVGTVHRITERGDVRVQY---------------EGCQNRWTFHAG------ALTK--VQQFSVADIVKISENLHEVRKLQVGHGEWTDSMKAALGKIGKVLKVYADGDLRVAVNKQTWTFNPACCTVLPHGAEDLNNSMASHEREDRTTTLTALLEQLFELQLPDASGPDRLVREAAQGHIDNVKNIVTKFPDKVDQKS--AGKTALQVASHQGHIEIVKLLLSSGANLELQDEDGDTALHYASFGNQPEITEYLLSKGANINALNNGGCSTLHVAVNKQHVDCVRVL-LRHTCDVNIQDSYGDTALHDGIGKDNQEIIDLLCNYPGIDFTLRNKRGFNVLHHAALKGNKLATERILLK-ARQVADVKKDDGFSALHLAALNGHKEVAEILLTQGQADIEIRNNRKQTPLLLAVSQGHTALLELLVSKGADVNVQDEDGDTCLHLALMRQNVATELDNSPIL--AAIRSQLGMTEDDTNTGTAIACYLAQQGASLTNKNAQGKTPLDVITDPKVQEQLKQFAGVQTSTPANPAENSMPSCKVCEDDPADVKFMPCGHQISCSDCCAKMKKCLECGVPIQSKVAAGGTPIKPSSVKRQDSSNDF--SESKFQELQAKMQEMEDTVMCSICLDRKKDLVFLCGHSACHICAQPLRNCHMCRKPITKRINLF 920          

HSP 2 Score: 75.485 bits (184), Expect = 5.293e-10
Identity = 42/140 (30.00%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGME--WMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLT 979
            KV +  + +++K +Q+ HGGW   M  FIG+   + +I + GD+ V   G +  W  +   +        K ++    DIV+I +++ ++++LQ  HG W +SM+   GKI KV  +   GD++V V++    +NP   T
Sbjct:  253 KVKVDLDLDILKAMQEGHGGWNPKMAEFIGKVGTVHRITERGDVRVQYEGCQNRWTFHAGAL-------TKVQQFSVADIVKISENLHEVRKLQVGHGEWTDSMKAALGKIGKVLKVYADGDLRVAVNKQTWTFNPACCT 385          

HSP 3 Score: 62.003 bits (149), Expect = 6.509e-6
Identity = 34/125 (27.20%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECL--TGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRIN 493
            D++ +K  Q  HGGWN  M E +   G    +   G   +      N +  ++  L +    Q   +   V + EN  E ++LQV +GEW+D M   LGK  ++++ + DG++++    +T+  N
Sbjct:  259 DLDILKAMQEGHGGWNPKMAEFIGKVGTVHRITERGDVRVQYEGCQNRWTFHAGALTKV---QQFSVADIVKISENLHEVRKLQVGHGEWTDSMKAALGKIGKVLKVYADGDLRVAVNKQTWTFN 380          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A1S3IJ21 (E3 ubiquitin-protein ligase MIB2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106164494 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 2.632e-82
Identity = 226/711 (31.79%), Postives = 347/711 (48.80%), Query Frame = 2
Query:  779 KLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCE------SEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNL-NEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLD-AGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMD-FCDPSLKEKL-------------SVANARRMSKEIE------------------------TKILQAQGP--TTVAAGG--LMAHPGDHIDRNSAQHLKTKDE----ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            + R GD V++  D+  +K +Q+ HGGW   M    GK+  V  I   GDV+V                 EG Q   T   G      AL K  V+ FS  D V++  N H++++LQ GHGEW ++M+  LGK+GKV  V  +GDL+V +  Q    NP C        E      +  + +     LT ++ Q       D    DR         I N+ N V K  D V   +   G   L +A + GHI++VKLL+   AN+  ++E+GDTALH A   ++ +I + L++KGA++NA NN   + + +A +   +D  R+L      D++I +S  DTALH  +   + E ++ L +  G D    N + FN  H  A +GN+   E  L +   ++ + +KDD F+ALHLA  N H+    +LL + +ADI IRNN  QT L +AVSQ +   +++LV KGA+++V D +GDT LH+A+   ++ T      +L  + I      + + ++    +A YL ++ A    KN   KTP+D   DP ++E+L                N+    K  E                         K L+   P  + VAAGG  L A  G  I  +S +   + ++    + +EL+ ++Q+MED   C IC DR  ++ F CGH AC +CA  L  CH+CR+ I  +I L+
Sbjct:  247 QFRVGDKVKVDLDLDILKAMQEGHGGWNPKMAEFIGKVGTVHRITERGDVRVQY---------------EGCQNRWTFHAG------ALTK--VQQFSVADIVKISENLHEVRKLQVGHGEWTDSMKAALGKIGKVLKVYADGDLRVAVNKQTWTFNPACCTVLPHGAEDLNNSMASHEREDRTTTLTALLEQLFELQLPDASGPDRLVREAAQGHIDNVKNIVTKFPDKVDQKS--AGKTALQVASHQGHIEIVKLLLSSGANLELQDEDGDTALHYASFGNQPEITEYLLSKGANINALNNGGCSTLHVAVNKQHVDCVRVL-LRHTCDVNIQDSYGDTALHDGIGKDNQEIIDLLCNYPGIDFTLRNKRGFNVLHHAALKGNKLATERILLK-ARQVADVKKDDGFSALHLAALNGHKEVAEILLTQGQADIEIRNNRKQTPLLLAVSQGHTALLELLVSKGADVNVQDEDGDTCLHLALMRQNVATELDNSPIL--AAIRSQLGMTEDDTNTGTAIACYLAQQGASLTNKNAQGKTPLDVITDPKVQEQLKQFAGVQTSTPANPAENSMPSCKVCEDDPADVKFMPCGHQISCSDCCAKMKKCLECGVPIQSKVAAGGQELNALSGTPIKPSSVKRQDSSNDFSESKFQELQAKMQEMEDTVMCSICLDRKKDLVFLCGHSACHICAQPLRNCHMCRKPITKRINLF 928          

HSP 2 Score: 75.485 bits (184), Expect = 5.051e-10
Identity = 42/140 (30.00%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGME--WMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLT 979
            KV +  + +++K +Q+ HGGW   M  FIG+   + +I + GD+ V   G +  W  +   +        K ++    DIV+I +++ ++++LQ  HG W +SM+   GKI KV  +   GD++V V++    +NP   T
Sbjct:  253 KVKVDLDLDILKAMQEGHGGWNPKMAEFIGKVGTVHRITERGDVRVQYEGCQNRWTFHAGAL-------TKVQQFSVADIVKISENLHEVRKLQVGHGEWTDSMKAALGKIGKVLKVYADGDLRVAVNKQTWTFNPACCT 385          

HSP 3 Score: 62.3882 bits (150), Expect = 6.312e-6
Identity = 34/125 (27.20%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECL--TGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRIN 493
            D++ +K  Q  HGGWN  M E +   G    +   G   +      N +  ++  L +    Q   +   V + EN  E ++LQV +GEW+D M   LGK  ++++ + DG++++    +T+  N
Sbjct:  259 DLDILKAMQEGHGGWNPKMAEFIGKVGTVHRITERGDVRVQYEGCQNRWTFHAGALTKV---QQFSVADIVKISENLHEVRKLQVGHGEWTDSMKAALGKIGKVLKVYADGDLRVAVNKQTWTFN 380          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A0S7GYI9 (MIB1 (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=MIB1 PE=4 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 1.533e-80
Identity = 213/735 (28.98%), Postives = 360/735 (48.98%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN--------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            I  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + ++ LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A ++I+N N QTALH+AV +++   +++LV   A++DV D +GDTPLH A+R H++  +++   +  +S +     S N        +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S +++T+                           +  L +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 IWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKI------APSGSAVSNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKSSGQVDTR---------------------------SPSLNSNIESLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 861          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 281.952 bits (720), Expect = 3.065e-80
Identity = 214/741 (28.88%), Postives = 365/741 (49.26%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN--------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETK---------ILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGHV-ACDVCANNLYECHICRESIENK 2734
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V       +  P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + ++ LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A ++I+N N QTALH+AV +++   +++LV   A++DV D +GDTPLH A+R H++  +++   +  +S +     S N        +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++          L+     +      +  P  HI   S    + K   +   + ++Q     + C++C D+   V F  CGH+ AC+ CA+ + +C  CR  +E +
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVARSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVT------KVAPAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLI--CKDQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERR 905          

HSP 2 Score: 170.629 bits (431), Expect = 6.195e-43
Identity = 183/736 (24.86%), Postives = 309/736 (41.98%), Query Frame = 2
Query:  590 EVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GMEWMINPKCIGKRNENKFK---------SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND--TALHLAVKNFHAESVNALLDAGA---DIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            E++++LQ  HGGW + M   +     +  I +D D+ V    G  W  NP  + K N  +           S +   GD+VQIC DI +IK LQ+ HG W  +M    GK+ +VQ I    D+KV V      YNP  +TK     +  T A G+R     L +L  K+F   +   +  N+  +K    G    +  ++ +L    K   VDVNG               +C   T     S    Q     + +++ + +   E+++ D DR          G++ EV     +   +       PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  +  +L+  GADV   NNN    +  AA  G+    R+L +       +   ++D  TALHLA  N H E    L+  G+   DI+ VN +   A HL  +R + +I                                   +R+L++ +A +++++ +  T LH A+    L+ ++ L       D+ D +   P   +     M         LG  G  + +A+S         +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++                           +  L + +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC++ ++++ ++
Sbjct:  259 EIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGER-----LSQLLKKLFETQESGDI--NEELVKAAANGD---LAKVEDIL----KRPDVDVNG---------------QCAGHTAMQAAS----QNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVNQQ--TALHLAVERQHTQI-----------------------------------VRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQ------DMQDVSKVEPWEPSKNTLIMG--------LGTQGAEKKSAAS---------IACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSR---------------------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKDQVQSRTKI 861          

HSP 3 Score: 56.6102 bits (135), Expect = 1.292e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 4 Score: 51.9878 bits (123), Expect = 3.346e-6
Identity = 53/241 (21.99%), Postives = 99/241 (41.08%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K               + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  224 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 459          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 281.952 bits (720), Expect = 3.899e-80
Identity = 214/741 (28.88%), Postives = 364/741 (49.12%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN--------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETK---------ILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGHV-ACDVCANNLYECHICRESIENK 2734
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + ++ LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A ++I+N N QTALH+AV +++   +++LV   A++DV D +GDTPLH A+R H++  +++   +  +S +     S N        +G++K     +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++          L+     +      +  P  HI   S    + K   +   + ++Q     + C++C D+   V F  CGH+ AC+ CA+ + +C  CR  +E +
Sbjct:  193 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVARSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKV------APAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLI--CKDQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERR 902          

HSP 2 Score: 170.244 bits (430), Expect = 6.664e-43
Identity = 183/736 (24.86%), Postives = 309/736 (41.98%), Query Frame = 2
Query:  590 EVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GMEWMINPKCIGKRNENKFK---------SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND--TALHLAVKNFHAESVNALLDAGA---DIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            E++++LQ  HGGW + M   +     +  I +D D+ V    G  W  NP  + K N  +           S +   GD+VQIC DI +IK LQ+ HG W  +M    GK+ +VQ I    D+KV V      YNP  +TK     +  T A G+R     L +L  K+F   +   +  N+  +K    G    +  ++ +L    K   VDVNG               +C   T     S    Q     + +++ + +   E+++ D DR          G++ EV     +   +       PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  +  +L+  GADV   NNN    +  AA  G+    R+L +       +   ++D  TALHLA  N H E    L+  G+   DI+ VN +   A HL  +R + +I                                   +R+L++ +A +++++ +  T LH A+    L+ ++ L       D+ D +   P   +     M         LG  G  + +A+S         +A +L    A   I+NK  ++P+D C DPSL + L+  +  + S ++ ++                           +  L + +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC++ ++++ ++
Sbjct:  256 EIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGER-----LSQLLKKLFETQESGDI--NEELVKAAANGD---LAKVEDIL----KRPDVDVNG---------------QCAGHTAMQAAS----QNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVNQQ--TALHLAVERQHTQI-----------------------------------VRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQ------DMQDVSKVEPWEPSKNTLIMG--------LGTQGAEKKSAAS---------IACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSR---------------------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKDQVQSRTKI 858          

HSP 3 Score: 67.0106 bits (162), Expect = 8.672e-11
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2564 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  967 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1027          

HSP 4 Score: 56.6102 bits (135), Expect = 1.267e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  254 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 394          

HSP 5 Score: 51.9878 bits (123), Expect = 3.630e-6
Identity = 53/241 (21.99%), Postives = 99/241 (41.08%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K               + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  221 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 456          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 263.462 bits (672), Expect = 9.208e-74
Identity = 200/673 (29.72%), Postives = 331/673 (49.18%), Query Frame = 2
Query:  782 LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCES--------EPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAV-KNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV---RIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2740
             ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F+ G+ VR++++   +KRLQ GHGEW ++M   LG+VGKV  V  +GDL+V   GQ    NP C+     + ++             T+++ L +++ Q   S E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK+L++  ++I AK+E+GD ALH     ++ +I  LL++KGA+VN  NN+  T + +A + G  D+ R+L T  +AD+++ +S  DT LH A+ K+F +      +    D    NN+ FN  H  A +GN+   EM L R   ++ + +K+D F+ALHLA  NNH     +L+K  + D NIRNN  QT L +AV+Q ++  + +LV +GA+++  D  GDT +H A+   ++ +M +  +R        +  S    N   +    +A +L ++ A  +  N   K+P+D    S   +L     R  S++   + LQA    T ++   +     H   N+  +L             +        C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  313 FQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSGQPGEVDANLMTAENPSESGSTVISVLEKLLSQ---STEQDNPG----RLVIEAAH-GSATKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKVLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGNTELNVGAAIACFLAQEGADINYANHKGKSPLDLVTDSTTLQL----IRSFSEKHRLQQLQAITCGTSSSSSSLRRV--HTTPNTMTNLA------------MPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIR 930          

HSP 2 Score: 64.3142 bits (155), Expect = 5.652e-10
Identity = 34/130 (26.15%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V ++++ E  KRLQ  +GEW+D M + LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  324 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 448          

HSP 3 Score: 50.447 bits (119), Expect = 9.363e-6
Identity = 46/201 (22.89%), Postives = 88/201 (43.78%), Query Frame = 2
Query:  356 FKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCI----GKRNENKFKSEKLRK--GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV 940
             +++Q  +G W+  M   + +   + +    G+V+++Y            LT            TF  GE V ++ + E +K LQ  HG W + M   +G+  +++K+  DGD+ V+  G  W  NP C+    G+ + N   +E   +    ++ + + +      Q N G  V  +E   G   KV+ ++     KV++
Sbjct:  328 LRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALT---------KVNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSGQPGEVDANLMTAENPSESGSTVISVLEKLLSQSTEQDNPGRLV--IEAAHGSATKVRELVQKHPDKVDI 517          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 263.462 bits (672), Expect = 1.212e-73
Identity = 200/673 (29.72%), Postives = 331/673 (49.18%), Query Frame = 2
Query:  782 LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCES--------EPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAV-KNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV---RIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2740
             ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F+ G+ VR++++   +KRLQ GHGEW ++M   LG+VGKV  V  +GDL+V   GQ    NP C+     + ++             T+++ L +++ Q   S E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK+L++  ++I AK+E+GD ALH     ++ +I  LL++KGA+VN  NN+  T + +A + G  D+ R+L T  +AD+++ +S  DT LH A+ K+F +      +    D    NN+ FN  H  A +GN+   EM L R   ++ + +K+D F+ALHLA  NNH     +L+K  + D NIRNN  QT L +AV+Q ++  + +LV +GA+++  D  GDT +H A+   ++ +M +  +R        +  S    N   +    +A +L ++ A  +  N   K+P+D    S   +L     R  S++   + LQA    T ++   +     H   N+  +L             +        C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  319 FQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSGQPGEVDANLMTAENPSESGSTVISVLEKLLSQ---STEQDNPG----RLVIEAAH-GSATKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKVLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGNTELNVGAAIACFLAQEGADINYANHKGKSPLDLVTDSTTLQL----IRSFSEKHRLQQLQAITCGTSSSSSSLRRV--HTTPNTMTNLA------------MPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIR 936          

HSP 2 Score: 64.3142 bits (155), Expect = 6.011e-10
Identity = 34/130 (26.15%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V ++++ E  KRLQ  +GEW+D M + LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  330 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 454          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 261.536 bits (667), Expect = 2.640e-73
Identity = 197/676 (29.14%), Postives = 326/676 (48.22%), Query Frame = 2
Query:  782 LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCES--------EPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAV-KNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV---RIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKL--SVANARRMSKEIETKILQAQ-GPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2740
             ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F+ G+ VR++++   +KRLQ GHGEW ++M   LG+VGKV  V  +GDL+V   GQ    NP C+     + ++             T+++ L +++ Q   S E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK+L++  ++I AK+E+GD ALH     ++ +I  LL++KGA+VN  NN+  T + +A + G  D+ R+L T  +AD+++ +S  DT LH A+ K+F +      +    D    NN+ FN  H  A +GN+   EM L R   ++ + +K+D F+ALHLA  NNH     +L+K  + D NIRNN  QT L +AV+Q ++  + +LV +GA+++  D  GDT +H A+   ++ +M +  +R        +  S    N   +    +A +L ++ A  +  N   K+P+D    S   +L  S +   R      + + +    P T+    + + PG                                 C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  258 FQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSGQPGEVDANLMTAENPSESGSTVISVLEKLLSQ---STEQDNPG----RLVIEAAH-GSATKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKVLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGNTELNVGAAIACFLAQEGADINYANHKGKSPLDLVTDSTTLQLIRSFSEKHRYVVSSSSSLRRVHTTPNTMTNLAMPSAPG------------------------------PSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIR 866          

HSP 2 Score: 63.929 bits (154), Expect = 7.127e-10
Identity = 34/130 (26.15%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V ++++ E  KRLQ  +GEW+D M + LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  269 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 393          

HSP 3 Score: 63.1586 bits (152), Expect = 1.091e-9
Identity = 30/72 (41.67%), Postives = 42/72 (58.33%), Query Frame = 2
Query: 2531 NSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            NS QH       LE+L+ R + ME+  TC IC D  I + F CGH +C  C+  L  C ICR++I  +I+L+
Sbjct:  880 NSEQH-----NLLEQLQSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 946          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008505.1 (pep scaffold:Pmarinus_7.0:GL477211:28706:49738:-1 gene:ENSPMAG00000007672.1 transcript:ENSPMAT00000008505.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.333 bits (451), Expect = 1.269e-46
Identity = 161/589 (27.33%), Postives = 273/589 (46.35%), Query Frame = 2
Query:  740 CIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDV-KVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDC-----ESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVG--TSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGA-DIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIA--------------------VRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDF-CDPSLKEKLS 2413
            C+G  + N+  +     GD V+   D Q +  LQQ+HGG+  +M   + +  KV  ++ +GDV  V  +  + +YNP  L K +  Q     +  Q R+S  +  +   +FSP   + LIN+             W+  ++  LG+VG+V  V  +GDL+V + G   N NP CV   D         SE     ++ +   ++  +D +           K   +    GN+  V+KLV       +   EG   L +A + GHIDV + L++  A+    ++ G+TALH A   ++  +  LL++  A VN++N+   T + LAA  G  ++ R L      D++  +S  ++ +H A+   + E + AL      D+   N   F    L A +G++  ++  L +   K+V+ QK D FA LHLA +N     + +L+K  ++ +N R    QTAL +A  + +++ + +LV +  ++DV D  G+T LH+                     V+IH    V +  +L   SG+F    S   G    E LA +L+K+ A     N   K P D+   P L++ L+
Sbjct:  226 CLGD-SSNRTSTMGFCLGDTVRCGVDGQTLMVLQQDHGGFSVAMALIAARPGKVAGLIDNGDVLVVYSNGGKYIYNPKCLIKVKMAQC---ISHLQLRQSFWI--VIALIFSP-SCIALINDDSI---------NWMKMVKPTLGRVGRVVKVLPSGDLRVALGGHIWNFNPACVSTADPKSLDLAETSEDSAADILKERVILVWDTDLNK----------KQLISEAAQGNVGNVQKLVQLFPGQINAQQEGRTALHVAAHQGHIDVARALLKAGASTEIGDDKGNTALHYAAHGNEAAMAGLLVSHRARVNSRNHAGRTALHLAARKGYGEVARTLC-EHACDVNTQDSTKNSPIHDAIAENYEEVIEALTSVKTLDLERQNESGFTPLQLAAFKGSKLAVQRILAKS-PKLVDEQKSDGFAPLHLAAYNGRLDVVHILIKQGRSAVNARTCGGQTALMLAAGRGHVDVVFLLVREACKLDVEDEGGNTALHLVLKEADLFSTDCHLLQDDSTIVQIHYATRVLRINRLRD-SGLF-GAGSIYAG----EALACFLVKEGANLRQTNARGKAPFDYILKPELRKTLT 780          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 1.501e-28
Identity = 75/260 (28.85%), Postives = 132/260 (50.77%), Query Frame = 2
Query: 1418 LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIA 2197
            L + R  VD +     L+ +  L +A + GH    K+L++K AN N +  NG T LHIA +K++ ++ +LL+  GA + A   + +TP+ ++A  G+++I  +L     A  +  N   +TALH+A +    E V +LL  GA + A   +     H+ A+ G   I+++ L+       ++   + +  LH+A    HE    +LL++ A + +      T LH+A     +    +L+++ A  D    NG TPLH+A
Sbjct:   58 LMQYRAPVDDI----TLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQG-GASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASP--DAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVA 310          

HSP 2 Score: 114.005 bits (284), Expect = 7.329e-26
Identity = 91/309 (29.45%), Postives = 143/309 (46.28%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK---KRGKLLGIS---GIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPM 2377
            +G+ PL  A   GH  VV++L+E+ A I AK +NG + LH+A Q D  +   +L+   A V+    + +T + +AA  G     ++L   + A+ ++      T LH+A K      +  LL  GA I AV        H+ A  GN  I+ + L  +G    N+       ALH+A        +R LL+  A ++ +    QT LHIA     L  +++L++  A  D   +NG TPLH+A R    D      + G  L ++   G      +S  G     ++A  LL++ A  D   KN  TP+
Sbjct:    5 DGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVL-LDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILL--QGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGK---MEVASLLLQRFASPDAAGKNGLTPL 307          

HSP 3 Score: 106.301 bits (264), Expect = 1.602e-23
Identity = 74/270 (27.41%), Postives = 124/270 (45.93%), Query Frame = 2
Query: 1400 ALKIGNLNEVRKLVDSVGT--STLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR 2203
            A ++G L  V+ L+  + +  +    G  PL +A   GH DV  +L+E  A++    + G T LH+A +  K ++  LL+ + A  +A   N +TP+ +A+   +  +  LL   + A          T LH+A K    E    LL+ GA+  A+  +     HL AQ G+  +  + L R     VN       + LHLA   +      +L+K+ A +N       T L +A     +  +  L++ GA+++    NG TPLH A +
Sbjct:  211 AARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVA-LLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLAR--YADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQ 477          

HSP 4 Score: 104.76 bits (260), Expect = 5.379e-23
Identity = 75/256 (29.30%), Postives = 125/256 (48.83%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR---IHSMDTVK 2227
            +G  PL +A   G ++V  LL+++ A+ +A  +NG T LH+A   D  K+  LL+++GA  +A   N  TP+ +AA    ++I   L     A+ +    +    LHL  +  HA+  + LL   AD+        +  HL AQ     + E+ +K      VN+     +  L +A    +   +  LL++ AD+N +  N  T LH A  Q + + + +L++ GA  +    NG+T L IA R   I  +DT+K
Sbjct:  269 KGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTL-LEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGA--HVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLK 521          

HSP 5 Score: 74.7146 bits (182), Expect = 7.881e-14
Identity = 58/213 (27.23%), Postives = 109/213 (51.17%), Query Frame = 2
Query: 1871 NFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV---RIHSMDTVKKRG---KLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAA 2491
                 H  A+ G+E+++E+ L+ +G  I+   K+   + LH+A   +H  C++VL++Y+A ++    +  TALH+A    +    K+L++KGA  +V   NG TPLHIA    RI  M+ + K G   + +  SG+     S+  G+    ++ + LL+  A  +  N   +T +     + + ++ V +  R   +++ K  + Q P  +AA
Sbjct:    6 GLTPLHCAARSGHEQVVEILLE-QGAPILAKTKNG-LSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGN---LNIVLILLQGGASPNATNVRGETALHMAARAGQTEV-VRSLLRNGAQVDAKAREEQTPLHIAA 212          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 2.209e-28
Identity = 87/297 (29.29%), Postives = 140/297 (47.14%), Query Frame = 2
Query: 1352 DESDEPDNDRTKTFFNALKIG---NLNEVRKLVDSVGTS---TLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTV 2224
            D   EP N R    F  L I    N  +V +L+   G S   T   G+ P+ +A   GH++VV+LL++  A+ NA    G+T LH+A +  + ++   L+  GA V  +     TP+ +A+  G  +I +LL   R +D +   +   T L+ A +  H +  + LL+ GADI  V  K F   H+ ++ G   +  + L++           +    LH+A   +H+    +LL   A  +    N  T LHIA  +  L   K+L+E GAE ++    G  PLH+A +    D V
Sbjct:  358 DRGGEP-NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL-LQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMV 652          

HSP 2 Score: 120.939 bits (302), Expect = 2.766e-28
Identity = 81/306 (26.47%), Postives = 143/306 (46.73%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCD 2389
            G  PL IA + G+++V  LL+   A ++    NG T LH+A ++    +  LL+++GA ++ +  + +TP+  AA +G   +  +L   R+A +        + LH+A +  H   V  LL   A +  V        H+ A  G+ R+ ++ L R G    N++  + F  LH+A   N    + +LLK+ A I+    +  T +H+A    +LN +++L++ GA  + T+  G+TPLH+A R   ++ VK                               LL+  AR  +K + D+TP+    
Sbjct:  205 GFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEML-LERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEP--NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKT------------------------------LLQSGARVGVKAREDQTPLHIAS 477          

HSP 3 Score: 114.39 bits (285), Expect = 3.134e-26
Identity = 79/251 (31.47%), Postives = 125/251 (49.80%), Query Frame = 2
Query: 1466 LEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLL---ATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEID--VTDANGDTPLHIAVR 2203
            L+ + PL +A + GH  V KLL+++    NA+  NG T LHIA +K++ K+ +LL+  GA ++    + +TPI +A+  G +++ +LL     S NA     N   +T LH+A +    E V  LL +GA +     ++    H+ ++ G   I+++ L+R      N+        L+ A    H     +LL+  ADI+       T LHIA     L    +L+EK A  D  V   NG TPLH+A  
Sbjct:  335 LDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNAT----NVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP--NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATH 579          

HSP 4 Score: 111.309 bits (277), Expect = 3.423e-25
Identity = 84/284 (29.58%), Postives = 140/284 (49.30%), Query Frame = 2
Query: 1373 NDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLE-----GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALL--DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR 2203
            +D   +F  A + GNL    +L+D +     +      G+  L +A   GH+DVV  L+++ A I+   + G+TALHIA    +  I  +L+  GA++NAQ+ N  TP+ +AA    ++I + L     A+ S+   +  T L +A++  H + V  LL  D    +R        A H+ A++ +     + L+ E    V S+    F  LH+A    +     +LL   A ++    N  T LH+A  +   N +K+L+++GA+ID    +G TPLH A R
Sbjct:    9 SDAATSFLRAARNGNL---ERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFL-LDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVR------LPALHIAARKDDTNAAALLLQHEHNADVTSKSG--FTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAAR 280          

HSP 5 Score: 102.834 bits (255), Expect = 1.318e-22
Identity = 86/333 (25.83%), Postives = 156/333 (46.85%), Query Frame = 2
Query: 1409 IGNLNEVRKLVDSVGTS--TLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLD--AGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV---RIHSMDTVKKRGKLLGISGIFQST---ASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPM 2377
            +G+LN V+ L+ +  +S  T + G  PL +A   G ++VVK L++  A +  K     T LHIA +  K +I  LL+ +G+D NA   +  TP+  A+  G  D+  LL     AD+S    +  T LH+A K    E    LL+  A AD +          H+     ++++  + L +      +S   + +  LH+A   N     +VLL+  A+ N+        LH+A  + + + + +L+ + A I +    G T +H+A    +++  + + K    +  +     T    +S+ G+ K   +  +LL+ +A  + K +N  TP+
Sbjct:  413 MGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLL-LENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASP--HSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIK---MVNFLLRNRALVNAKTRNGYTPL 739          

HSP 6 Score: 92.0485 bits (227), Expect = 3.272e-19
Identity = 90/373 (24.13%), Postives = 157/373 (42.09%), Query Frame = 2
Query: 1547 NINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGH 2665
            +IN   +NG  ALH+A ++    +   L+ + A+++       T + +AA AG  DI R+L     A+++  +    T L++A +  H E V  LLD GA+        F    +  Q+G+E+++ + L+ +      ++   +  ALH+A   +      +LL+++ + ++ + +  T LHIA     +N   +L+  GA +D T  NG TPLH+A          KRG                       ++   LL + A+ D K ++  TP+     S  EK+       M  E +  IL           GL           S  H+ T+ E L  ++  +          + Y  P++V   CGH
Sbjct:   36 DINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVL-VEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESD------TKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAA---------KRGN---------------------NNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVI-----EMLLERDAPILAK------TKNGL-----------SPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGH 349          

HSP 7 Score: 75.0998 bits (183), Expect = 5.676e-14
Identity = 50/141 (35.46%), Postives = 76/141 (53.90%), Query Frame = 2
Query: 1424 EVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND-TALHLAVKNFHAESVNALL 1834
            EV K++  +G  T +   +GV PL +A   GH D+V LL+ + A+I+   + G TA+H+A Q+DK  + ++L    ADVN       TP+ +A+  G++ +   L   RN  L    + N  T LH A +  H   VNALL
Sbjct:  617 EVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLL--RNRALVNAKTRNGYTPLHQAAQQGHTHVVNALL 755          

HSP 8 Score: 53.9138 bits (128), Expect = 1.759e-7
Identity = 39/117 (33.33%), Postives = 63/117 (53.85%), Query Frame = 2
Query: 1880 AFHLVAQRGN-ERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            +F   A+ GN ER+++     +G   +N+   +   ALHLA    H   +  LLK +A+I+       TALHIA      + +++LVE GA I+    NG TPL++A + + ++ VK
Sbjct:   14 SFLRAARNGNLERLMDHL---KGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVK 127          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.939 bits (302), Expect = 3.422e-28
Identity = 81/305 (26.56%), Postives = 143/305 (46.89%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            G  PL IA + G+++V  LL+   A ++    NG T LH+A ++    +  LL+++GA ++ +  + +TP+  AA +G   +  +L   R+A +        + LH+A +  H   V  LL   A +  V        H+ A  G+ R+ ++ L R G    N++  + F  LH+A   N    + +LLK+ A I+    +  T +H+A    +LN +++L++ GA  + T+  G+TPLH+A R   ++ VK                               LL+  AR  +K + D+TP+   
Sbjct:  212 GFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEML-LERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEP--NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKT------------------------------LLQSGARVGVKAREDQTPLHIA 483          

HSP 2 Score: 120.553 bits (301), Expect = 4.629e-28
Identity = 87/297 (29.29%), Postives = 142/297 (47.81%), Query Frame = 2
Query: 1352 DESDEPDNDRTKTFFNALKIG---NLNEVRKLVDSVGTS---TLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTV 2224
            D   EP N R    F  L I    N  +V +L+   G S   T   G+ P+ +A   GH++VV+LL++  A+ NA    G+T LH+A +  + ++   L+  GA V  +     TP+ +A+  G  +I +LL   R +D +   +   T L+ A +  H +  + LL+ GADI  V  K F   H+ ++ G   +  + L++      + +  +    LH+A   +H+    +LL   A  +    N  T LHIA  +  L   K+L+E GAE ++    G  PLH+A +    D V
Sbjct:  365 DRGGEP-NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL-LQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYAS--ADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMV 657          

HSP 3 Score: 116.701 bits (291), Expect = 7.253e-27
Identity = 78/249 (31.33%), Postives = 124/249 (49.80%), Query Frame = 2
Query: 1466 LEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLL---ATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR 2203
            L+ + PL +A + GH  V KLL+++    NA+  NG T LHIA +K++ K+ +LL+  GA ++    + +TPI +A+  G +++ +LL     S NA     N   +T LH+A +    E V  LL +GA +     ++    H+ ++ G   I+++ L+R      N+        L+ A    H     +LL+  ADI+       T LHIA     L    +L+EK A  D    NG TPLH+A  
Sbjct:  342 LDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNAT----NVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP--NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATH 584          

HSP 4 Score: 111.694 bits (278), Expect = 2.522e-25
Identity = 83/290 (28.62%), Postives = 141/290 (48.62%), Query Frame = 2
Query: 1373 NDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLE-----GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALL--DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKRE------GVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVR 2203
            +D   +F  A + GNL    +L+D +     +      G+  L +A   GH+DVV  L+++ A I+   + G+TALHIA    +  I  +L+  GA++NAQ+ N  TP+ +AA    ++I + L     A+ S+   +  T L +A++  H + V  LL  D    +R        A H+ A++ +     + L+ E         ++N   +  F  LH+A    +     +LL   A ++    N  T LH+A  +   N +K+L+++GA+ID    +G TPLH A R
Sbjct:    8 SDAATSFLRAARNGNL---ERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFL-LDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVR------LPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAAR 287          

HSP 5 Score: 108.997 bits (271), Expect = 1.510e-24
Identity = 77/252 (30.56%), Postives = 124/252 (49.21%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTV 2224
            +G  PL IA   G ++V  LL+EK A+ + K +NG T LH+A   D  K+  LL++KGA  ++   N  TP+ +AA    +++ ++L     A+ ++   +    LHLA +  HA+ V  LL   A I         A HL AQ     + E+  K +    VN+     +  LH+A    +   +  LL+ +A +N +  N  T LH A  Q + + +  L++  A  +   ANG+T L IA R+  +  V
Sbjct:  541 KGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVL-LELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKA--DVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVV 789          

HSP 6 Score: 74.7146 bits (182), Expect = 6.200e-14
Identity = 50/141 (35.46%), Postives = 76/141 (53.90%), Query Frame = 2
Query: 1424 EVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND-TALHLAVKNFHAESVNALL 1834
            EV K++  +G  T +   +GV PL +A   GH D+V LL+ + A+I+   + G TA+H+A Q+DK  + ++L    ADVN       TP+ +A+  G++ +   L   RN  L    + N  T LH A +  H   VNALL
Sbjct:  622 EVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLL--RNRALVNAKTRNGYTPLHQAAQQGHTHVVNALL 760          

HSP 7 Score: 73.1738 bits (178), Expect = 1.929e-13
Identity = 90/360 (25.00%), Postives = 148/360 (41.11%), Query Frame = 2
Query: 1640 GADVNAQNNNKITPIMLAASAGSMDI-TRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTD--------ANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTA---------SSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGH 2665
            G D+N  N N +  + LA+  G +D+ T LL   R A++       +TALH+A      + V  L++ GA+I A +   F   ++ AQ  +  I++  L     + V ++  D F  L +A+   HE  + +LL+      +R      ALHIA  +   N   +L++     DVT          +G TPLHIA    +M+       LL +      TA         ++  G++   ++   LL + A+ D K ++  TP+     S  EK+       M  E +  IL           GL           S  H+ T+ E L  ++  +          + Y  P++V   CGH
Sbjct:   33 GMDINTCNQNGLNALHLASKEGHVDVVTELL--KREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATE--DGFTPLAVALQQGHEQVVGLLLESDTKGKVR----LPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVAT---LLLNLGAAVDFTARNGITPLHVAAKRGNN---NMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVI-----EMLLERDAPILAK------TKNGL-----------SPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGH 356          

HSP 8 Score: 54.299 bits (129), Expect = 1.404e-7
Identity = 39/117 (33.33%), Postives = 63/117 (53.85%), Query Frame = 2
Query: 1880 AFHLVAQRGN-ERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            +F   A+ GN ER+++     +G   +N+   +   ALHLA    H   +  LLK +A+I+       TALHIA      + +++LVE GA I+    NG TPL++A + + ++ VK
Sbjct:   13 SFLRAARNGNLERLMDHL---KGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVK 126          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Match: ankdd1a (ankyrin repeat and death domain containing 1A [Source:ZFIN;Acc:ZDB-GENE-070615-8])

HSP 1 Score: 115.546 bits (288), Expect = 3.163e-27
Identity = 78/250 (31.20%), Postives = 128/250 (51.20%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGAD--VNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGA--DIRAVNNKNFN---AFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAV 2200
            G+ PL+IA   GH++V+K L+     ++++ +NG   LH A Q+   +     +    D  +  + N + TP +LAA  G + +  LL   + A   + + E +TA+HLA K+ H  S+  LL+ G    +  VN++N N   A HL A+ G+   + M L  E +  +N+  ++   ALH+A  + HE   ++L+    DIN  +    + LH+AV   Y   +  LVE  A I++ D    T LHIA 
Sbjct:   68 GMNPLLIAAWFGHLEVLKRLVNGGGRVSSQNKNGLNILHCAAQRGHVETVKYTLESLEDLGIEGKTNAEKTPYLLAAEYGQLAVLELLMDYKCAQ-DVSDGEKNTAIHLAAKSGHMLSLEHLLEKGPGRTLDFVNSQNANGNTALHLAAEGGHLECVRMLLDCEAICDINALNNESMNALHMAAKHGHEQIAKLLIDETIDINAISTKQASPLHLAVQNNYPIIVTFLVEAEANINLVDCRNQTALHIAA 316          

HSP 2 Score: 69.707 bits (169), Expect = 1.465e-12
Identity = 54/207 (26.09%), Postives = 100/207 (48.31%), Query Frame = 2
Query: 1343 DHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTL-------LEGVYPLMIAVNGGHIDVVKLLIEKRA--NINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLK 1936
            D+    D  D ++      A K G++  +  L++     TL         G   L +A  GGH++ V++L++  A  +INA       ALH+A +    +I  LLI++  D+NA +  + +P+ LA       I   L  +  A++++ +  N TALH+A +    ES + LL AG D+  ++ +  +   + A+     +++M +K
Sbjct:  157 DYKCAQDVSDGEKNTAIHLAAKSGHMLSLEHLLEKGPGRTLDFVNSQNANGNTALHLAAEGGHLECVRMLLDCEAICDINALNNESMNALHMAAKHGHEQIAKLLIDETIDINAISTKQASPLHLAVQNNYPIIVTFLVEAE-ANINLVDCRNQTALHIAAETGFQESADLLLAAGTDLTLLDKQKKSCLEVAARANQVNLVDMIIK 362          

HSP 3 Score: 63.5438 bits (153), Expect = 1.264e-10
Identity = 60/223 (26.91%), Postives = 101/223 (45.29%), Query Frame = 2
Query: 1637 KGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKR-EGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAE-----IDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNE 2287
            K   V+A+N    T +  AA +G  D  +LL   R A++  G+      L +A    H E +  L++ G  + + N    N  H  AQRG+   ++  L+  E + I      +K   L LA        L +L+ YK   ++ +    TA+H+A    ++  ++ L+EKG       ++  +ANG+T LH+A     ++ V+    LL    I    A +NE
Sbjct:   24 KKVKVDAKNMRDQTALHFAAGSGQEDAVKLL-LERKANVDKGDKYGMNPLLIAAWFGHLEVLKRLVNGGGRVSSQNKNGLNILHCAAQRGHVETVKYTLESLEDLGIEGKTNAEKTPYL-LAAEYGQLAVLELLMDYKCAQDVSDGEKNTAIHLAAKSGHMLSLEHLLEKGPGRTLDFVNSQNANGNTALHLAAEGGHLECVR---MLLDCEAICDINALNNE 241          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 64.6994 bits (156), Expect = 3.073e-11
Identity = 49/178 (27.53%), Postives = 82/178 (46.07%), Query Frame = 2
Query: 1988 LHLAVFNNHEGCLRVLLK-YKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYL----LKKKARTDIKNKND-----KTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAA 2491
            +HLA+   HE  L +LL+ +   IN R  N +  +HIA    Y  C+ +L+  GA++ V D NGDTPLH+ +   S+  +K    LL    +       ++G+ KP D+A       +  K   ++K K       K P  F  P       + NA+   ++  + +L    P ++ +
Sbjct:   79 VHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMK---MLLNEGEVSLDDNVRDKGNWKPIDVAQTFEVGNIYSKVLKEVKKKGPPLGAGKKPSSFRTP-------ILNAKATFEDGPSPVLSMNSPYSLYS 246          

HSP 2 Score: 60.8474 bits (146), Expect = 5.326e-10
Identity = 55/194 (28.35%), Postives = 98/194 (50.52%), Query Frame = 2
Query: 1715 ITRLLATSRNADLSIG-NSEND-TALHLAVKNFHAESVNA--LLDAGADIRAV--NNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGA---EIDVTDANGDTPLHIAV-----RIHS--MDTVKKRGKLLG 2248
            + RLL   RN DL    +SEN  ++LH A  ++H   +    L+  G D   +    K     HL   +G+E+ L + L+ +  + +N + ++  A +H+A  N++  CL +L+   AD+ + + N  T LH+ +    ++CMK+L+ +G    + +V D     P+ +A       I+S  +  VKK+G  LG
Sbjct:   21 VKRLL--RRNPDLLTNIDSENGWSSLHYA--SYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQ-QFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQTFEVGNIYSKVLKEVKKKGPPLG 209          

HSP 3 Score: 47.7506 bits (112), Expect = 5.983e-6
Identity = 26/81 (32.10%), Postives = 43/81 (53.09%), Query Frame = 2
Query: 1490 IAVNGGHIDVVKLLIEKRAN-INAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLL 1729
            +A+  GH   + LL+++    IN + ENG   +HIA   D ++   LLI  GAD+   + N  TP+ +    GS+   ++L
Sbjct:   81 LALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKML 161          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 61.2326 bits (147), Expect = 8.319e-11
Identity = 46/157 (29.30%), Postives = 79/157 (50.32%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEK--RANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLD-AGADIRAVNNKNFNAFHLVAQRGNERILEMFL 1933
            G  P  IA + G+++VVK L ++  + ++N     G T LH+AV K  F++   LI  GA V  ++     P+  AAS GS+ +  LL     + ++  + +  T L  A+   H ++   L++  GA+   V+NK   A  +     NE++ + FL
Sbjct:   72 GWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVAL---NEQVKKFFL 225          

HSP 2 Score: 57.3806 bits (137), Expect = 1.557e-9
Identity = 49/163 (30.06%), Postives = 70/163 (42.94%), Query Frame = 2
Query: 1361 DEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL----EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKG-ADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSI----GNSENDTALHLAVKNFHAESV 1822
            D PD+     F  A  +GNL  V+ L D      L     +GV  L +AV     +V + LIE  A++  K++     LH A      K+ +LL   G + VN Q+    TP+  A + G  D   LL     A+  +    G    D AL+  VK F   +V
Sbjct:   66 DYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV 228          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 56.225 bits (134), Expect = 1.970e-8
Identity = 40/109 (36.70%), Postives = 63/109 (57.80%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRA-NINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKI--TPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALH 1789
            G   L IA + G  DVVK +IE+   +IN ++  G+TALH A  +   +I +LLI  GADVN ++      TP++ A++ G +D+ + L  +  AD +I N++  TA  
Sbjct:  330 GRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKN-GADPTIRNAKGLTAFE 437          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 53.1434 bits (126), Expect = 1.804e-7
Identity = 55/231 (23.81%), Postives = 91/231 (39.39%), Query Frame = 2
Query: 1577 TALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLK---REGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGI 2260
            T LH A   ++  + D L+++GADVNA+             AG++                    + T LH A +  +   V+ LL  GAD    +++ FN  HL     N  ++   L     +G+  ++ +      +L  A +      +  LLK+ A I I +    T LH    +   + +K L++ GA+       G     IA     M+TV    + L  SG 
Sbjct:  111 TGLHWASINNRLSVVDFLVSQGADVNAR-------------AGAL--------------------HATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIA---QEMNTVYSLREALTHSGF 305          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 53.1434 bits (126), Expect = 1.853e-7
Identity = 44/176 (25.00%), Postives = 79/176 (44.89%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLI------NKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKF 1981
            G   L  A   G+I +V LL++  A+   K+E G   +H +V      +   ++      N   D+++++NN  TP++ AA  G      LL     + ++  ++    ALH A+       +  L+ +GA+    NN+  + F L    G + + E  L+  G   + +QKD  F
Sbjct:  118 GATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLL-KFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDLAEGMGTKSLFEQALQHHGYDRLGNQKDKLF 292          

HSP 2 Score: 52.7582 bits (125), Expect = 2.584e-7
Identity = 53/207 (25.60%), Postives = 89/207 (43.00%), Query Frame = 2
Query: 1391 FFNALKIGNLNEVRKLVDSVGTST---LLEGVYPLMIAVNGGHIDVVKLLIEKRANIN-AKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSR-----NADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERIL-EMFLKREGVKIVNSQKDDKF 1981
            F  A K G+L  V+ +V+S         ++ +  L  A       V K L+ + AN N A    G TALH A +     I DLL+  GAD   ++   +  +  +  + ++ +   +         N D+   ++ N T L  A       +V  LL  G+ +   +N+ FNA H     G++R++ ++ L        N+QK D F
Sbjct:   54 FIEAAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCF 260          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 84.7297 bits (208), Expect = 7.632e-18
Identity = 73/267 (27.34%), Postives = 120/267 (44.94%), Query Frame = 2
Query: 1484 LMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQT-ALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK----------KRGKLLGI 2251
             + AV+ G +D VK L+ K A+IN +  +G TALH A   + F +  +L++KGA ++ ++N   T +  AAS GS++I +                                   L++ GAD+ AVNN+      L  +   E +L   ++ +G+ +     DD  A     + N+ +  L      K  IN   +  +  ALH+A S+ YL  + +L++ G EI+  DA+  TPLH A      D  +           R K++GI
Sbjct:   53 FLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKY----------------------------------LIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDV-----DDARAVEEKIMLNDAQSWLN-----KNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNKMVGI 275          

HSP 2 Score: 61.6178 bits (148), Expect = 3.804e-10
Identity = 58/230 (25.22%), Postives = 107/230 (46.52%), Query Frame = 2
Query: 1388 TFFNALKIGNLNEVRKLVDSVGTSTL--LEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNS-ENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRN 2068
             F +A+  G+++EV+KL+          ++G+  L  A    + D+VK+L++K A+++ ++  G T+LH A      +I   LI  GADV A NN    P+ LA      D+      ++  D+    + E    L+ A    +   +N          + +    +A H+ + +G  +++ + L+  GV+I N++  D +  LH A     +    +L +  AD N RN
Sbjct:   52 VFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCIN---------ESKDKTEASALHVASSKGYLKVIGLLLQL-GVEI-NAKDADNWTPLHAAAHWGQKDACELLSENGADFNARN 270          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 87.0409 bits (214), Expect = 8.120e-18
Identity = 69/246 (28.05%), Postives = 112/246 (45.53%), Query Frame = 2
Query: 1517 VVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGN---------SENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            ++  +I  RA I  ++++ DT L IA +K+       L+  GAD+ A++ N    +  AA+ G M+        +    +I +           N   L L +      S   LLD GA I + N+++    H  A+ G  R +   LKR+   I+N +       LHLA  + H   ++ LL     I+ RN  L T L  A ++  +    IL+++ A +D TD    TPLH+A R   ++ VK
Sbjct:  162 IICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRI------SSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPA-IINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVK 400          

HSP 2 Score: 75.0998 bits (183), Expect = 5.540e-14
Identity = 59/228 (25.88%), Postives = 106/228 (46.49%), Query Frame = 2
Query: 1577 TALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNS-----------ENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            T LH+A       +   L+  GAD+ + +  ++TP+  A   G++ + +LL  +  A+L  G S           E  TALHLAV+  H +     L+ GA++ AV       FH       E I  M +K   +K ++  K +K     L  F +    +  +++++A I  R+ +  T L IA  + +++ ++ L++ GA+I   D N    +  A     M+T++
Sbjct:    6 TPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVA--AELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVM-IKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLE 230          

HSP 3 Score: 58.9214 bits (141), Expect = 6.692e-9
Identity = 35/119 (29.41%), Postives = 67/119 (56.30%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLD 1837
            PL +A   GH  VVK L+ +   I+A+     T L  A  +   ++ ++L+++ A V+  +  K TP+ LA+  G +++ +LL  SR A++++ +S     L +A+++ H E   A++D
Sbjct:  320 PLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLL-LSRKANITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 4 Score: 51.2174 bits (121), Expect = 1.422e-6
Identity = 37/151 (24.50%), Postives = 71/151 (47.02%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEK-RANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERI 1918
            E + P+  A   G +  V  L+++  A IN ++   +T LH+A       +   L+ +G  ++A+N    TP+  AA+ G +++  +L    +A +   +    T LHLA +  H E V  LL   A+I   ++   N   +  +  ++ +
Sbjct:  282 EDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANIL-LDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEV 431          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 75.8702 bits (185), Expect = 9.084e-16
Identity = 47/159 (29.56%), Postives = 79/159 (49.69%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKF---KICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLK 1936
            +G  PL  A    H+D+V++L++  A+++ +       +   +   KF   + C +L+  GADVN  N    T +  A   G   +  LL      D+++ + +N T+LH+A        +  LL  GA+I A +N  F AFHL A+ G E +L+  L+
Sbjct:   28 DGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 2 Score: 66.6254 bits (161), Expect = 1.743e-12
Identity = 55/213 (25.82%), Postives = 91/213 (42.72%), Query Frame = 2
Query: 1517 VVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNN---NKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKG 2146
            V KLL     N+N  + +G + LH A   +   I  +L++ GADV+ + +    +I PI+ AA   ++                                  ES   LL AGAD+   N     A H   +RG+ +++E+ L R+G   VN    D   +LH+A        ++ LL   A+I  ++N+  TA H+A  +     ++ L+  G
Sbjct:   11 VRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAI----------------------------------ESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLL-RDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 3 Score: 54.6842 bits (130), Expect = 1.975e-8
Identity = 53/180 (29.44%), Postives = 79/180 (43.89%), Query Frame = 2
Query: 1691 AASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKG-AEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            A   G  D  R L      +L+  +++  + LH A    H + V  LLDAGAD+                RG+  I  +        I+ + K           FN  E C RVLL+  AD+NI N   QTALH A  + +   +++L+  G  +++V D +  T LH+A  I S   +K
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDV--------------RGSPSIQRI------PPIICAAK-----------FNAIESC-RVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIK 149          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 73.1738 bits (178), Expect = 1.604e-14
Identity = 68/259 (26.25%), Postives = 111/259 (42.86%), Query Frame = 2
Query: 1388 TFFNALKIGN-LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND-TALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYL-NCMKILVEKGAEI 2155
            T F+AL      N V  + + +   ++ +   PL +A   G ++V +LL+EK A ++ K + G+T LH+A     F     L++KG  ++ ++ +  TP + A +AG          + NA L +   EN  + LHLA     A  V AL  AG      + +  +A H+ A  G  +++                                     LL+Y ADIN R++N  T L  A     +  CM++L + GA I
Sbjct:    7 TGFSALHHATRYNRVEAMAELIRNGSIEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGR---------TENAMLLLEKDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQ-----------------------------------LLRYGADINARDSNRWTPLMCAAKTGSVKTCMELL-QSGASI 220          

HSP 2 Score: 60.077 bits (144), Expect = 4.746e-10
Identity = 57/226 (25.22%), Postives = 102/226 (45.13%), Query Frame = 2
Query: 1550 INAKEENGDTALHIAVQKDKFKICDLLINKGA--DVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDT 2221
            +N  ++ G +ALH A + ++ +    LI  G+  D++       TP+ +A   GSM++ RLL   + A L   N + +T LH+A      +++  LL  G  I   +  +   F      G         + E   ++  + +++ + LHLA        +  L +     N R+   Q+ALH+A    +   +  L+  GA+I+  D+N  TPL  A +  S+ T
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGSIEDLS-------TPLHVACKKGSMEVGRLL-VEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAG---------RTENAMLLLEKDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKT 209          

HSP 3 Score: 53.1434 bits (126), Expect = 1.146e-7
Identity = 32/91 (35.16%), Postives = 48/91 (52.75%), Query Frame = 2
Query: 1955 VNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVK 2227
            +N   D  F+ALH A   N    +  L++     N    +L T LH+A  +  +   ++LVEKGA +D  +  G+TPLH+A  I S D +K
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIR-----NGSIEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALK 86          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 73.559 bits (179), Expect = 1.661e-14
Identity = 60/211 (28.44%), Postives = 106/211 (50.24%), Query Frame = 2
Query: 1583 LHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRG-NERILEMFLKREGVKIVNSQKDDK--FAALHLAVFNNHEGCLRVLLKYKA-DINIRNNN--LQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIA 2197
            LH+A      + C  L+  G DVNA++NN  TP+  AA +G+++   LL  S+  D +  +      LH A  + +   V +L+ AG+++   + K     H  A    + + +E  L+  G    N+ K DK  ++A+H A  N H+  + +LL   A D+  R++     T LH+A    +   +++L++   +++V D  G TPL +A
Sbjct:    4 LHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELL-MSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRG----NASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLA 209          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 281.182 bits (718), Expect = 7.119e-80
Identity = 214/741 (28.88%), Postives = 367/741 (49.53%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN--------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKI------LQAQGPTTVAAG---GLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGHV-ACDVCANNLYECHICRESIENK 2734
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + ++ LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A ++I+N N QTALH+AV +++   +++LV   A++DV D +GDTPLH A+R H++  +++   +  +S +     S N        +G++K     +A +L    A   I+NK  ++P+D C DP+L + L+  +  + S ++ T+       +++     V +      +  P  HI   S    + K   +   ++++Q     + C++C D+   V F  CGH+ AC+ CA+ + +C  CR  +E +
Sbjct:  197 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKI------APSGSAVSNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGTRSPSLNSNMESLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLI--CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERR 906          

HSP 2 Score: 169.474 bits (428), Expect = 1.461e-42
Identity = 183/736 (24.86%), Postives = 310/736 (42.12%), Query Frame = 2
Query:  590 EVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GMEWMINPKCIGKRN---------ENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND--TALHLAVKNFHAESVNALL---DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            E++++LQ  HGGW + M   +     +  I +D D+ V    G  W  NP  + K N           +  S +   GD+VQIC DI +IK LQ+ HG W  +M    GK+ +VQ I    D+KV V      YNP  +TK   + +  + A G+R     L +L  K+F   +   +  N+  +K    G    +  ++ +L    K   VDVNG               +C   T     S    Q     + +++ + +   E+++ D DR          G++ EV +   +   +       PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  +  +L+  GADV   NNN    +  AA  G+    R+L +       +   ++D  TALHLA  N H E    L+   +A  DI+ VN +   A HL  +R + +I                                   +R+L++ +A +++++ +  T LH A+    L+ ++ L       D+ D +   P   +     M         LG  G  + +A+S         +A +L    A   I+NK  ++P+D C DP+L + L+  +  + S ++ T+                           +  L +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  260 EIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGER-----LSQLLKKLFETQESGDI--NEELVKAAANGD---LAKVEDIL----KRPDVDVNG---------------QCAGHTAMQAAS----QNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQ--TALHLAVERQHTQI-----------------------------------VRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQ------DMQDVSKVEPWEPSKNTLIMG--------LGTQGAEKKSAAS---------IACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGTR---------------------------SPSLNSNMESLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 862          

HSP 3 Score: 67.0106 bits (162), Expect = 8.169e-11
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2564 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  960 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1020          

HSP 4 Score: 56.6102 bits (135), Expect = 1.256e-7
Identity = 41/149 (27.52%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYD--------------TRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +              + Q H +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  258 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFH-VGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 398          

HSP 5 Score: 51.2174 bits (121), Expect = 5.324e-6
Identity = 53/241 (21.99%), Postives = 101/241 (41.91%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXK------VMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G+ YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            +      V +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K   +           + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  225 GSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 460          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 280.026 bits (715), Expect = 3.609e-79
Identity = 214/741 (28.88%), Postives = 367/741 (49.53%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFL-KREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLL-KYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSN--------EGSDK--PEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKI------LQAQGPTTVAAG---GLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGHV-ACDVCANNLYECHICRESIENK 2734
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   ++ A++++GD A+H A   D+  + ++L   GAD+NA+N  + TP+ +A + G + + + L        S+ +SE DT LH A+     + ++ LL+AGAD+   NN  FNA H  A RGN   + + L K     IV+ +KDD + ALHLA  NNH     +L+ +  A ++I+N N QTALH+AV +++   +++LV   A++DV D +GDTPLH A+R H++  +++   +  +S +     S N        +G++K     +A +L    A   I+NK  ++P+D C DP+L + L+  +  + S ++ T+       +++     V +      +  P  HI   S    + K   +   ++++Q     + C++C D+   V F  CGH+ AC+ CA+ + +C  CR  +E +
Sbjct:  197 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKI------APSGSAVSNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGTRSPSLNSNMESLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLI--CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERR 906          

HSP 2 Score: 169.474 bits (428), Expect = 1.464e-42
Identity = 183/736 (24.86%), Postives = 310/736 (42.12%), Query Frame = 2
Query:  590 EVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GMEWMINPKCIGKRN---------ENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSEND--TALHLAVKNFHAESVNALL---DAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2743
            E++++LQ  HGGW + M   +     +  I +D D+ V    G  W  NP  + K N           +  S +   GD+VQIC DI +IK LQ+ HG W  +M    GK+ +VQ I    D+KV V      YNP  +TK   + +  + A G+R     L +L  K+F   +   +  N+  +K    G    +  ++ +L    K   VDVNG               +C   T     S    Q     + +++ + +   E+++ D DR          G++ EV +   +   +       PL IAVN GH+ VVK L++   + + ++  GDT LH A+ K +  +  +L+  GADV   NNN    +  AA  G+    R+L +       +   ++D  TALHLA  N H E    L+   +A  DI+ VN +   A HL  +R + +I                                   +R+L++ +A +++++ +  T LH A+    L+ ++ L       D+ D +   P   +     M         LG  G  + +A+S         +A +L    A   I+NK  ++P+D C DP+L + L+  +  + S ++ T+                           +  L +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  260 EIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGER-----LSQLLKKLFETQESGDI--NEELVKAAANGD---LAKVEDIL----KRPDVDVNG---------------QCAGHTAMQAAS----QNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQ--TALHLAVERQHTQI-----------------------------------VRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQ------DMQDVSKVEPWEPSKNTLIMG--------LGTQGAEKKSAAS---------IACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGTR---------------------------SPSLNSNMESLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 862          

HSP 3 Score: 56.9954 bits (136), Expect = 9.321e-8
Identity = 41/149 (27.52%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYD--------------TRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +              + Q H +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  258 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFH-VGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 398          

HSP 4 Score: 52.373 bits (124), Expect = 2.622e-6
Identity = 53/241 (21.99%), Postives = 101/241 (41.91%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXK------VMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G+ YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            +      V +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K   +           + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  225 GSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 460          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 263.077 bits (671), Expect = 5.647e-74
Identity = 209/691 (30.25%), Postives = 341/691 (49.35%), Query Frame = 2
Query:  782 LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESE------PDIQ--TMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAV-KNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDL---------------------AIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGH-VACDVCANNLYECHICRESIENKIR 2740
             ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F  G+ VR+++    +KRLQ GHGEW ++M  VLG+VGKV  V  +GDL+V   GQ    NP C+ A   D ++       P+    T+++ L +++ QS    E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK L++   ++  K+E+GDTALH A   ++ +I  LL++KGA+VN  NN+  T + +A + G  D+ R+L T  +AD+++ +S  DT LH A+ K+F +     ++    D    N++ FN  H  A +GN+   E  L R   ++V+ +KDD F+ALHLA  NNH     VL+K  + DIN+RNN  QTAL +AV+Q +   +++LV++GA++++ D +GDT +H+A+    +  V     +L  +    +T  ++EG   P  L                     A +L ++ A  +  N   K+P+D     L +  ++   +  S++   + LQA    T   G         +   S + + T    +  L         E  C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  249 FQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVDVDANLMTTENPNESGSTVISVLEKLLSQST---EQDNP----CRLVIEAAH-GSAVKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKALLQANCSVEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILAR-ARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQLANV-----MLSPAVGTGATEDNSEGC-SPTTLHGRLSSSGLLGNGELSVGTAIACFLAQEGADINYANHKGKSPLDL----LADSGALQLIKSFSEKHRLQRLQA---ITCGQG---------LSSASLRRVHTTPNTMTNLVLPTPPGPSE--CLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 878          

HSP 2 Score: 63.5438 bits (153), Expect = 9.674e-10
Identity = 34/130 (26.15%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V +++  E  KRLQ  +GEW+D M  +LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  260 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 384          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 263.462 bits (672), Expect = 1.168e-73
Identity = 209/691 (30.25%), Postives = 341/691 (49.35%), Query Frame = 2
Query:  782 LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESE------PDIQ--TMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAV-KNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDL---------------------AIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGH-VACDVCANNLYECHICRESIENKIR 2740
             ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F  G+ VR+++    +KRLQ GHGEW ++M  VLG+VGKV  V  +GDL+V   GQ    NP C+ A   D ++       P+    T+++ L +++ QS    E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK L++   ++  K+E+GDTALH A   ++ +I  LL++KGA+VN  NN+  T + +A + G  D+ R+L T  +AD+++ +S  DT LH A+ K+F +     ++    D    N++ FN  H  A +GN+   E  L R   ++V+ +KDD F+ALHLA  NNH     VL+K  + DIN+RNN  QTAL +AV+Q +   +++LV++GA++++ D +GDT +H+A+    +  V     +L  +    +T  ++EG   P  L                     A +L ++ A  +  N   K+P+D     L +  ++   +  S++   + LQA    T   G         +   S + + T    +  L         E  C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  318 FQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVDVDANLMTTENPNESGSTVISVLEKLLSQST---EQDNP----CRLVIEAAH-GSAVKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKALLQANCSVEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILAR-ARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQLANV-----MLSPAVGTGATEDNSEGC-SPTTLHGRLSSSGLLGNGELSVGTAIACFLAQEGADINYANHKGKSPLDL----LADSGALQLIKSFSEKHRLQRLQA---ITCGQG---------LSSASLRRVHTTPNTMTNLVLPTPPGPSE--CLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 947          

HSP 2 Score: 63.5438 bits (153), Expect = 9.491e-10
Identity = 34/130 (26.15%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V +++  E  KRLQ  +GEW+D M  +LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  329 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 453          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 263.462 bits (672), Expect = 2.033e-73
Identity = 209/691 (30.25%), Postives = 341/691 (49.35%), Query Frame = 2
Query:  782 LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESE------PDIQ--TMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAV-KNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDL---------------------AIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGH-VACDVCANNLYECHICRESIENKIR 2740
             ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F  G+ VR+++    +KRLQ GHGEW ++M  VLG+VGKV  V  +GDL+V   GQ    NP C+ A   D ++       P+    T+++ L +++ QS    E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK L++   ++  K+E+GDTALH A   ++ +I  LL++KGA+VN  NN+  T + +A + G  D+ R+L T  +AD+++ +S  DT LH A+ K+F +     ++    D    N++ FN  H  A +GN+   E  L R   ++V+ +KDD F+ALHLA  NNH     VL+K  + DIN+RNN  QTAL +AV+Q +   +++LV++GA++++ D +GDT +H+A+    +  V     +L  +    +T  ++EG   P  L                     A +L ++ A  +  N   K+P+D     L +  ++   +  S++   + LQA    T   G         +   S + + T    +  L         E  C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  374 FQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVDVDANLMTTENPNESGSTVISVLEKLLSQST---EQDNP----CRLVIEAAH-GSAVKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKALLQANCSVEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILAR-ARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQLANV-----MLSPAVGTGATEDNSEGC-SPTTLHGRLSSSGLLGNGELSVGTAIACFLAQEGADINYANHKGKSPLDL----LADSGALQLIKSFSEKHRLQRLQA---ITCGQG---------LSSASLRRVHTTPNTMTNLVLPTPPGPSE--CLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 1003          

HSP 2 Score: 63.5438 bits (153), Expect = 9.410e-10
Identity = 34/130 (26.15%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V +++  E  KRLQ  +GEW+D M  +LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  385 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 509          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000017279.1 (SMESG000017279.1)

HSP 1 Score: 1786.54 bits (4626), Expect = 0.000e+0
Identity = 879/894 (98.32%), Postives = 885/894 (98.99%), Query Frame = 2
Query:   68 MGGAESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLYK 2749
            MGG ESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMEMEETFEEGEKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAAR QRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVN GHIDV+KLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVN LLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDT LHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKND+TPMDFCDPSLKEKLSVANARRMSKEIETKILQAQG TTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDE+TCIIC+DR  NVTFGCGHVACDVCANNLYECHICRE+I NKIRLY+
Sbjct:    1 MGGVESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMEMEETFEEGEKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARAQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNEGHIDVIKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNVLLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTALHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDRTPMDFCDPSLKEKLSVANARRMSKEIETKILQAQGSTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDERTCIICFDRQNNVTFGCGHVACDVCANNLYECHICRENIGNKIRLYR 894          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000017281.1 (SMESG000017281.1)

HSP 1 Score: 1026.54 bits (2653), Expect = 0.000e+0
Identity = 545/908 (60.02%), Postives = 675/908 (74.34%), Query Frame = 2
Query:   68 MGGAESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQY--DTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMG-QSDHSDESDE-PDNDRTKT---------FFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLYK 2749
            MG + S   +   VVI  KD+ETI   Q  HGGWN +MNECL GPC+LVQ +GS AIV+GPSGNVYRLNSELL +Y  DT Q+   G  V LI++ ++F++LQV +GEW+++M +I+GKKV++I +F DG+VKIKY G TF IN KAI + N K    E+   F+ GEKV+LI N + MK LQ++HGGW +L+ L+ G+EVEIV+I +DGDMYVS+ GMEWMINP+CI        K  KLRKGD V + DDIQK KQLQQNHGGWV+ M   +GK  K+++ILP+GDVKVNV+ L LVYNP+LLTK +                    K ++K+F+PGDKVRLIN+K K+K LQK HGEWV++M+F LGK GKVKS+  +GDL+VKIM Q L LNPECVEATDSD +S+PDI +M+  L+++M   SD SD+ D+  D+D  KT          F A+K G LN VR L +SVG +  L+G+YPLMIAVN GHIDVVKLLIEKRAN+NAK+++GDTALH+AV K++ KICDLLINKGADVNAQNNNKITPIMLAAS+GS++ITRLLATSRNADLSIG+S+NDTALHLAV+     SV  LLDAGADI A+N K FN FHL A +G+ +ILE+FLKREGVKIV+SQK+DKFAA+HL   NNHE CLRVLL YKADINIRNN LQTALHIAV QK+LNC+KILVE  AEI++ D++GDTPLHIA+++  ++  KK G++ G+  +        EGSD P+D+AIYLLK  A  D+KNK   TPM+ C D  LK ++   N    +K+    +++ +      A    A        +   ++K++DEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLYK
Sbjct:    1 MGASLSGLKAGDDVVIAIKDLETIIQMQMAHGGWNDSMNECLIGPCKLVQGIGSDAIVRGPSGNVYRLNSELLSKYGSDTSQESISGYVVELIQDEKQFRQLQVGHGEWNNNMKDIIGKKVQVIHKFLDGDVKIKYNGSTFVINPKAIASKNEKPPVSEVCHKFKIGEKVVLIGNVDTMKKLQENHGGWSDLLMLYAGKEVEIVEIFEDGDMYVSKFGMEWMINPECI------DVKDNKLRKGDTVILSDDIQKTKQLQQNHGGWVSRMSVFAGKCGKIEAILPTGDVKVNVNGLGLVYNPLLLTKSD--------------------KSDLKMFAPGDKVRLINDKSKVKLLQKNHGEWVSSMEFFLGKKGKVKSLFADGDLRVKIMNQNLTLNPECVEATDSDSDSDPDIFSMMEHLSKLMNLDSDQSDQEDKGKDSDDGKTDGNQEEVMKLFFAVKNGELNNVRNLCESVGVNARLKGIYPLMIAVNEGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQ---DLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLYK 879          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000031930.1 (SMESG000031930.1)

HSP 1 Score: 484.182 bits (1245), Expect = 3.399e-160
Identity = 288/647 (44.51%), Postives = 397/647 (61.36%), Query Frame = 2
Query:  815 DIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQ--RRRSSALEKLE-VKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRL 2743
            D+  I + Q+NHGGW + M+ C    CK+          +N D               G+ A      G   R  S  L   + VK    G  V+LI ++ + K LQ  HGEW   M+ +LGK  +V  +  +GD K+    +   ++P+ +++     E   + +   +        +D S  +DE    RT  F  ALK GNL+EV +LVDSVG +T L+G+YPL+IA N GH D+V LL+EK+ANIN  +++GDTALH+AV +++FK+CDLL+ KGADVNAQNN KITP M+A   GS DI  LL TS NADLSIG+S+ DTALHLAV +   ESV ALL+AGADI  +N K FNA+HL A  G+E+ILE+FLKR+G K+VNSQK+DKFAA+H+A  NNHE CL VL+KYKAD+N++N  L+TALHIAV +KYL+ +K LVE  AE+D+ D NG+T LH+A++++  ++    G  L ++       +  EG DK ED+AIYL++  A  DIKN   KTP+D C D SLK ++     R   K   TK              L+ HP    D       ++ + EL ELRQ++++MEDEK C IC+DR + V F CGH+ CD C++N+ ECH+C E I +KI++
Sbjct:   20 DLSTIIKKQKNHGGWNDLMKECLTGPCKL----------INDD---------------GSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS-----EIVENTELKSDDSDDSDDSNDRSLITDE----RTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTES--GFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITK------------KELLEHPVQPSDA------RSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 612          

HSP 2 Score: 162.155 bits (409), Expect = 1.702e-41
Identity = 79/156 (50.64%), Postives = 106/156 (67.95%), Query Frame = 2
Query:   68 MGGAESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSM 535
            MG   S  +   +VVI  +D+ TI  KQ+ HGGWN  M ECLTGPC+L+   GS A V GPSG +YRLNSELL+ + + + HKIGSFV LI++ EEFK LQ  +GEW +DM NILGK+VE+IQ F+DG+ KI +    F ++ K I ++  + T +
Sbjct:    1 MGANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTEL 156          

HSP 3 Score: 61.2326 bits (147), Expect = 3.108e-9
Identity = 100/442 (22.62%), Postives = 183/442 (41.40%), Query Frame = 2
Query:  608 QKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRK-GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTK--CEGNQANP---------------TAARGQR----RRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGD--LKVKIMGQKLNLNPECV-EATDSDCESEPDIQ-TMV------NQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLE----GVYPLMIAVNGGHIDVVKLLIEKRAN--INAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAES 1819
            QK+HGGW +LM   +    +++         +   GM + +N + +       FKS K  K G  VQ+  D ++ K LQ  HG W   M    GK  +V  I   GD K++ +    + +P  +     E  +                  T  R  R     ++  L ++   V S G    L      +    +GH + VN    +L K   +   D +GD  L + +   +  L    + +  D + ++   I  TM+        + +++  S+++D S   D+DR      A+    L  V  L+++     LL       Y L  A   GH  ++++ +++     +N+++E+   A+H+A   +      +L+   AD+N QN    T + +A     +   + L  ++ A+L + +   +TALH+A+K    ES
Sbjct:   28 QKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVP-----FKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKSDDSDDSDDSNDRSLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVN---LLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSI-GDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHL--AAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENK-AELDLKDKNGNTALHVAMKVNQTES 457          

HSP 4 Score: 55.0694 bits (131), Expect = 2.383e-7
Identity = 38/127 (29.92%), Postives = 62/127 (48.82%), Query Frame = 2
Query:  368 QVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT-DNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCI 745
            Q  +G W+D M   L    ++I         +   G  +R+NS+ ++   + KK  +           V LI++ E  K LQ  HG W E M   +G+EVE+++I KDGD  +S     ++++PK I
Sbjct:   28 QKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSF--------VQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTI 146          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000030607.1 (SMESG000030607.1)

HSP 1 Score: 224.172 bits (570), Expect = 4.509e-60
Identity = 183/663 (27.60%), Postives = 306/663 (46.15%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYV-SRLGMEWMINPKCIGK-----RNENKFKSEK--------LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLE--VKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQK-------LNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEP------------------------DNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIE---KRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNE---RILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            +V++  + ++++NLQ  HGGW + M   +  E  + +I +DGD+ V    G ++  NP C+ K       EN   S++        LR G       +I + +  + +                   S +P  D           YNP    +       PT+   Q R SS    L    +  SPG  V++ ++   IK +Q G G W  +M   +G VGK+    +  DL   ++ +          LN   +    S   S P++     Q   ++     +  + +P                          D  + F  A   G+L++V +L+   SV  +++      L  A   GH+++V+ LI+    + +IN K+ +GD A+H A   D   I  +L N GAD+N++N    TP+ +A + G +++ + L   ++A  +  + + DT LH ++   H +   AL+ A +DI   NN  FN+ H  A RGN    RI+   L R+   IV+ +KDD + ALHLA  NNH     +L+K   AD+N++N NLQT LH+AV +++ N +K+LV+ GA+I + D +GDTPLH A+R H++  +++   L  +  +    +   E       +A YL+   +   IKNK  +TP+D C
Sbjct:  250 QVVIDLDFDIVRNLQVGHGGWADCMMECLSMEGTVTQIDEDGDVQVIFSSGAQYTFNPVCLTKTTRRDHGENSLSSQRSTITVPITLRPGAT-----NISRTRSTESDD--------------VPTSSTVPDSDTTR--------YNPHNPRR----STLPTSVYAQHRDSSQSRPLSHAPESLSPGCWVKISSDLELIKTVQCGLGMWNESMAVCVGTVGKIVQ-SLGHDLWRVVLSRTSGSSESTFVLNSALLARIRSP-MSSPEVSVSATQPRTMLLSQRSTGSTSQPIEAVEAASTGTLSHVLRSIFEAHTTGDAKELFVKAAANGDLDKVLELLKKRSVDVNSMFARHSALHAASQNGHVEIVQALIKYGGDQLDINLKDPDGDAAVHHAALGDHKIIIQILKNAGADINSRNRRNQTPLHIAVNKGHLEVLKALLELKSALQTNQDYDGDTPLHDSITRRHDKLTLALVQANSDITVCNNAGFNSLHHAALRGNPNATRIILENLPRQW--IVDEKKDDGYTALHLAALNNHADVAELLIKVGSADLNVQNINLQTPLHLAVERQHSNMVKLLVDSGADISIPDKDGDTPLHEALRHHTLSQLRQMQDLQDMGKLLMGLSLGGEKRSAAH-IACYLVSNGSDIHIKNKKGQTPLDLC 876          

HSP 2 Score: 68.1662 bits (165), Expect = 2.757e-11
Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 2
Query: 2555 KDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            KD++ ++L Q+ QD+++   C +C DR   + F CGH +C +C + L  C ICRE+I NKI LY
Sbjct: 1230 KDKDYKKLEQQYQDIKEMTMCPVCMDRVRKMVFMCGHCSCQLCGDKLETCPICRETITNKILLY 1293          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000030607.1 (SMESG000030607.1)

HSP 1 Score: 221.09 bits (562), Expect = 4.654e-59
Identity = 183/663 (27.60%), Postives = 305/663 (46.00%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYV-SRLGMEWMINPKCIGK-----RNENKFKSEK--------LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLE--VKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQK-------LNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEP------------------------DNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIE---KRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNNKNFNAFHLVAQRGNE---RILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKY-KADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDKTPMDFC 2386
            +V++  + ++++NLQ  HGGW + M   +  E  + +I +DGD+ V    G ++  NP C+ K       EN   S++        LR G       +I + +  + +                   S +P  D           YNP    +       PT+   Q R SS    L    +  SPG  V++ ++   IK +Q G G W  +M   +G VGK+    +  DL   ++ +          LN   +    S   S P++     Q   ++     +  + +P                          D  + F  A   G+L++V +L+   SV  +++      L  A   GH+++V+ LI+    + +IN K+ +GD A+H A   D   I  +L N GAD+N++N    TP+ +A + G +++ + L   +    S+ + + DT LH ++   H +   AL+ A +DI   NN  FN+ H  A RGN    RI+   L R+   IV+ +KDD + ALHLA  NNH     +L+K   AD+N++N NLQT LH+AV +++ N +K+LV+ GA+I + D +GDTPLH A+R H++  +++   L  +  +    +   E       +A YL+   +   IKNK  +TP+D C
Sbjct:  250 QVVIDLDFDIVRNLQVGHGGWADCMMECLSMEGTVTQIDEDGDVQVIFSSGAQYTFNPVCLTKTTRRDHGENSLSSQRSTITVPITLRPGAT-----NISRTRSTESDD--------------VPTSSTVPDSDTTR--------YNPHNPRR----STLPTSVYAQHRDSSQSRPLSHAPESLSPGCWVKISSDLELIKTVQCGLGMWNESMAVCVGTVGKIVQ-SLGHDLWRVVLSRTSGSSESTFVLNSALLARIRSP-MSSPEVSVSATQPRTMLLSQRSTGSTSQPIEAVEAASTGTLSHVLRSIFEAHTTGDAKELFVKAAANGDLDKVLELLKKRSVDVNSMFARHSALHAASQNGHVEIVQALIKYGGDQLDINLKDPDGDAAVHHAALGDHKIIIQILKNAGADINSRNRRNQTPLHIAVNKGHLEVLKALLELK-CLASLQDYDGDTPLHDSITRRHDKLTLALVQANSDITVCNNAGFNSLHHAALRGNPNATRIILENLPRQW--IVDEKKDDGYTALHLAALNNHADVAELLIKVGSADLNVQNINLQTPLHLAVERQHSNMVKLLVDSGADISIPDKDGDTPLHEALRHHTLSQLRQMQDLQDMGKLLMGLSLGGEKRSAAH-IACYLVSNGSDIHIKNKKGQTPLDLC 875          

HSP 2 Score: 68.1662 bits (165), Expect = 2.925e-11
Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 2
Query: 2555 KDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2746
            KD++ ++L Q+ QD+++   C +C DR   + F CGH +C +C + L  C ICRE+I NKI LY
Sbjct: 1229 KDKDYKKLEQQYQDIKEMTMCPVCMDRVRKMVFMCGHCSCQLCGDKLETCPICRETITNKILLY 1292          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIB16.457e-8028.14mindbomb E3 ubiquitin protein ligase 1 [Source:HGN... [more]
MIB25.349e-6225.59mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB25.809e-6225.54mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB21.244e-6125.54mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB24.894e-6126.26mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.231e-2930.56AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.231e-2930.56AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.451e-2930.56AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.451e-2930.56AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.520e-2930.56AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib15.903e-7628.76gene:FBgn0263601 transcript:FBtr0333578[more]
mib11.275e-7528.76gene:FBgn0263601 transcript:FBtr0075520[more]
mib29.240e-5629.94gene:FBgn0086442 transcript:FBtr0336840[more]
mib29.240e-5629.94gene:FBgn0086442 transcript:FBtr0081142[more]
mib29.240e-5629.94gene:FBgn0086442 transcript:FBtr0336841[more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib18.908e-8028.74mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib12.189e-7928.48mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib11.171e-7828.44mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib24.200e-4626.80mindbomb E3 ubiquitin protein ligase 2 [Source:ZFI... [more]
ank3a8.538e-3129.16ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib11.117e-7728.28mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib12.578e-7728.13mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
coa73.150e-7627.46cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa73.452e-6726.84cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa73.917e-6726.98cytochrome c oxidase assembly factor 7 (putative) ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mib11.801e-8028.26mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib11.801e-8028.26mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib17.106e-6228.34mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib24.991e-5425.82mindbomb E3 ubiquitin protein ligase 2 [Source:MGI... [more]
Mib21.845e-3124.40mindbomb E3 ubiquitin protein ligase 2 [Source:MGI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80SY4|MIB1_MOUSE1.260e-7928.26E3 ubiquitin-protein ligase MIB1 OS=Mus musculus O... [more]
sp|Q86YT6|MIB1_HUMAN3.101e-7928.14E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens O... [more]
sp|Q804S5|MIB1_DANRE6.724e-7928.74E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX... [more]
sp|Q6GNY1|MIB1_XENLA1.646e-7627.91E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis... [more]
sp|Q9VUX2|MIB_DROME1.278e-7428.76E3 ubiquitin-protein ligase mind-bomb OS=Drosophil... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8FX871.161e-8830.63Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A498NZI97.397e-8427.41E3 ubiquitin-ligase mib1 isoform X1 OS=Labeo rohit... [more]
A0A1S3II446.060e-8331.63E3 ubiquitin-protein ligase MIB2 isoform X2 OS=Lin... [more]
A0A1S3IJ212.632e-8231.79E3 ubiquitin-protein ligase MIB2 isoform X1 OS=Lin... [more]
A0A0S7GYI91.533e-8028.98MIB1 (Fragment) OS=Poeciliopsis prolifica OX=18813... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib13.065e-8028.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib13.899e-8028.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib29.208e-7429.72mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.212e-7329.72mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib22.640e-7329.14mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008505.11.269e-4627.33pep scaffold:Pmarinus_7.0:GL477211:28706:49738:-1 ... [more]
ENSPMAT00000007446.11.501e-2828.85pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000000095.12.209e-2829.29pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.13.422e-2826.56pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ankdd1a3.163e-2731.20ankyrin repeat and death domain containing 1A [Sou... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AVO23.073e-1127.53Component of a complex containing the Tor2p kinase... [more]
NAS68.319e-1129.30Evolutionarily conserved 19S regulatory particle a... [more]
HOS41.970e-836.70Subunit of the Set3 complex; complex is a meiotic-... [more]
AKR11.804e-723.81Palmitoyl transferase involved in protein palmitoy... [more]
AKR21.853e-725.00Ankyrin repeat-containing protein; member of a fam... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO436907.632e-1827.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387028.120e-1828.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391139.084e-1629.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387251.604e-1426.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494851.661e-1428.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib17.119e-8028.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib13.609e-7928.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib25.647e-7430.25mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.168e-7330.25mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib22.033e-7330.25mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017279.10.000e+098.32SMESG000017279.1[more]
SMESG000017281.10.000e+060.02SMESG000017281.1[more]
SMESG000031930.13.399e-16044.51SMESG000031930.1[more]
SMESG000030607.14.509e-6027.60SMESG000030607.1[more]
SMESG000030607.14.654e-5927.60SMESG000030607.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004508 ID=SMED30004508|Name=E3 ubiquitin-protein ligase MIB2|organism=Schmidtea mediterranea sexual|type=transcript|length=2842bp
CAGTGAACTTTTAAATAGTATTTTTTATTACATTTTTTATTAACTAATTG
CAAAATAAGAAGATCTGATGGGGGGAGCAGAATCAGTGGAAAACTCTAAT
ATCCAGGTTGTTATTGGAACTAAGGATATGGAAACCATTAAGATAAAGCA
GAGAGAGCATGGCGGCTGGAATGCCAATATGAACGAGTGTCTAACTGGTC
CATGCCAACTGGTACAAAGCCTTGGTTCATGTGCCATTGTCAAGGGCCCC
TCTGGAAATGTGTACCGTTTGAATTCTGAATTGCTGATCCAATACGACAC
AAGGCAAGATCATAAAATTGGATCATTTGTTACTCTTATTGAAAATGCCG
AAGAATTCAAACGTTTGCAGGTTCAGAATGGAGAATGGAGTGACGACATG
GGAAATATTTTAGGTAAAAAAGTAGAAATCATTCAACAATTTCAAGATGG
CAATGTTAAAATTAAATACAGAGGCAGAACTTTCAGAATAAATTCTAAAG
CTATTTTAACCGATAATTGCAAGAAAACCTCTATGGAGATGGAGGAGACA
TTTGAAGAAGGGGAAAAGGTTATGTTGATAAGAAATTCTGAAGTCATGAA
AAATCTTCAGAAAGACCATGGAGGATGGTGCGAATTGATGAACTTGTTTA
TTGGTGAAGAAGTGGAGATTGTGAAGATATTGAAAGATGGTGACATGTAC
GTATCAAGGTTGGGCATGGAGTGGATGATCAATCCTAAATGCATTGGAAA
AAGAAATGAAAACAAATTCAAGAGTGAAAAGTTAAGAAAGGGAGATATTG
TCCAAATCTGTGATGACATTCAGAAAATAAAGCAACTTCAGCAAAATCAC
GGCGGCTGGGTTAACAGCATGGAATTCTGCTCTGGCAAAATTTGTAAAGT
TCAATCTATTCTTCCGTCGGGCGATGTGAAAGTTAATGTTGATAGATTGG
AACTTGTCTATAATCCGATGTTGCTAACCAAATGTGAAGGTAACCAGGCA
AATCCAACTGCTGCTCGGGGTCAAAGGAGAAGGTCAAGTGCTCTTGAGAA
ACTTGAAGTTAAAGTGTTTTCTCCTGGAGATAAAGTGCGCTTGATTAACA
ACAAACATAAAATCAAACGCTTGCAAAAAGGTCACGGAGAATGGGTAAAT
GCCATGCAATTCGTTCTAGGAAAAGTTGGCAAAGTTAAGTCAGTTGATGT
TAATGGAGATCTGAAAGTGAAAATCATGGGTCAAAAACTAAATTTAAATC
CAGAATGCGTCGAGGCAACGGATTCAGACTGCGAATCGGAACCGGATATA
CAGACAATGGTGAACCAATTAACTCAAATAATGGGGCAATCTGATCACTC
TGATGAGTCGGATGAACCCGATAATGACAGAACCAAAACATTTTTCAATG
CACTTAAAATTGGAAATTTGAATGAAGTAAGGAAACTGGTGGACTCGGTG
GGAACTAGCACTTTGTTGGAAGGCGTTTATCCCTTGATGATTGCAGTAAA
TGGCGGCCACATTGATGTGGTGAAATTGTTGATAGAAAAGAGGGCGAATA
TCAATGCAAAAGAAGAAAATGGTGACACCGCCCTTCATATCGCGGTTCAG
AAAGACAAATTTAAGATTTGTGATCTGCTGATAAATAAAGGGGCCGATGT
GAATGCTCAGAATAATAACAAGATCACACCAATAATGCTGGCGGCGAGTG
CCGGTTCAATGGATATTACTCGATTGCTGGCTACTTCTAGGAATGCTGAC
CTCAGCATTGGGAACTCTGAAAATGATACCGCGCTTCATTTGGCAGTCAA
GAACTTCCATGCGGAATCTGTGAATGCGTTGTTGGATGCGGGAGCCGATA
TCAGAGCAGTGAACAACAAGAATTTCAATGCATTTCACCTTGTAGCTCAG
AGGGGAAATGAAAGGATTCTTGAAATGTTTCTGAAAAGAGAAGGAGTAAA
AATTGTCAATTCACAAAAGGATGATAAATTTGCAGCGCTACACTTGGCAG
TTTTTAATAACCATGAAGGCTGTTTGCGAGTCCTCCTGAAGTACAAGGCG
GACATCAACATTCGCAACAACAATTTACAAACTGCCTTGCACATCGCAGT
GTCACAAAAATATCTAAACTGCATGAAAATATTGGTGGAAAAGGGCGCAG
AAATTGACGTGACCGACGCAAATGGAGATACTCCACTTCACATTGCTGTT
AGGATACACTCAATGGACACTGTTAAGAAACGCGGTAAACTCTTAGGAAT
TTCAGGGATCTTCCAGTCGACAGCAAGTAGTAACGAAGGCTCCGACAAGC
CTGAGGATTTAGCTATATATTTGCTAAAGAAGAAGGCAAGAACTGATATA
AAAAATAAAAATGATAAAACCCCTATGGATTTCTGCGACCCTTCATTAAA
AGAGAAATTATCAGTCGCAAATGCAAGAAGAATGTCAAAAGAAATTGAGA
CAAAGATCTTGCAAGCTCAAGGACCAACAACGGTAGCTGCAGGAGGATTA
ATGGCACATCCAGGAGATCATATTGACAGAAATTCCGCACAGCATTTAAA
AACTAAAGATGAAGAATTGGAAGAATTACGTCAAAGAATACAAGATATGG
AAGACGAAAAAACTTGTATCATTTGCTATGACCGACCAATTAATGTTACA
TTCGGCTGTGGCCACGTGGCTTGCGACGTTTGCGCAAACAACTTATATGA
GTGCCACATCTGCCGGGAAAGCATAGAAAACAAGATTAGACTATATAAAT
GATTTCTTTTCCGTTTCAGCTTTCGAAATTAAATAATTTTGGGACATTTT
TATATTTTATAACGAATATTACGTTTTCCTAATTCAAAAAAA
back to top

protein sequence of SMED30004508-orf-1

>SMED30004508-orf-1 ID=SMED30004508-orf-1|Name=SMED30004508-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=895bp
MGGAESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQ
SLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRL
QVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDN
CKKTSMEMEETFEEGEKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVE
IVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDD
IQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNP
MLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIK
RLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEA
TDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN
LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANINAKEE
NGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDI
TRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNALLDAGADIRAVNN
KNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHE
GCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTD
ANGDTPLHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAI
YLLKKKARTDIKNKNDKTPMDFCDPSLKEKLSVANARRMSKEIETKILQA
QGPTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDEKTC
IICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR040847SH3_15
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 824..847
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 847..887
e-value: 1.5E-8
score: 34.4
NoneNo IPR availablePFAMPF13857Ank_5coord: 656..710
e-value: 1.1E-10
score: 41.5
NoneNo IPR availablePANTHERPTHR24202FAMILY NOT NAMEDcoord: 329..884
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 843..889
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 501..530
e-value: 1.4E-5
score: 34.5
coord: 636..665
e-value: 2.3E-4
score: 30.5
coord: 669..698
e-value: 9.1E-5
score: 31.8
coord: 702..761
e-value: 360.0
score: 8.3
coord: 534..564
e-value: 5.6
score: 15.9
coord: 468..497
e-value: 1.7E-5
score: 34.3
coord: 568..597
e-value: 2.6E-4
score: 30.3
coord: 601..632
e-value: 32.0
score: 13.4
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 469..498
e-value: 3.3E-6
score: 27.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 568..600
score: 12.823
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 501..533
score: 14.452
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 669..701
score: 11.835
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 468..500
score: 13.09
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 636..668
score: 10.873
IPR040847Mind bomb, SH3 repeat domainPFAMPF18346SH3_15coord: 83..145
e-value: 3.0E-7
score: 30.7
coord: 334..398
e-value: 3.0E-16
score: 59.5
coord: 162..225
e-value: 6.7E-9
score: 35.9
coord: 240..302
e-value: 9.5E-13
score: 48.3
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 506..597
e-value: 3.8E-15
score: 56.2
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 468..720
score: 70.565
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 425..559
e-value: 1.7E-30
score: 107.7
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 560..627
e-value: 1.2E-14
score: 56.4
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 430..720
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 823..894
e-value: 1.3E-14
score: 55.4
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 850..883
score: 9.76