FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30004492
Length (bp)1837
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30004492) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30004492) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30004492) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30004492) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004492

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004492SMESG000053382.1 SmedASXL_010794SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30004492SMESG000053382.1 dd_Smed_v4_23314_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004492SMESG000053382.1 dd_Smed_v6_23314_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.697e-10
Identity = 68/305 (22.30%), Postives = 128/305 (41.97%), Query Frame = 2
Query:  167 IVIEYLEFNTTIQTRLQLEDSSP--FPAITICPYQPFSDRAIH--FFKNKGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTIN----IRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISE 1057
            +V +YL+F     +  +++DS P  +P+++IC  +P S R I   +F N+    ++    LR   K   E+DS        F + +R +Y+NL   D+  +  +  ++ ++C    R    +  V      N S +   ++FNC+T N    ++   +     + LI    K   L              H  G ++ +H  GS P+     I + P     +  + I       P   C  +      +++   +Y ++F +CL   K + +++RC C  + LP   +PS    +C   K+  E
Sbjct:   88 LVRKYLQFQVVELS--EIKDSMPVQYPSVSICNIEPISLRTIRRMYFNNES---QNLITWLRFIQKFRFEQDS--------FMNSIRAFYENLG-QDAKKLSHNLEDMLMHC----RFNRELCHVS-----NFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTND------MLNGIKQYKYTFFACLQLCKQRLIIQRCGCKSSALPE--VPSYNATFCGVIKDWQE 361          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A1I8H6N9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002809g2 PE=3 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 5.797e-59
Identity = 153/534 (28.65%), Postives = 265/534 (49.63%), Query Frame = 2
Query:   38 IFFTNCSIRGVAKAYKTSSXXXXXXXXXXXXXXXXXXXYSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIHFFKNK-GMSPKDFSFKLRRTAKSFLEKD-------------------------------SPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVR-SDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQ-ESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGF--EYFLKKGKCIVKVLNEDQRLTSSDXXXXXXXXXXXXSLQISNIVWEPNLWQLEWLLTLHQSWNVLIE--PPANDTIVRSAKAEALKFL---NANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLT 1516
            IF    SIRGV K +KT S ++  +W IF++   + L YS+ KI ++YL+++  IQT  +++D +PFPA++IC  QPFS  A   + NK  MSP +F+  LR+ A S +  D                               S       L YD+LR+YYQN+  +++  +G   +E  V CI K      +G     D    +  +S P+FFNC ++   PEY+     + LI+      + +     S L  +++   G ++ +HE  + P   ++ I  EP ++ +I Y+ I ++ ++TP + CI  ++   +K  DL  EY++ F+ CL+S   + +L +C C+   LPR  +P++  PYC         GF  E F ++ +C+  +     R +   K CF KC +  F  ++S   W    W L W+  L + W+   +    +N +    +      +L   N  +L+ L +    + F  ++ ++ ++++R SN TF   E++ L++  L SR+GG C++Y+GLT
Sbjct:    8 IFLETSSIRGVGKVFKTQSPLLSRMWGIFVLGSTSFLFYSVFKITLDYLQYDVNIQTYQEIDDETPFPAVSICNNQPFSVNAYQRWSNKQSMSPTEFNKYLRQQALSLVSPDLMRDKYRDLQAARDRKDSKAFRQIHQSMFDSSVAAMTYSLIYDNLRMYYQNMLADEAMELGHTRNESIVDCIFKYGSIQVLGTRGCHDDMVKVKTFSDPNFFNCLSVEFTPEYAMTIISITLIVWLGPDDSYDIRHRQSFLNEVYEQAYGLRVDVHEPKTQPRVLEQGIQTEPGKMNEIKYQPIRFERKDTPKNPCISLDAAEKQKFRDLRMEYNYDFELCLNSKVQEVVLNKCGCMYIELPRIAMPNKTHPYC---------GFMDEKFKERSQCVKSLDMRTIRKSFEGKDCFPKCVDLSFEKELSTTKWRETKWMLHWIKELCERWDKQFKQLSGSNASEFEESLTGVTDYLTRDNITDLRSLGNSTSKASFDFDDRFSFIVVKRQSNNTFVKTEKIVLTLNALFSRVGGLCSMYIGLT 532          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4Z2D6C6 (FMRFamide-activated amiloride-sensitive sodium channel OS=Schistosoma japonicum OX=6182 GN=EWB00_004230 PE=3 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 8.305e-59
Identity = 154/488 (31.56%), Postives = 245/488 (50.20%), Query Frame = 2
Query:  167 IVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIHFF-KNKGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDC----GFNISRYSSPDFFNCYTIN-IRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCA---DFKNISEEGFEYFLKKGKCIVKVLNEDQRLTSSDXXXXXXXXXXXXSLQISNIVWEPNLWQLEWLLTLHQSWNVLIE-----PPANDTIVRSAKAEA--LKFLNANELKDLTDVHENSPFHKN--------------------ESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCA 1522
            ++ ++L ++ ++ T+L +++ SPFPA+T+C   PFS  A   + ++K +SP  ++  +R+   + L K+    A SI  YD L VYYQNL Y +S  +G     IF+ C   +RI   I     +C    G+ I R S   + NCYT   I    + +T ++ LI+    P + +   + + L  +F+   G ++ IHE G+ P   K  IHVEP +L +INY  I+WK  NTP   CIQ +++  + +DL  +Y+++   CL  ++   ++  CHC+    PR I+P++  PYC     + N SE     F++K  C+ K LN   +       CF +CE   +    S   W    WQL WL   +Q+   L+      P  N T+  + K     L + +   L   +D+ +N  FH N                    E +A VI++R S+ T    E+L LS+Y L+SRIGG C+L +GLT A
Sbjct:   33 LIKDFLNYDVSVHTQLIMDNPSPFPALTVCHQPPFSYEAYKLWNESKILSPSQYNLYMRKLILNALHKNDIDSASSIWSYDSLSVYYQNLDYKESLNLG-HSPTIFLNC---MRIFSHISAFEDNCTLLSGYRIRRLSHHQYLNCYTFEPINMNAANETTFLSLIVGM-GPRDKDINLQQAFLPDVFEQARGLRVVIHEAGTMPDLEKNGIHVEPGKLNEINYEPIHWKRLNTPKRPCIQPNES-HQYLDLGVKYNYTHTQCLLVHQQIEIMNNCHCIYVMHPRLILPNKNLPYCGRLWPYLNQSE-----FIEKILCLNKYLNNSIKQKYDGYTCFPRCEFYDYESTTSVTKWRAYPWQLYWLRVQNQATQWLLNYHEKFPQHNITMTAAYKLWQFYLHYHDLTHLPRKSDLLKN--FHSNYTDIISLLPSWPPENLDLDSEDFAYVILKRKSHSTIEKTEKLVLSLYVLISRIGGLCSLTIGLTAA 507          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A267DCW3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012953g2 PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.252e-58
Identity = 156/530 (29.43%), Postives = 257/530 (48.49%), Query Frame = 2
Query:   41 FFTNCSIRGVAKAYKTSSXXXXXXXXXXXXXXXXXXXYSIIKIVIEYLEFNTTIQTRLQLEDSS-PFPAITICPYQPFSDRAIHFFKN-KGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQ-ESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLTSSDXXXXXXXXXXXXSLQISNIVWEPNLWQLEWLLTLHQSWNVLIE----------PP-----------------------ANDTIVRSAKAEALKFLNANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCA 1522
            F ++ S+RG  +  K  +  ++ +W  ++ +M   L+  +  I  +YL++ T IQT + L D +   PA+TIC + PFS  A   + + + +SP +FS +LRRTA           AE++L  D  +VYYQ+L++ND+  +     ++F++C+  +   + I + + DC   + R S P +FNCY +    +  RD +++ L+L+       E   E + ++ +F+   G ++ +HE  + P  T + IHVEP +L++I+Y+   W E ++P D C+  E+ +  K+ DLD E+++S+++CL     K  LERC C      RS +P+   PYC D    +  G    L    C+ ++  + +R   S   C   C    F    S  VW    WQL WL+   + +  L E          PP                       AN T   SA      F  + E K  T + +  P   + ++A V I R S  T    E L L +  L+S+IGG  +L+LGLTCA
Sbjct:   10 FCSSTSLRGAGRLVKAPTRHLRAIWAGYLCLMAAALIACVCFIAKDYLQYKTIIQTTIVLNDPTIAIPAVTICSHYPFSKTAATLWSSGRVLSPTNFSHELRRTAFQLFNSSEFLMAENVLASDTKKVYYQSLEHNDAVNLSFSVPQLFIFCVTGVGPFVEISNWK-DCSLLLKRVSLPSYFNCYQV----QAPRDIDWLTLVLRVSSAVPNEY--EEAFVQDIFEQADGIRLEVHENDTYPEPTLKGIHVEPGKLVEISYKTERWAEVDSPADACMSAEAASQRKIRDLDEEFAYSYEACLRQELGKLALERCGCHYVKYLRSSVPNGSHPYCGD----TRIGMRKMLANIDCLNRLNLDSERERLSRSVCLMPCHFHYFDTVASKTVWRATQWQLHWLMQHSRCFRDLDEASKRLEMGGLPPDEERRLREKLEQASVTMKTFFETANITKAASADGGTNGFDESAEEKQQT-LDQVMP-KDDTNFAYVTIRRQSRNTVQKTEILSLGLSALMSQIGGLSSLFLGLTCA 526          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A074ZXV4 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_01690 PE=3 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 2.204e-58
Identity = 156/523 (29.83%), Postives = 274/523 (52.39%), Query Frame = 2
Query:   29 NMEIFFTNCSIRGVAKAYKTSSXXXXXXXXXXXXXXXXXXXYSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIHFFKNKG-MSPKDFSFKLRRTAKSFLEKDSPKKAESIL--------FYDDLRVYYQNLKYNDSTYIGLDESEIFVYCI-----NKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLE-RFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLT---SSDXXXXXXXXXXXXSLQISNIVWEPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEALK-FLNANELK------DLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCA 1522
            N+ +F  + SIRG  +  +  S+ I+LLWI F++     L+ S+ +IV EYL ++  I+T  +++  + FP++T C +QPFS++A   +++   +SP  F+  LR+ A+  ++ +S   +E +L         +D +++YYQNL + D   +G   ++    C+      +L +G   G    D   +I   S P  +NCYT++I    SR  + + LI+    P N + R+R+ + L+ +F+   G ++ IHE G      +  I +EP R+ +IN+  I  + Q TP   CIQ+ K  ++  DLD EY + F+ CLDS   + ++ERC CV A+LPR +IP+   PYC      ++   +    + +C+  V+ +  +L     ++ KC ++C+  ++  ++S   W    WQL W     ++ N L E  A+      A  + L  +L    L       D+T       +  ++ +  ++I+R  N+T   +E L L++  LVSRIGG C+LY+G+T A
Sbjct:   29 NISLFLESISIRGCNRIVRAQSMFIRLLWICFLICTTVFLIVSVRRIVKEYLLYSVNIETEERMDAPTEFPSVTFCNHQPFSEKAYELWRSGSVISPTQFNRILRQKAEELVDNNSGNISEHLLQMVAHYSIVFDTIKMYYQNLDWPDQKRLGHQRNQSIYMCLIRFSGEELLLG---GPGCYDEMIHIKERSHPHHYNCYTVDINIYLSRRVQELGLIVWLGPPENYDIRYRQ-AFLQDVFEQAHGLRVAIHEPGQLVNLDRLGIQIEPGRMNEINFEVIRKEHQQTPRKPCIQDPK--DQYRDLDGEYDYEFELCLDSLIQQIVIERCSCVYAYLPRIVIPNATLPYCGRLLRNNQLDAQGLFDRKECVRHVVQQFAKLRKQFEAEGKCLRRCQTLEYDKRVSVTTWRATQWQLYW---SQETANALEEIMASSPNFTKASVDRLTVYLKTANLSTAFNAPDVTHKGITRKYGFSDRHTYLLIKRKRNDTVVRKETLVLTLDALVSRIGGLCSLYIGMTFA 542          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4S2LIB5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007029 PE=3 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 2.750e-58
Identity = 159/536 (29.66%), Postives = 278/536 (51.87%), Query Frame = 2
Query:    2 KKTRGNSIS----NMEIFFTNCSIRGVAKAYKTSSXXXXXXXXXXXXXXXXXXXYSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIHFFKNKG-MSPKDFSFKLRRTAKSFLEKDSPKKAESIL--------FYDDLRVYYQNLKYNDSTYIGLDESEIFVYCI-----NKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLE-RFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLT---SSDXXXXXXXXXXXXSLQISNIVWEPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEA----LKFLNANELKDLTDVHENSPFHK---NESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCA 1522
            ++TRG  +     N+ +F  + SIRG  +  +  S+ I+LLWI F++     L+ S+ +IV EYL ++  I+T  +++  + FP++T C +QPFS++A   +++   +SP  F+  LR+ A+  ++ +S    E +L         +D +++YYQNL + D   +G   ++    C+      +L +G   G    D   +I   S P  +NCYT++I    SR  + + LI+    P N + R+R+ + L+ +F+   G ++ IHE G      +  I +EP R+ +IN+  I  + Q TP   CIQ+ K   +  DLD EY + F+ CLDS   + ++ERC CV A+LPR +IP+   PYC      ++   +    + +C+  V+ +  +L     ++ KC ++C+  ++  ++S   W    WQL W     ++ N L +  A+      A  +     LK  N +   +  DV       K   ++ +  ++I+R  N+T   +E L L++  LVSRIGG C+LY+G+T A
Sbjct:   17 RRTRGKVLQKISENVSLFLESISIRGCNRIVRAQSMFIRLLWICFLICTTVFLIVSVRRIVKEYLLYSVNIETEERMDAPTEFPSVTFCNHQPFSEKAYELWRSGSVISPTQFNRILRQKAEELVDNNSGNINEHLLQMVAHYSIVFDTIKMYYQNLDWPDQKRLGHQRNQSIYMCLIRFSGEELLLG---GPGCYDEMIHIKERSHPHHYNCYTVDINIYLSRRVQELGLIVWLGPPENYDIRYRQ-AFLQDVFEQAHGLRVAIHEPGQLVNLDRLGIQIEPGRMNEINFEVIRKEHQQTPRKPCIQDPKN--RYRDLDGEYDYEFELCLDSLIQQIVIERCSCVYAYLPRIVIPNATLPYCGRLLRNNQLDAQGLFDRKECVRHVVQQFAKLRKQFEAEGKCLRRCQTLEYDKRVSVTTWRATQWQLYW---SQETANALEQIMASSPNFTKASVDRLIVYLKTANLSTAFNAPDVAHKGITRKYGFSDRHTYLLIKRKRNDTVVRKETLVLTLDALVSRIGGLCSLYIGMTFA 543          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000053382.1 (SMESG000053382.1)

HSP 1 Score: 1031.17 bits (2665), Expect = 0.000e+0
Identity = 549/552 (99.46%), Postives = 551/552 (99.82%), Query Frame = 2
Query:    2 KKTRGNSISNMEIFFTNCSIRGVAKAYKTSSXXXXXXXXXXXXXXXXXXXYSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIHFFKNKGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLTSSDXXXXXXXXXXXXSLQISNIVWEPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEALKFLNANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCAXXXXXXXXXXXXWKRQCKEKISSNGPNPCTLDHNNTSLEIQKELI 1657
            KKTRGNS+SNMEIFFTNCSIRGVAKAYKTSSLIIKLLWIIFIMIMMTLLLYSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAI FFKNKGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLTSSDKKC+KKCEEQKFSLQISNIVWEPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEALKFLNANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCAFFIEIIEYLIILWKRQCKEKISSNGPNPCTLDHNNTSLEIQKELI
Sbjct:    3 KKTRGNSVSNMEIFFTNCSIRGVAKAYKTSSLIIKLLWIIFIMIMMTLLLYSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIRFFKNKGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLTSSDKKCYKKCEEQKFSLQISNIVWEPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEALKFLNANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCAFFIEIIEYLIILWKRQCKEKISSNGPNPCTLDHNNTSLEIQKELI 554          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000053390.1 (SMESG000053390.1)

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 339/507 (66.86%), Postives = 421/507 (83.04%), Query Frame = 2
Query:    2 KKTRGNSISNMEIFFTNCSIRGVAKAYKTSSXXXXXXXXXXXXXXXXXXXYSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIHFFKNKGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLTSSDXXXXXXXXXXXXSLQISNIVWEPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEALKFLNANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCA 1522
            K+   N  S++  FFTNCS+RGV+KAYK+ SLIIKLLW+IFI +MM L+LYSIIKI+ EY+E+NTT+Q  LQ ED+S FPAITICP+QPF  R+I FFKNKGMSPKDFS KLR+ AK+FLEK +P KAE+ILFYD+LR YYQNLKYN+STYIGL E EIFVYCI KL+  M +G+V  +CG+ ISRYSSPDFFNCYT+N+RPEY ++TEY+ LIL+F KP NL ++ E S L+TL ++ IGAQ+ IHE+GSSPTSTKEKIH+EPNR+LQINYRN+ WKE +TP DVC+ + + L K+IDL+N Y+F+FQ CL+SY AK +LE+C C+MAF PRS+IPSE+FPYCADF NI+EEGFE F+    CI KVLN+DQ+L+SSDKKCFK CEEQKF+LQISNI WEP+LWQLEWL  L +SWN+LI+ P N T+   AK  A+KFL+A  L +L+  ++NS F+ +E YACV++ERLSNET+Y EE+LGLSM+GL+SRIG SCTLYLGLTCA
Sbjct:    2 KRHLKNRESHLGTFFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCA 508          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000053391.1 (SMESG000053391.1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 328/499 (65.73%), Postives = 410/499 (82.16%), Query Frame = 2
Query:  152 YSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIHFFKNKGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLTSSDXXXXXXXXXXXXSLQISNIVWEPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEALKFLNANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCAXXXXXXXXXXXXWKRQCK----------EKISSNGP--NPCT 1612
            YSI+KI+ EYLE+NTTIQT+LQLED+SPFPAITICPYQPFS+RA+ +F+NKGMSPK+FS+KLR++AK +LEKD P  AESILFYDDLR+YYQNLKY +STYIGL++ E+FV+CI KL IGMF G+VR +CG+NI+R+SSPDFFNCYTIN++PEYS +TEY+HLIL+F KP NLE F++ SLLK+L  ++IGAQ+ +HE GSSP ST+EKIH+EPNRLLQINY N  WKE +TP D+C+ ESK  EK+ DLDNEYSF+FQ CLDS KAK +LE+C CVMAFLPR +IPSE++PYCA+F+N+S+E F+ F K+G+CI + L +D+ L +  K C+K C  QKF+LQISNI W P LWQLEWL  L QSWNVLI+ P N +IV  AKA+AL+FLNA ++ +L   +ENS F K+E YACV++ERLSNETFY EE+LGLS+YGLVSRIGGSCTLYLGLTCAFFIEI+E++I+LW  Q            +KI+ N P   PC+
Sbjct:    7 YSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNKGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQKISLLKSLSLNIIGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMYKNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPKNRSIVEKAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCAFFIEILEFIIVLWTEQSHKREIRKEVEVDKIALNQPPIGPCS 505          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000062815.1 (SMESG000062815.1)

HSP 1 Score: 215.312 bits (547), Expect = 2.754e-61
Identity = 167/525 (31.81%), Postives = 263/525 (50.10%), Query Frame = 2
Query:   41 FFTNCSIRGVAKAYKTSSXXXXXXXXXXXXXXXXXXXYSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIHFFK-NKGMSPKDFSFKLRRTA-KSFLE----KDSPKKAE--SILFY----DDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYR---NINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLTS---SDXXXXXXXXXXXXSLQISNIVWEPNLWQLEWLLTLHQSW----NVL---IEPPANDT------IVRSAKAEALKFLNANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCA 1522
            FF N SIRG ++  K+ +  ++ LWI+F++  +T L+ SI K+VI+Y +++  IQT +Q+++++PFPA+T C +QPFS+RA   ++ +K MSP  F+   R  A K F +    K +PK ++    LF     D L VYYQNL    S+ +G + S I   C+      M   +   D    +   S P +FNC+T+   P+Y+     + LI+                L  +F+   G ++ IHE  S P    E + +EP RL ++NY+   NI    +  P   CI E   + +  DLDN + +    C +    + ++  C C+  + PR + PS+  PYC     +  E +   L +  CI K+ NE   + S   +DKKC   C   +++   S   W P  WQL WL  +  +W    N++   I  P+N+       ++++  +    F     L +     E   F  NE Y  V+++R +N TF  EERL LS   LVSR+GG C+LY+GLT A
Sbjct:   20 FFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNIS-IIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKP---CINEPDRIYR--DLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCG---YLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLF--NERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFA 533          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000039581.1 (SMESG000039581.1)

HSP 1 Score: 209.92 bits (533), Expect = 3.569e-59
Identity = 134/460 (29.13%), Postives = 232/460 (50.43%), Query Frame = 2
Query:  167 IVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIHFFK-NKGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCG----FNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKV---LNEDQRLTSSDXXXXXXXXXXXXSLQISNIVWEPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEALKFLNANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCA 1522
            +V +++ ++  I   ++L   +PFP+ITIC + PFS  A  +++ NK +SP  F+ K+R    S L  +   +AE I  YD + VYYQN+ YNDS  IG  + +IF+ C+  LR  M       +C     + +  +S  + FNCYT   + +       + +I+    P +     +  ++ T F+   G ++ +HE G  P      +HVEP +L +I+YR + WK +NTPT  C  + K  E+  DL+  Y+++   CL S + K +++ CHC+  + PR  IP+++ PYC +F  + +        + +C+  +   +N  ++L S            + S+ I+   W    W L W+     ++  L   P  +    +   + LK+ NA  L  + D      F  N+++A +++ R S+ +    ERL +S Y LVSRIGG C+  +G+T +
Sbjct:  123 LVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSMEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIG-HQKDIFLSCM-LLRNNMI--SYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVD---KITTLGIIVSMGPPPDYSATEQAFIVDT-FRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKK-ERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLQIPTKKLPYCGNF--LEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITK--WRATEWHLHWIRLQLLTFRQLKNNPQINATESTYFKQWLKYWNATNLT-VIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITAS 568          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP3.697e-1022.30FMRFamide-activated amiloride-sensitive sodium cha... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H6N95.797e-5928.65Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4Z2D6C68.305e-5931.56FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A267DCW31.252e-5829.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A074ZXV42.204e-5829.83Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2LIB52.750e-5829.66Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053382.10.000e+099.46SMESG000053382.1[more]
SMESG000053390.10.000e+066.86SMESG000053390.1[more]
SMESG000053391.10.000e+065.73SMESG000053391.1[more]
SMESG000062815.12.754e-6131.81SMESG000062815.1[more]
SMESG000039581.13.569e-5929.13SMESG000039581.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004492 ID=SMED30004492|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1837bp
TAAAAAGACAAGGGGAAATAGTATATCAAATATGGAAATATTTTTCACAA
ATTGTTCCATAAGAGGAGTTGCAAAAGCCTACAAAACGAGTTCTTTAATT
ATAAAGTTACTTTGGATAATATTTATAATGATAATGATGACACTTTTATT
GTATTCAATCATCAAAATTGTCATAGAGTACCTAGAATTCAATACAACTA
TACAAACTAGATTACAGCTGGAAGACTCATCTCCTTTTCCGGCGATCACG
ATTTGTCCGTATCAACCGTTTTCGGATAGAGCAATCCACTTTTTTAAGAA
TAAAGGAATGTCACCGAAGGACTTCAGTTTCAAATTGAGAAGAACCGCAA
AGTCGTTTCTTGAAAAGGACTCACCAAAAAAAGCAGAATCTATTTTATTT
TATGATGATCTCAGAGTTTATTATCAAAATCTCAAATACAATGATTCGAC
TTACATAGGTCTAGATGAGAGTGAGATATTCGTTTATTGCATTAACAAGC
TGCGAATCGGAATGTTTATTGGTGATGTGAGGTCGGATTGCGGTTTCAAT
ATTTCCCGATATAGCAGTCCAGACTTCTTCAATTGTTACACAATAAATAT
CAGGCCTGAATATTCTCGCGATACAGAATATGTGCACCTAATTTTGAAGT
TTTTCAAGCCAACGAACTTAGAAAGGTTTCGGGAGACGTCTCTGTTAAAA
ACTCTATTTCAACATGTAATAGGCGCTCAAATCACAATCCACGAAACGGG
TAGTTCTCCAACAAGTACTAAAGAAAAGATACATGTTGAGCCTAATAGGC
TTTTACAAATCAATTATAGGAATATTAATTGGAAGGAACAAAATACCCCA
ACGGATGTATGTATACAAGAAAGTAAAACCCTTGAAAAATTAATAGATTT
AGACAATGAATATTCCTTCTCATTTCAAAGTTGTTTAGACTCGTATAAAG
CAAAGAATTTATTGGAAAGATGTCATTGTGTAATGGCCTTTCTTCCAAGA
TCAATTATACCCTCGGAAAGGTTCCCATATTGTGCTGATTTTAAAAATAT
AAGTGAAGAAGGGTTTGAGTATTTTTTGAAAAAAGGTAAATGCATTGTGA
AGGTACTCAATGAAGATCAAAGGCTTACTAGTTCGGATAAGAAATGTTTC
AAGAAATGCGAAGAACAAAAGTTTAGCTTACAAATTTCAAATATTGTTTG
GGAACCAAATCTTTGGCAACTCGAATGGCTATTGACATTGCATCAGTCAT
GGAATGTTTTAATTGAACCTCCAGCAAATGATACTATTGTTCGATCGGCA
AAGGCAGAGGCTTTAAAATTTTTGAATGCCAACGAACTTAAGGATCTAAC
TGACGTTCATGAAAATTCTCCATTTCATAAAAATGAAAGCTACGCTTGTG
TCATTATAGAGAGATTGTCTAATGAGACATTTTATAATGAAGAAAGATTA
GGTTTGAGCATGTATGGATTGGTGAGTAGAATTGGTGGATCCTGCACTTT
ATATCTGGGCTTGACATGCGCATTTTTTATAGAAATAATTGAATATTTAA
TCATTCTATGGAAAAGACAGTGTAAAGAGAAAATATCTTCTAATGGTCCG
AATCCATGTACTCTTGACCACAACAATACGTCCCTCGAAATTCAAAAAGA
ACTGATTTAAGTATTTTTAAATCGTTTTAAATATAAATAGAAATAACAAT
TATTTTAAAAATTTTTCATCTGAATAAAAACAAATTTTTAATTTTTCCTG
CTAACAAATTTTATTCAATATATTATTTTATTCAAATATTATATTATTGC
ACAAAAATATCGTGAAACCTTTTATCTTTTTCGCAAT
back to top

protein sequence of SMED30004492-orf-1

>SMED30004492-orf-1 ID=SMED30004492-orf-1|Name=SMED30004492-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=553bp
KKTRGNSISNMEIFFTNCSIRGVAKAYKTSSLIIKLLWIIFIMIMMTLLL
YSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIHFFKN
KGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDST
YIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINI
RPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETG
SSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDL
DNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNI
SEEGFEYFLKKGKCIVKVLNEDQRLTSSDKKCFKKCEEQKFSLQISNIVW
EPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEALKFLNANELKDLT
DVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTL
YLGLTCAFFIEIIEYLIILWKRQCKEKISSNGPNPCTLDHNNTSLEIQKE
LI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 75..91
score: 41.88
coord: 183..199
score: 35.53
coord: 382..402
score: 24.19
coord: 35..52
score: 16.67
coord: 241..259
score: 23.58
coord: 317..334
score: 22.44
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 14..515
e-value: 3.9E-50
score: 171.1
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 10..528
NoneNo IPR availablePANTHERPTHR11690:SF222PICKPOCKET 6-RELATEDcoord: 10..528
NoneNo IPR availableTMHMMTMhelixcoord: 32..54
NoneNo IPR availableTMHMMTMhelixcoord: 497..519