Tyrosine phosphatase domain-containing protein 1

Overview
NameTyrosine phosphatase domain-containing protein 1
Smed IDSMED30004467
Length (bp)1774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine phosphatase domain-containing protein 1 (SMED30004467) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine phosphatase domain-containing protein 1 (SMED30004467) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine phosphatase domain-containing protein 1 (SMED30004467) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine phosphatase domain-containing protein 1 (SMED30004467) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004467

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004467SMESG000055316.1 SMESG000054364.1 SmedASXL_010603SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30004467SMESG000055316.1 SMESG000054364.1 dd_Smed_v4_13749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004467SMESG000055316.1 SMESG000054364.1 dd_Smed_v6_13749_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30004467SMESG000055316.1 SMESG000054364.1 dd_Smed_v4_13749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004467SMESG000055316.1 SMESG000054364.1 dd_Smed_v4_13749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Human
Match: PTPDC1 (protein tyrosine phosphatase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30184])

HSP 1 Score: 229.18 bits (583), Expect = 2.282e-65
Identity = 112/249 (44.98%), Postives = 165/249 (66.27%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLD-PSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC 946
            ++I G   C + CG R CKY  P +R+  ++ A+KG+YS+W+TDNILAMARPS+E + +Y II+QF +H IKT+IN+Q  GEH+ CG PL+  SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   L  GK+A+HCHAG GRTG++IACYL+F  R++  QAI +VR KR  SIQ + Q   V  F ++L PL  +F          ++ + ++RQ+ ++HG E+ +L++VPKII  VC
Sbjct:   46 HVIPGHMACSMACGGRACKYENP-ARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLTPLRNIFSCCDPKAHAVTLPQYLIRQRHLLHGYEARLLKHVPKIIHLVC 293          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Human
Match: PTPDC1 (protein tyrosine phosphatase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30184])

HSP 1 Score: 229.18 bits (583), Expect = 2.282e-65
Identity = 112/249 (44.98%), Postives = 165/249 (66.27%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLD-PSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC 946
            ++I G   C + CG R CKY  P +R+  ++ A+KG+YS+W+TDNILAMARPS+E + +Y II+QF +H IKT+IN+Q  GEH+ CG PL+  SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   L  GK+A+HCHAG GRTG++IACYL+F  R++  QAI +VR KR  SIQ + Q   V  F ++L PL  +F          ++ + ++RQ+ ++HG E+ +L++VPKII  VC
Sbjct:   46 HVIPGHMACSMACGGRACKYENP-ARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLTPLRNIFSCCDPKAHAVTLPQYLIRQRHLLHGYEARLLKHVPKIIHLVC 293          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Human
Match: PTPDC1 (protein tyrosine phosphatase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30184])

HSP 1 Score: 229.565 bits (584), Expect = 2.966e-65
Identity = 112/249 (44.98%), Postives = 165/249 (66.27%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLD-PSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC 946
            ++I G   C + CG R CKY  P +R+  ++ A+KG+YS+W+TDNILAMARPS+E + +Y II+QF +H IKT+IN+Q  GEH+ CG PL+  SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   L  GK+A+HCHAG GRTG++IACYL+F  R++  QAI +VR KR  SIQ + Q   V  F ++L PL  +F          ++ + ++RQ+ ++HG E+ +L++VPKII  VC
Sbjct:   98 HVIPGHMACSMACGGRACKYENP-ARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLTPLRNIFSCCDPKAHAVTLPQYLIRQRHLLHGYEARLLKHVPKIIHLVC 345          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Human
Match: PTPDC1 (protein tyrosine phosphatase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30184])

HSP 1 Score: 229.565 bits (584), Expect = 3.576e-65
Identity = 112/249 (44.98%), Postives = 165/249 (66.27%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLD-PSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC 946
            ++I G   C + CG R CKY  P +R+  ++ A+KG+YS+W+TDNILAMARPS+E + +Y II+QF +H IKT+IN+Q  GEH+ CG PL+  SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   L  GK+A+HCHAG GRTG++IACYL+F  R++  QAI +VR KR  SIQ + Q   V  F ++L PL  +F          ++ + ++RQ+ ++HG E+ +L++VPKII  VC
Sbjct:  100 HVIPGHMACSMACGGRACKYENP-ARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLTPLRNIFSCCDPKAHAVTLPQYLIRQRHLLHGYEARLLKHVPKIIHLVC 347          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Human
Match: CDC14B (cell division cycle 14B [Source:HGNC Symbol;Acc:HGNC:1719])

HSP 1 Score: 65.4698 bits (158), Expect = 1.413e-10
Identity = 45/127 (35.43%), Postives = 63/127 (49.61%), Query Frame = 2
Query:  392 INQFKNHKIKTVI--NMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALP----VQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            I  FKNH + T+I  N +M                 YD K+  D G DH +    D G+ P    V+   DI +  +     G IAVHC AG GRTG +IACY++ + R++  + I +VR  R GS+
Sbjct:  244 IQYFKNHNVTTIIRLNKRM-----------------YDAKRFTDAGFDHHDLFFAD-GSTPTDAIVKEFLDICENAE-----GAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSV 347          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Celegans
Match: T12B3.1 (pep chromosome:WBcel235:IV:7382415:7384752:1 gene:WBGene00020444.1 transcript:T12B3.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T12B3.1)

HSP 1 Score: 194.897 bits (494), Expect = 1.310e-55
Identity = 106/264 (40.15%), Postives = 158/264 (59.85%), Query Frame = 2
Query:  173 KSSEAITVSAKPNIIS---GDGFCQLFC-GRECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLR 952
            + + A   S +  I+S   GD  C+L+C G  C++C  ++    E  A+ GLYSTWIT +ILAMAR   E+     I+ +FK + I++VIN+Q  GEHSFCG     SGFSYDP+ LM NGI H N+P  D+ A     + DI+K +   L+ GKIAVHCHAGHGRTGMVIA ++++   +S  QA++ VR +R  ++Q+K Q +T+  F   ++    +   K++      I E V   +K +   ES +   +PKI+++ +R
Sbjct:   19 EKASATYSSLRTGILSLTPGDQKCRLYCSGPRCRFCIVVTG-QTEIQAIDGLYSTWITSDILAMARLQVEHFDSLGIVEKFKTNGIQSVINLQESGEHSFCGSGNLTSGFSYDPENLMRNGIYHYNFPLPDFQACTPNRLLDIVKVVDFALSHGKIAVHCHAGHGRTGMVIAAWMMYALGMSPSQAVDTVRSRRAKAVQSKEQVKTLHEFRLLIRNNGGMIIPKNKMT---HISEYVAYNQKFISKPESRLYGKIPKIVYIAMR 278          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 54.299 bits (129), Expect = 1.885e-7
Identity = 39/156 (25.00%), Postives = 69/156 (44.23%), Query Frame = 2
Query:  311 GLYSTWITDNILAMARPSNE--------YIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            G ++  I   IL+   P NE        Y       + F+ +K+ T++ +               +  +YD  K    G DH++    D      + M   +K + +  T G +AVHC AG GRTG +IAC+++    ++  + + ++R  R GS+
Sbjct:  195 GDFNWIIPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRL---------------NAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDN--TKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSV 333          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 54.299 bits (129), Expect = 1.934e-7
Identity = 39/156 (25.00%), Postives = 69/156 (44.23%), Query Frame = 2
Query:  311 GLYSTWITDNILAMARPSNE--------YIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            G ++  I   IL+   P NE        Y       + F+ +K+ T++ +               +  +YD  K    G DH++    D      + M   +K + +  T G +AVHC AG GRTG +IAC+++    ++  + + ++R  R GS+
Sbjct:  195 GDFNWIIPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRL---------------NAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDN--TKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSV 333          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 54.299 bits (129), Expect = 2.017e-7
Identity = 38/150 (25.33%), Postives = 66/150 (44.00%), Query Frame = 2
Query:  329 ITDNILAMARPSNE--------YIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            I   IL+   P NE        Y       + F+ +K+ T++ +               +  +YD  K    G DH++    D      + M   +K + +  T G +AVHC AG GRTG +IAC+++    ++  + + ++R  R GS+
Sbjct:  201 IPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRL---------------NAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDN--TKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSV 333          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 54.299 bits (129), Expect = 2.017e-7
Identity = 38/150 (25.33%), Postives = 66/150 (44.00%), Query Frame = 2
Query:  329 ITDNILAMARPSNE--------YIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            I   IL+   P NE        Y       + F+ +K+ T++ +               +  +YD  K    G DH++    D      + M   +K + +  T G +AVHC AG GRTG +IAC+++    ++  + + ++R  R GS+
Sbjct:  201 IPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRL---------------NAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDN--TKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSV 333          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Zebrafish
Match: ptpdc1a (protein tyrosine phosphatase domain containing 1a [Source:NCBI gene;Acc:565773])

HSP 1 Score: 226.868 bits (577), Expect = 4.739e-65
Identity = 117/267 (43.82%), Postives = 172/267 (64.42%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIG---QTIEDDSL 994
            ++I G   C + CG R CKY  P SR+  ++ A+KGLYS+WITD++LAMARPS E + +++II QF    +KTVIN+Q  GEH+ CG  L+P SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   +  GKIAVHCHAG GRTG++IAC+L+F +R+S  QAI +VR KR  SIQ + Q   V  FA++L PL +VF        + ++ + + RQ+ ++HG E+  ++ +PKII +  R L  I    QT+E++ L
Sbjct:   44 HVIPGHMQCSMACGGRACKYENP-SRWSDKEQAVKGLYSSWITDHLLAMARPSTEIVEKFNIIEQFHVCGLKTVINLQRPGEHASCGSTLEPESGFTYRPELFMEAGIYFYNFGWKDYGVASLTTILDMVKVMSFAMQEGKIAVHCHAGLGRTGVLIACFLVFTSRMSADQAILFVRAKRPNSIQTRGQLLCVREFAQFLVPLRSVFSCAEPKAHEVTLSQYLTRQRHLLHGYEARHMKNMPKIIHLICRLLLDIAENRQTVEEEVL 309          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Zebrafish
Match: ptpdc1b (protein tyrosine phosphatase domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-090312-138])

HSP 1 Score: 223.016 bits (567), Expect = 5.315e-64
Identity = 115/265 (43.40%), Postives = 170/265 (64.15%), Query Frame = 2
Query:  233 CQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIG---QTIEDD--SLFDIT 1006
            C + CG + CKY  P S +  E+ A++G+YS+WITD++LAMARPS E I +++II+QF    +KT+IN+Q  GEH+ CG PLDP SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   +  GK+AVHCHAG GRTG+++ACYL+F  +++  QAI  +R KR  SIQ + Q + V  FA++L PL  +F          ++ + ++RQK I+HG E+  LRY+PK++ +  R L  I    Q IE+D   + DIT
Sbjct:   31 CSMGCGGQACKYEDP-SHWSEEQQAIRGIYSSWITDDMLAMARPSTETIEKFNIIDQFLRCGLKTIINLQCPGEHASCGNPLDPDSGFTYRPETFMEAGIYFYNFRWIDYGVASLTSILDMVKVMSFAIQEGKMAVHCHAGLGRTGVLLACYLLFTTQMTADQAILLIRNKRPNSIQTRGQLQCVRQFAQFLVPLRNLFANAEPRAPAVTLSQFLIRQKHILHGLEARQLRYMPKLVPLISRLLLDIAENRQVIEEDIVEVPDIT 294          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Zebrafish
Match: zgc:77752 (zgc:77752 [Source:ZFIN;Acc:ZDB-GENE-040426-1867])

HSP 1 Score: 218.009 bits (554), Expect = 8.254e-64
Identity = 110/261 (42.15%), Postives = 167/261 (63.98%), Query Frame = 2
Query:  170 NKSSEAITVSAKPNIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVF-WIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFV 943
            +++ E++  +  P II     C L CG R+C+Y  P   +   + A+KG++S+W+TD+ILAMARPS   + +Y II QFK   IK++INMQ+ GEH+ CG PL+P SGF+Y P+  MDN I   N+   D+G   ++ M D +K +   +  GK+AVHCHAG GRTG++IACYL++  RIS  +A++YVR KR  SIQ + Q   V  FA+ L      F  + ++  + FS+++ ++RQ  ++HG E+  L++ PKI+ V
Sbjct:   13 SQARESLVKAVPPKII-----CLLACGGRDCRYEGPAC-WSTNQQAIKGIFSSWVTDDILAMARPSTYLMKRYSIIEQFKQLNIKSIINMQLPGEHAHCGPPLEPDSGFTYSPQSFMDNQIFFYNFGMSDFGVSSLEGMLDAVKVLAFSVQEGKVAVHCHAGLGRTGVLIACYLVYTCRISASEAVHYVRIKRPRSIQTRSQINLVFDFARLLGSQLAQFPSLNTRHCATFSLRQYLLRQALLLHGDEARTLKHTPKILHV 267          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Zebrafish
Match: BX571879.2 (pep chromosome:GRCz11:CHR_ALT_CTG18_1_3:7591744:7600733:1 gene:ENSDARG00000112511.1 transcript:ENSDART00000190620.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX571879.2)

HSP 1 Score: 216.468 bits (550), Expect = 2.539e-63
Identity = 110/261 (42.15%), Postives = 167/261 (63.98%), Query Frame = 2
Query:  170 NKSSEAITVSAKPNIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVF-WIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFV 943
            +++ E++  +  P II     C L CG R+C+Y  P   +   + A+KG++S+W+TD+ILAMARPS   + +Y II QFK   IK++INMQ+ GEH+ CG PL+P SGF+Y P+  MDN I   N+   D+G   ++ M D +K +   +  GK+AVHCHAG GRTG++IACYL++  RIS  +A++YVR KR  SIQ + Q   V  FA+ L      F  + ++  + FS+++ ++RQ  ++HG E+  L++ PKI+ V
Sbjct:   13 SQARESLVKAVPPKII-----CLLACGGRDCRYEGPAC-WSTNQQAIKGIFSSWVTDDILAMARPSTYLMKRYSIIEQFKQLNIKSIINMQLPGEHAHCGPPLEPDSGFTYSPQIFMDNQIFFYNFGMSDFGVSSLEGMLDAVKVLAFSVQEGKVAVHCHAGLGRTGVLIACYLVYTCRISASEAVHYVRIKRPRSIQTRSQINLVFDFARLLGSQLAQFPSLNTRHCATFSLRQYLLRQALLLHGDEARTLKHTPKILHV 267          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Zebrafish
Match: zgc:77752 (zgc:77752 [Source:ZFIN;Acc:ZDB-GENE-040426-1867])

HSP 1 Score: 219.935 bits (559), Expect = 3.846e-63
Identity = 110/261 (42.15%), Postives = 167/261 (63.98%), Query Frame = 2
Query:  170 NKSSEAITVSAKPNIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVF-WIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFV 943
            +++ E++  +  P II     C L CG R+C+Y  P   +   + A+KG++S+W+TD+ILAMARPS   + +Y II QFK   IK++INMQ+ GEH+ CG PL+P SGF+Y P+  MDN I   N+   D+G   ++ M D +K +   +  GK+AVHCHAG GRTG++IACYL++  RIS  +A++YVR KR  SIQ + Q   V  FA+ L      F  + ++  + FS+++ ++RQ  ++HG E+  L++ PKI+ V
Sbjct:   13 SQARESLVKAVPPKII-----CLLACGGRDCRYEGPAC-WSTNQQAIKGIFSSWVTDDILAMARPSTYLMKRYSIIEQFKQLNIKSIINMQLPGEHAHCGPPLEPDSGFTYSPQSFMDNQIFFYNFGMSDFGVSSLEGMLDAVKVLAFSVQEGKVAVHCHAGLGRTGVLIACYLVYTCRISASEAVHYVRIKRPRSIQTRSQINLVFDFARLLGSQLAQFPSLNTRHCATFSLRQYLLRQALLLHGDEARTLKHTPKILHV 267          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Xenopus
Match: PTPDC1 (protein tyrosine phosphatase domain containing 1 [Source:NCBI gene;Acc:100490857])

HSP 1 Score: 235.728 bits (600), Expect = 3.299e-68
Identity = 121/267 (45.32%), Postives = 175/267 (65.54%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC--LRKLSQIGQTIEDDSL 994
            ++I G   C + CG R CKY  P +R+  E+ A+KGLYS+WITDNILAMARPS+E I +YDII QFK+  IKTVIN+Q  GEH+ CG PL+P SGF+Y P+  M+  I   N+   DYG   +  + D++K +   L  GK+A+HCHAG GRTG++IACYLIF  R++  QAI  VR +R  +IQ ++Q   +  F+++L PL  VF          ++ + ++RQ+ ++HG E+  L+YVPK++  VC  L  L++  Q +E++ L
Sbjct:   60 HVIPGHMQCSMTCGGRACKYENP-TRWSDEEQAIKGLYSSWITDNILAMARPSSEIIDKYDIIRQFKSCSIKTVINLQRPGEHASCGNPLEPESGFTYLPEAFMEAEIYFYNFGWKDYGVASLTTILDMVKVMAFALQEGKVAIHCHAGLGRTGVLIACYLIFATRMTADQAILLVRARRHNAIQTRVQLLCIREFSQFLAPLHNVFACSDPKAHAVTLNQYLIRQQHLLHGYEARHLKYVPKMVHLVCKLLLDLAENRQVLEEEIL 325          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Xenopus
Match: PTPDC1 (protein tyrosine phosphatase domain containing 1 [Source:NCBI gene;Acc:100490857])

HSP 1 Score: 234.187 bits (596), Expect = 1.252e-67
Identity = 121/267 (45.32%), Postives = 175/267 (65.54%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC--LRKLSQIGQTIEDDSL 994
            ++I G   C + CG R CKY  P +R+  E+ A+KGLYS+WITDNILAMARPS+E I +YDII QFK+  IKTVIN+Q  GEH+ CG PL+P SGF+Y P+  M+  I   N+   DYG   +  + D++K +   L  GK+A+HCHAG GRTG++IACYLIF  R++  QAI  VR +R  +IQ ++Q   +  F+++L PL  VF          ++ + ++RQ+ ++HG E+  L+YVPK++  VC  L  L++  Q +E++ L
Sbjct:   46 HVIPGHMQCSMTCGGRACKYENP-TRWSDEEQAIKGLYSSWITDNILAMARPSSEIIDKYDIIRQFKSCSIKTVINLQRPGEHASCGNPLEPESGFTYLPEAFMEAEIYFYNFGWKDYGVASLTTILDMVKVMAFALQEGKVAIHCHAGLGRTGVLIACYLIFATRMTADQAILLVRARRHNAIQTRVQLLCIREFSQFLAPLHNVFACSDPKAHAVTLNQYLIRQQHLLHGYEARHLKYVPKMVHLVCKLLLDLAENRQVLEEEIL 311          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Xenopus
Match: mettl14 (methyltransferase like 14 [Source:Xenbase;Acc:XB-GENE-5813560])

HSP 1 Score: 60.8474 bits (146), Expect = 4.060e-10
Identity = 29/86 (33.72%), Postives = 52/86 (60.47%), Query Frame = 2
Query:  551 DYGALPVQYMFDIMKTIQHRLTVGK-IAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLK 805
            D+ A  ++ + + +K +      G+ + VHC  G GRTG ++ACYL+   +I+G+ AIN +R  R+GSI+   Q + ++ F  ++K
Sbjct:  110 DFCAPSLEQIKNFLKIVDDAKAKGEAVGVHCLHGFGRTGTMLACYLVKVRKITGVDAINEIRSLRRGSIETTEQEKAIIQFHHHIK 195          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Xenopus
Match: CDC14A (cell division cycle 14A [Source:NCBI gene;Acc:100490252])

HSP 1 Score: 60.077 bits (144), Expect = 6.539e-9
Identity = 36/91 (39.56%), Postives = 52/91 (57.14%), Query Frame = 2
Query:  494 YDPKKLMDNGIDHINYPCDDYGALP----VQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            YD K+  D G DH +    D G+ P    V+   ++ +      T G IAVHC AG GRTG +IACY++ + R++  +AI ++R  R GSI
Sbjct:  221 YDAKRFTDAGFDHYDLFFVD-GSTPSDGIVRRFLNLCEN-----TDGAIAVHCKAGLGRTGTLIACYIMKHYRLTHSEAIAWIRICRPGSI 305          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Xenopus
Match: CDC14A (cell division cycle 14A [Source:NCBI gene;Acc:100490252])

HSP 1 Score: 60.077 bits (144), Expect = 7.247e-9
Identity = 36/91 (39.56%), Postives = 52/91 (57.14%), Query Frame = 2
Query:  494 YDPKKLMDNGIDHINYPCDDYGALP----VQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            YD K+  D G DH +    D G+ P    V+   ++ +      T G IAVHC AG GRTG +IACY++ + R++  +AI ++R  R GSI
Sbjct:  221 YDAKRFTDAGFDHYDLFFVD-GSTPSDGIVRRFLNLCEN-----TDGAIAVHCKAGLGRTGTLIACYIMKHYRLTHSEAIAWIRICRPGSI 305          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Mouse
Match: Ptpdc1 (protein tyrosine phosphatase domain containing 1 [Source:MGI Symbol;Acc:MGI:2145430])

HSP 1 Score: 225.328 bits (573), Expect = 3.490e-64
Identity = 112/249 (44.98%), Postives = 161/249 (64.66%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLD-PSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC 946
            ++I G   C + CG R CKY  P +R+  ++ A+KG+YS+W+TDNILAMARPS+E + +Y II QF    IKT+IN+Q  GEH+ CG  L+  SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   L  GK+AVHCHAG GRTG++IACYL+F  R++  QAI +VR KR  SIQ + Q   V  F ++L PL  +F          ++ + ++RQ+ ++HG E+ +L+YVPKII  VC
Sbjct:   46 HVIPGHMACSMACGGRACKYENP-ARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLAPLRNIFSCCDPKAHAVTLAQYLIRQRHLLHGYEARLLKYVPKIIHLVC 293          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Mouse
Match: Ptpdc1 (protein tyrosine phosphatase domain containing 1 [Source:MGI Symbol;Acc:MGI:2145430])

HSP 1 Score: 226.098 bits (575), Expect = 3.880e-64
Identity = 112/249 (44.98%), Postives = 161/249 (64.66%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLD-PSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC 946
            ++I G   C + CG R CKY  P +R+  ++ A+KG+YS+W+TDNILAMARPS+E + +Y II QF    IKT+IN+Q  GEH+ CG  L+  SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   L  GK+AVHCHAG GRTG++IACYL+F  R++  QAI +VR KR  SIQ + Q   V  F ++L PL  +F          ++ + ++RQ+ ++HG E+ +L+YVPKII  VC
Sbjct:  107 HVIPGHMACSMACGGRACKYENP-ARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLAPLRNIFSCCDPKAHAVTLAQYLIRQRHLLHGYEARLLKYVPKIIHLVC 354          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Mouse
Match: Ptpdc1 (protein tyrosine phosphatase domain containing 1 [Source:MGI Symbol;Acc:MGI:2145430])

HSP 1 Score: 226.098 bits (575), Expect = 3.895e-64
Identity = 112/249 (44.98%), Postives = 161/249 (64.66%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLD-PSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC 946
            ++I G   C + CG R CKY  P +R+  ++ A+KG+YS+W+TDNILAMARPS+E + +Y II QF    IKT+IN+Q  GEH+ CG  L+  SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   L  GK+AVHCHAG GRTG++IACYL+F  R++  QAI +VR KR  SIQ + Q   V  F ++L PL  +F          ++ + ++RQ+ ++HG E+ +L+YVPKII  VC
Sbjct:   94 HVIPGHMACSMACGGRACKYENP-ARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLAPLRNIFSCCDPKAHAVTLAQYLIRQRHLLHGYEARLLKYVPKIIHLVC 341          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Mouse
Match: Cdc14b (CDC14 cell division cycle 14B [Source:MGI Symbol;Acc:MGI:2441808])

HSP 1 Score: 67.0106 bits (162), Expect = 3.171e-11
Identity = 45/127 (35.43%), Postives = 64/127 (50.39%), Query Frame = 2
Query:  392 INQFKNHKIKTVI--NMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALP----VQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            I  FKNH + T+I  N +M                 YD K+  D G DH +    D G+ P    VQ   DI + ++     G IAVHC AG GRTG +I CYL+ + R++  ++I ++R  R GS+
Sbjct:  249 IPYFKNHNVTTIIRLNKRM-----------------YDAKRFTDAGFDHHDLFFPD-GSTPAESIVQEFLDICENVK-----GAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSV 352          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Mouse
Match: Cdc14b (CDC14 cell division cycle 14B [Source:MGI Symbol;Acc:MGI:2441808])

HSP 1 Score: 67.0106 bits (162), Expect = 3.171e-11
Identity = 45/127 (35.43%), Postives = 64/127 (50.39%), Query Frame = 2
Query:  392 INQFKNHKIKTVI--NMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALP----VQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            I  FKNH + T+I  N +M                 YD K+  D G DH +    D G+ P    VQ   DI + ++     G IAVHC AG GRTG +I CYL+ + R++  ++I ++R  R GS+
Sbjct:  249 IPYFKNHNVTTIIRLNKRM-----------------YDAKRFTDAGFDHHDLFFPD-GSTPAESIVQEFLDICENVK-----GAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSV 352          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|A2A3K4|PTPC1_HUMAN (Protein tyrosine phosphatase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PTPDC1 PE=1 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.096e-64
Identity = 112/249 (44.98%), Postives = 165/249 (66.27%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLD-PSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC 946
            ++I G   C + CG R CKY  P +R+  ++ A+KG+YS+W+TDNILAMARPS+E + +Y II+QF +H IKT+IN+Q  GEH+ CG PL+  SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   L  GK+A+HCHAG GRTG++IACYL+F  R++  QAI +VR KR  SIQ + Q   V  F ++L PL  +F          ++ + ++RQ+ ++HG E+ +L++VPKII  VC
Sbjct:   46 HVIPGHMACSMACGGRACKYENP-ARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLTPLRNIFSCCDPKAHAVTLPQYLIRQRHLLHGYEARLLKHVPKIIHLVC 293          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|A1L1R5|PTPC1_DANRE (Protein tyrosine phosphatase domain-containing protein 1 OS=Danio rerio OX=7955 GN=ptpdc1 PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 3.614e-64
Identity = 117/267 (43.82%), Postives = 172/267 (64.42%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIG---QTIEDDSL 994
            ++I G   C + CG R CKY  P SR+  ++ A+KGLYS+WITD++LAMARPS E + +++II QF    +KTVIN+Q  GEH+ CG  L+P SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   +  GKIAVHCHAG GRTG++IAC+L+F +R+S  QAI +VR KR  SIQ + Q   V  FA++L PL +VF        + ++ + + RQ+ ++HG E+  ++ +PKII +  R L  I    QT+E++ L
Sbjct:   44 HVIPGHMQCSMACGGRACKYENP-SRWSDKEQAVKGLYSSWITDHLLAMARPSTEIVEKFNIIEQFHVCGLKTVINLQRPGEHASCGSTLEPESGFTYRPELFMEAGIYFYNFGWKDYGVASLTTILDMVKVMSFAMQEGKIAVHCHAGLGRTGVLIACFLVFTSRMSADQAILFVRAKRPNSIQTRGQLLCVREFAQFLVPLRSVFSCAEPKAHEVTLSQYLTRQRHLLHGYEARHMKNMPKIIHLICRLLLDIAENRQTVEEEVL 309          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q6NZK8|PTPC1_MOUSE (Protein tyrosine phosphatase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ptpdc1 PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.441e-63
Identity = 112/249 (44.98%), Postives = 161/249 (64.66%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLD-PSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC 946
            ++I G   C + CG R CKY  P +R+  ++ A+KG+YS+W+TDNILAMARPS+E + +Y II QF    IKT+IN+Q  GEH+ CG  L+  SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   L  GK+AVHCHAG GRTG++IACYL+F  R++  QAI +VR KR  SIQ + Q   V  F ++L PL  +F          ++ + ++RQ+ ++HG E+ +L+YVPKII  VC
Sbjct:   46 HVIPGHMACSMACGGRACKYENP-ARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLAPLRNIFSCCDPKAHAVTLAQYLIRQRHLLHGYEARLLKYVPKIIHLVC 293          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|A7E379|PTPC1_BOVIN (Protein tyrosine phosphatase domain-containing protein 1 OS=Bos taurus OX=9913 GN=PTPDC1 PE=2 SV=2)

HSP 1 Score: 221.861 bits (564), Expect = 8.595e-62
Identity = 107/249 (42.97%), Postives = 164/249 (65.86%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLD-PSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKII-FVC 946
            ++I G   C + CG + CKY +  +R+  ++ A+KG+YS+W+TDNILAMARPS E + ++ II QF++H IK++IN+Q  GEH+ CG PL+  SGF+Y P+  M+ GI   N+   DYG   +  + D++K +   L  GK+A+HCHAG GRTG++IACYL+F  R++  QAI +VR KR  SIQ + Q   V  F ++L PL  +F          ++ + ++RQ+ ++HG E+ +L+++PKII  VC
Sbjct:   90 HVIPGHVACSMACGGKACKY-ENAARWSEQEQAVKGIYSSWVTDNILAMARPSTEVLEKFCIIEQFRSHGIKSIINLQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLIPLRNIFSCCDPKAHAVTLAQYLIRQRHLLHGYEARLLKHIPKIIHLVC 337          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q6PFY9|CC14B_MOUSE (Dual specificity protein phosphatase CDC14B OS=Mus musculus OX=10090 GN=Cdc14b PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.218e-10
Identity = 45/127 (35.43%), Postives = 64/127 (50.39%), Query Frame = 2
Query:  392 INQFKNHKIKTVI--NMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALP----VQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            I  FKNH + T+I  N +M                 YD K+  D G DH +    D G+ P    VQ   DI + ++     G IAVHC AG GRTG +I CYL+ + R++  ++I ++R  R GS+
Sbjct:  249 IPYFKNHNVTTIIRLNKRM-----------------YDAKRFTDAGFDHHDLFFPD-GSTPAESIVQEFLDICENVK-----GAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSV 352          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. TrEMBL
Match: K1RBN7 (Tyrosine phosphatase domain-containing protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10016183 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 2.874e-76
Identity = 125/261 (47.89%), Postives = 184/261 (70.50%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQ---IGQTI 979
            ++ISG+  C LFCG ++CKYC     +  ++MA++GLYS W+TDNILAMARPS + + ++ I+ QF  + IK+V+N+Q  GEH+ CG  L+ +GFSYDP+ LMDN I   N+   DYG   +  + D++K IQ  ++ GK+AVHCHAG GRTG++IACYL++ NR+SG +AI+YVR +RKG+IQ + Q + V  F +YLKP   VF  +S    +F++Q+ + RQK I+HG E+  L++VPK+I+V   KL Q   +GQ++
Sbjct:   84 SLISGERQCALFCGGKKCKYCTS-ENWTIDQMAIEGLYSNWVTDNILAMARPSTKQMKEHKILEQFHKNDIKSVLNLQKPGEHADCGEGLEKAGFSYDPQLLMDNNIFFYNFGWPDYGVAALSTILDMVKVIQFGVSEGKVAVHCHAGLGRTGVIIACYLVYTNRMSGSEAIHYVRSQRKGAIQTRGQMQCVQEFEQYLKPFRVVFASRSAGSHEFTLQQYLNRQKHILHGYEARKLKHVPKVIYVVCEKLLQLASLGQSL 343          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. TrEMBL
Match: A0A210PSS5 (Protein tyrosine phosphatase domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11122 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.218e-74
Identity = 123/257 (47.86%), Postives = 178/257 (69.26%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIGQ 973
             +IS +  C LFCG ++CKYC P   +P EKM +KGL+S+WIT+NI+AM+RP++E I +YDII QFK   I+T+INMQ  GEH+ CG+ ++  SGFSY P++ MDNG+   N+   DYG   +  + D++K +Q  ++ GK+AVHCHAG GRTG++IA YL+F NRISG  AI+YVR +R  SIQ + Q E +  F  YLKP   VF  K++   +F++   + RQK ++HG E+  L++VPKII++   +L ++ Q
Sbjct:   52 GMISQEKICALFCGGKKCKYCSP-DLWPKEKMVIKGLFSSWITENIVAMSRPADELIDKYDIIGQFKEMGIRTIINMQSQGEHADCGYGINKKSGFSYSPQRFMDNGVYFYNFCWPDYGVGSLSSILDMVKVMQFAVSEGKVAVHCHAGLGRTGVMIATYLVFTNRISGNLAIHYVRSQRPHSIQTRGQMEIIQEFEAYLKPFRIVFASKAKDTHEFTLIHYLNRQKHVLHGYEARKLKFVPKIIYISCERLLELAQ 307          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. TrEMBL
Match: A0A4Z2CLU0 (Protein tyrosine phosphatase domain-containing protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_009576 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 8.516e-71
Identity = 161/402 (40.05%), Postives = 212/402 (52.74%), Query Frame = 2
Query:  230 FCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIGQTIEDDSLFDITD-------AKXXXXXXXXXXXLPV----------ENDNYVLREHFFRWIRRIKGCFKKPLSKTYAEKILK-LLKTQY----GNEENINKIKADLNNDDKIWGQLYAMEEIHLH----CQLILDWFDDLKFPILRIPDIEEMK 1354
             C LFCG  +CKYC P S F   KM LKGLYSTWIT NILA +RPS E I +++II QFK  KI ++ NMQ  GEHS CG+ L  SGFSYDP   M N I+  N+   DY    +Q++ D +  IQ  +  GKIA+HCHAG GRTG++IACYL+FNNRIS  +AINYVR +R GSIQ + Q   +  F K+L P  T F   S     FS+   + RQ  + H ++   LR +P II++C + L +   T     L D +D        + S  SS   S+ PV           ++N  L +         K           A  + K LL TQY     NE    + K   NND + W      E+  L+     +LI DW   LK P+LR+ D+  ++
Sbjct:   44 LCLLFCGGSKCKYCNPPSFFDDNKMHLKGLYSTWITQNILATSRPSEELINRFNIIEQFKRMKICSIFNMQTPGEHSSCGYGLQTSGFSYDPVNFMKNNINFYNFGWCDYNVASLQFILDTVIVIQFAIYSGKIAIHCHAGLGRTGVIIACYLVFNNRISAGEAINYVRFRRPGSIQTQNQVGCIYEFEKFLCPYRTHFASHS---GHFSLSTFLQRQNVMSHDQQRNHLRNIPNIIYMCCKLLVRFIITGSTSVLTDSSDYVNRMVNNEDSGQSSRKLSATPVTQLEVCTNSLSDENTELTDITLEPDNTFKNQGVNDNHSIGARSVTKALLTTQYPEFVANE--TERWKKKFNNDPEAWDDF---EKSSLNPMVLVKLIDDWLMHLKSPVLRMQDLLSLQ 437          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. TrEMBL
Match: A0A3Q0KU34 (TYR_PHOSPHATASE_2 domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 2.481e-69
Identity = 171/479 (35.70%), Postives = 238/479 (49.69%), Query Frame = 2
Query:  215 ISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQI----GQTIEDDSLFDITDAKXXXXXXXXXXXLPVENDNYVLREHFFRWIR--RIKGCFKKPLSKTYAE----------------KILKLLKTQYGNEENINKI---KADLNNDDKIWGQL--YAMEEIHLHCQLILDWFDDLKFPILRIPDIEEMKISD--SEDLVTILLRLETIVGKTLAFLLEFLDQFQNLSDESFWDLHGIFFSRLTQKN---VNFLKNTKRSN 1552
            I     C LFCG  +CKYC P S F   +M L GLYSTWIT NILA +RPS + I ++DII QFK   I ++ NMQ  GEHS CG+ +  SGFSYDP   M N I   N+   DY    +Q++ D +  IQ  +  GKIAVHCHAG GRTG++IACYL+FNNRIS  +AI YVR +R GSIQ + Q   +  F KYL      F    Q    FS++  + RQ  ++HG E   LR +PKII++C + L +I      +++ DS        S  ++   T  LP  +   V +   F   +           +  TY E                 +L+ L T    E  +N+    K   NND + W      +   + L  +LI DW   LK P+LR+ D+  ++ +    ED++T L   E  V   ++   + +   Q L ++    L     + L QK    +N   NTK+ N
Sbjct:   39 IPEKNLCLLFCGGSKCKYCNPSSFFDETEMHLNGLYSTWITQNILATSRPSEKIIEEFDIIKQFKRMNICSIFNMQTAGEHSSCGYGVLSSGFSYDPLSFMKNNISFYNFSWCDYDVASLQFILDTVTVIQFAIFKGKIAVHCHAGLGRTGVIIACYLVFNNRISAEEAIQYVRFRRPGSIQTQNQVGCIYKFEKYLYLYRIYFGSHGQ----FSLEAFLKRQNVLLHGPERRRLRNIPKIIYMCCKLLVRIIVTGCTSVQIDSSNHRNRIVSDENNCQSTKKLPTTS---VTQSEVFTSCQPDETTKLTNATVDCTYGENSQNQNVDNNQSIGASSVLEALLTTEYPESVVNETEYWKKKFNNDPEAWDDFDKTSFNPLVL-VKLIDDWLTHLKSPVLRMQDLLSLQQNPLFEEDILTSLEIFEKPVVCLMSLFAKLITYLQPLPEQMEHLLIERVLNWLCQKQSKPLNVTTNTKKFN 509          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. TrEMBL
Match: R7VFV8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_229133 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 4.592e-69
Identity = 158/466 (33.91%), Postives = 251/466 (53.86%), Query Frame = 2
Query:  233 CQLFCG-RECKYCK--PMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSK-FSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQI-----GQTIEDDSLFDITDAKXXXXXXXXXXXLPVENDNYVLREHFFRWIRRIKGCFKKPLSKTYAEKILK-------------------------LLKTQYGNE--ENINKIKADLNNDDKIWGQLYAMEEIHLHCQLILDWFDDLKFPILRIPDIEEMKISDSEDLVTILLRLETIVGKTLAFLLEFLDQFQNLSDESFWDLHGIFFSRLTQKNV 1522
            C+ FCG R+CKYC    + ++  ++  +KG++S W+TDNILAMARP    I +++II+QFK + IK++IN+Q+ GEHS CG   +  GFSY P++ MD GI   N+  +DYG   +  + D++K +Q  ++ GK AVHCHAG GRTG+ IACYL+F N +    AI+YVR KR+G+IQ + Q E +  F+ YL+PL  VF I+S+  S  F++ + + RQK ++HG E+  L+++PKII VC  +L Q+     G T   DS         S+ SS +  S  + + N  L E+ F   R +       ++   + K+ K                         + +T+Y ++  + +++    LN D   +  L   ++  +   LI +W D LK P+L   D+  +    SE L  + L LE     T+ +L E +   + L +    +L     S L+ +N+
Sbjct:   51 CKSFCGGRKCKYCNVNQVGKWNEKQCEIKGIFSNWVTDNILAMARPVTVNIEEFNIIDQFKENGIKSIINLQLSGEHSTCGNGNEEGGFSYKPQQFMDEGIFFYNFGWEDYGVGTLGSILDVVKVMQFSVSEGKTAVHCHAGLGRTGVTIACYLVFTNAMDPYDAIHYVRSKRRGAIQTQSQIECIHQFSTYLRPLRQVFHIESEEGSHDFTLSQFLTRQKHMLHGYEARNLKFIPKIICVCCERLLQLAGRSAGYTAAKDS---NCPVLRSTSSSSLVRSSTLHSINSNLSENNFSTKRSVSLESFSAITPKSSRKLTKDVEKLSVSSSESKDASSKVEVVAMAMAETEYSSQVLQAVHQYMTQLNCDTHAFDVLAEEKDPTVLAALIWEWLDHLKEPMLNSQDLPNVLEYASEPLGGLEL-LEKGARFTILYLSEVVALLEPLPESIELELVQRLLSTLSHQNM 512          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Cavefish
Match: ptpdc1a (protein tyrosine phosphatase domain containing 1 [Source:NCBI gene;Acc:103031844])

HSP 1 Score: 239.965 bits (611), Expect = 1.247e-69
Identity = 120/266 (45.11%), Postives = 173/266 (65.04%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIG---QTIEDDS 991
            ++I G   C + CG R CKY  P SR+  ++ A+KGLYS+WITDN+LAMARPS E I +Y++I QF    +KTVIN+Q  GEH+ CG+PL+P SGF+Y P+ LM+ GI   N+   DYG   +  + D++K +   +  GK+AVHCHAG GRTG+++ACYL+F +R+S  QAI ++R KR  SIQ + Q   V  FA++L PL +VF          ++ + + RQ+ ++HG E   ++ VPKII +  R L  I    QT+ED++
Sbjct:   54 HVIPGHMQCSMACGGRACKYENP-SRWSDKEQAIKGLYSSWITDNLLAMARPSTEIIEKYNVIEQFLGCGLKTVINLQRPGEHASCGYPLEPESGFTYRPEVLMEAGIYFYNFGWKDYGVASLTTILDMVKVMSFAMQEGKMAVHCHAGLGRTGVLLACYLVFTSRMSADQAILFIRAKRPNSIQTRGQLLCVREFAQFLVPLRSVFSSAGPKAHTVTLSQFLTRQRHLLHGYEGRQMKNVPKIIHLVCRLLLDIAENRQTVEDEA 318          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Cavefish
Match: ptpdc1a (protein tyrosine phosphatase domain containing 1 [Source:NCBI gene;Acc:103031844])

HSP 1 Score: 239.58 bits (610), Expect = 2.096e-69
Identity = 120/266 (45.11%), Postives = 173/266 (65.04%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIG---QTIEDDS 991
            ++I G   C + CG R CKY  P SR+  ++ A+KGLYS+WITDN+LAMARPS E I +Y++I QF    +KTVIN+Q  GEH+ CG+PL+P SGF+Y P+ LM+ GI   N+   DYG   +  + D++K +   +  GK+AVHCHAG GRTG+++ACYL+F +R+S  QAI ++R KR  SIQ + Q   V  FA++L PL +VF          ++ + + RQ+ ++HG E   ++ VPKII +  R L  I    QT+ED++
Sbjct:   59 HVIPGHMQCSMACGGRACKYENP-SRWSDKEQAIKGLYSSWITDNLLAMARPSTEIIEKYNVIEQFLGCGLKTVINLQRPGEHASCGYPLEPESGFTYRPEVLMEAGIYFYNFGWKDYGVASLTTILDMVKVMSFAMQEGKMAVHCHAGLGRTGVLLACYLVFTSRMSADQAILFIRAKRPNSIQTRGQLLCVREFAQFLVPLRSVFSSAGPKAHTVTLSQFLTRQRHLLHGYEGRQMKNVPKIIHLVCRLLLDIAENRQTVEDEA 323          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Cavefish
Match: zgc:77752 (protein tyrosine phosphatase domain-containing protein 1-like [Source:NCBI gene;Acc:103032733])

HSP 1 Score: 204.912 bits (520), Expect = 8.637e-58
Identity = 108/271 (39.85%), Postives = 167/271 (61.62%), Query Frame = 2
Query:  170 NKSSEAITVSAKPNIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYL-KPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIGQ 973
            +++ E +  +  P II     C L CG R+C+Y  P   +   + A++GL+S+W+T++I+AMARPS   I +Y+II QFK   IK++INMQ+ GEH+ CG  L+P SGF+Y P+  M+N I   N+   D+G   +  M D +K +   +  GK+AVHCHAG GRTG++IACYLI+  RI+  +AI+YVR KR  SIQ + Q   V  FA+ +   L     +  +  + F++++ + RQ  ++HG+E+  L + PKI+ +    L+ I Q
Sbjct:    7 SQTRENLVKAIPPKII-----CLLACGGRDCRYEGPAC-WRTSQQAIRGLFSSWVTNDIIAMARPSTNLIKRYNIIEQFKKLNIKSIINMQLPGEHAHCGPDLEPDSGFTYSPQVFMENQIYFYNFGMTDFGVSSIVGMLDAVKVLTFSVEEGKVAVHCHAGLGRTGVLIACYLIYMLRITASEAIHYVRIKRPRSIQTRAQISLVFDFARLIGSQLAQYPCLNMRHGAPFTLRQYLQRQALLLHGEEARTLAHTPKILHLLCSLLTAIAQ 271          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Cavefish
Match: zgc:77752 (protein tyrosine phosphatase domain-containing protein 1-like [Source:NCBI gene;Acc:103032733])

HSP 1 Score: 204.912 bits (520), Expect = 9.763e-58
Identity = 108/271 (39.85%), Postives = 167/271 (61.62%), Query Frame = 2
Query:  170 NKSSEAITVSAKPNIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYL-KPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIGQ 973
            +++ E +  +  P II     C L CG R+C+Y  P   +   + A++GL+S+W+T++I+AMARPS   I +Y+II QFK   IK++INMQ+ GEH+ CG  L+P SGF+Y P+  M+N I   N+   D+G   +  M D +K +   +  GK+AVHCHAG GRTG++IACYLI+  RI+  +AI+YVR KR  SIQ + Q   V  FA+ +   L     +  +  + F++++ + RQ  ++HG+E+  L + PKI+ +    L+ I Q
Sbjct:   13 SQTRENLVKAIPPKII-----CLLACGGRDCRYEGPAC-WRTSQQAIRGLFSSWVTNDIIAMARPSTNLIKRYNIIEQFKKLNIKSIINMQLPGEHAHCGPDLEPDSGFTYSPQVFMENQIYFYNFGMTDFGVSSIVGMLDAVKVLTFSVEEGKVAVHCHAGLGRTGVLIACYLIYMLRITASEAIHYVRIKRPRSIQTRAQISLVFDFARLIGSQLAQYPCLNMRHGAPFTLRQYLQRQALLLHGEEARTLAHTPKILHLLCSLLTAIAQ 277          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Cavefish
Match: ptpdc1b (protein tyrosine phosphatase domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-090312-138])

HSP 1 Score: 203.371 bits (516), Expect = 3.519e-57
Identity = 111/259 (42.86%), Postives = 167/259 (64.48%), Query Frame = 2
Query:  233 CQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIG---QTIEDDSL 994
            C + CG R CKY  P S +  +K A+KGLYS+ +T+N+LA ARPS E I +Y+I+ QF+   ++TVIN+Q  GEH+ CG PL+P SGF+Y P+  M+ G  + N+  +DYG   +  + D++K +   L  GK+AVHCHAG GRT +++AC+L+F +R++  QAI +VR KR  SIQ + Q   V  FA++L PL  +F       +  ++ + ++RQK ++HG E+  LRY+PK++ +  R L  I    Q IE+D L
Sbjct:   19 CAIGCGGRACKYEDP-SYWSPDKQAIKGLYSS-VTENLLATARPSTEIIEKYNIVEQFQC-GLRTVINLQRPGEHANCGNPLEPESGFTYRPETFMEAGYFY-NFGWNDYGVASLATILDMVKVMSFALQEGKMAVHCHAGLGRT-VLLACFLVFTSRMTADQAILFVRSKRPNSIQTRGQLVCVRQFAQFLVPLRNLFARAEPRANPVTLSQYLIRQKHMLHGYEARQLRYMPKLVLIICRLLLDIAENRQVIEEDIL 272          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: dusp23b (dual specificity phosphatase 23b [Source:ZFIN;Acc:ZDB-GENE-040718-163])

HSP 1 Score: 56.225 bits (134), Expect = 1.124e-9
Identity = 24/55 (43.64%), Postives = 36/55 (65.45%), Query Frame = 2
Query:  626 IAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSF 790
            +AVHC  GHGRTG ++AC+L+ +  +SG+ A+  +R  R GSI+ + Q   V  F
Sbjct:   92 VAVHCMHGHGRTGTMLACFLVRHRALSGVDAVAEIRRLRPGSIETREQEIAVTRF 146          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: cdc14ab (cell division cycle 14Ab [Source:NCBI gene;Acc:565969])

HSP 1 Score: 57.7658 bits (138), Expect = 1.528e-9
Identity = 34/89 (38.20%), Postives = 52/89 (58.43%), Query Frame = 2
Query:  494 YDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQH--RLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            YD ++  D G+ H +    D G+ P     DI++        T G +AVHC AG GRTG +IACYL+ ++R++  +A+ ++R  R GSI
Sbjct:   60 YDARRFTDAGLAHHDLFFPD-GSSPSP---DIVRKFCEICEGTRGAVAVHCKAGLGRTGTLIACYLMKHHRLTAAEAVAWIRICRPGSI 144          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Yeast
Match: CDC14 (Protein phosphatase required for mitotic exit; required for rDNA segregation, cytokinesis, meiosis I spindle disassembly, environmental stress response; held in nucleolus by Cdc55p in early meiosis, liberated by FEAR and Mitotic Exit Network in anaphase, enabling it to effect a decrease in CDK/B-cyclin activity and mitotic exit; sequestered in metaphase II, released upon entry into anaphase II; human homolog CDC14A can complement thermosensitivity of yeast cdc14-1 mutant [Source:SGD;Acc:S000001924])

HSP 1 Score: 48.9062 bits (115), Expect = 1.729e-6
Identity = 42/159 (26.42%), Postives = 69/159 (43.40%), Query Frame = 2
Query:  329 ITDNILAMARPSNEYIGQY-------------DIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALP----VQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            +T + +A A P  ++   Y              ++N F N+ ++ V+ +               +   Y+ K   D GI H++   +D G  P    V+      +TI  R   GKIAVHC AG GRTG +I  +LI+    +  + I ++R  R G +
Sbjct:  181 LTPDFIAFASPQEDHPKGYLATKSSHLNQPFKSVLNFFANNNVQLVVRL---------------NSHLYNKKHFEDIGIQHLDLIFED-GTCPDLSIVKNFVGAAETIIKR--GGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMV 321          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO33331 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSG5])

HSP 1 Score: 100.908 bits (250), Expect = 1.426e-25
Identity = 46/102 (45.10%), Postives = 68/102 (66.67%), Query Frame = 2
Query:  416 IKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAI 721
            IK++IN+Q  GEH+ CG+ L  SGFSYDP+  M   I   N+  +DYG   ++ + D++K +   L  GK AVHCHAG GRTG++I CY I+++R++  + I
Sbjct:    2 IKSIINLQHPGEHASCGYGLQDSGFSYDPEAFMQVEIFFYNFGWNDYGVRSLESILDMVKVMSFALQEGKTAVHCHAGLGRTGVLICCYFIYSDRLTAEEVI 103          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO38043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE41])

HSP 1 Score: 64.6994 bits (156), Expect = 3.644e-11
Identity = 47/157 (29.94%), Postives = 73/157 (46.50%), Query Frame = 2
Query:  308 KGLYSTWIT-DNILAMARPS--NEYIGQ--YDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFD-IMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQN 760
            K   S WI    ILAM+ P   NE        +   F+ + +KTV+ +            +   G  YD +    NG  H +   +D G +P + +     + + H    G +A+HC AG GRTG +IACYLI   + S  +A+ ++R  R GS+ +
Sbjct:  180 KAFDSNWIVPGKILAMSDPQRRNEVKASRFAKLRKHFRQNGVKTVVRLNRDDN-------MIKYGLVYDARCFTANGFAHSDQYFED-GGIPTKAIVKRFTRILDH--CEGAVAIHCRAGLGRTGTLIACYLIKQYKFSAAEAVGWLRICRPGSVSS 326          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO38271 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ9])

HSP 1 Score: 62.3882 bits (150), Expect = 1.543e-10
Identity = 41/121 (33.88%), Postives = 60/121 (49.59%), Query Frame = 2
Query:  392 INQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            I  FK H I TV+ +                   YD ++  D+GI+H +    D G++P   +     TI      G IA+HC AG GRTG +IACYL+ + R +  ++I ++R  R GSI
Sbjct:  197 IPYFKKHNISTVVRLNKK---------------LYDAQRFTDHGIEHYDLFFID-GSVPSDMIVRRFLTIAENAK-GGIAIHCKAGLGRTGTLIACYLMKHYRFTAAESIGWLRVCRPGSI 300          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO32901 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STQ6])

HSP 1 Score: 49.6766 bits (117), Expect = 1.754e-6
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 2
Query:  323 TWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAV---HCHAGHGRTGMVIACYLIFNNRISGI-QAINYVRGKR 742
            T+I  NI+AM  PS +  G Y      +NH  +    ++   + S+  + L  S   YDP +  +       YP DD+ A P + +      +   L    + V   HC AG GRTG++I  YL+ N       +A+ Y    R
Sbjct:   25 TYIKPNIVAMGFPSEKLEGVY------RNHMDEVYRFLEQKHKDSYKVYNL-CSERQYDPMRFHNRVA---TYPFDDHNAPPFELIKPFCDDVDEWLKASNLNVAIIHCKAGKGRTGVMICAYLLHNGHFKDTKEAMEYYGNAR 158          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO45782 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM0])

HSP 1 Score: 47.7506 bits (112), Expect = 6.936e-6
Identity = 46/170 (27.06%), Postives = 76/170 (44.71%), Query Frame = 2
Query:  323 TWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGK---IAVHCHAGHGRTGMVIACYLIFNNRISGIQ------AINYVRGKRKGSIQNKIQAETVLSFAKYLK 805
            T+IT+ I+AM+ P         + + ++N+       +Q   +  +  F L  S   YD  KL    +D   +P  D+ A P++ +  I+K+I   L       + VHC  G GRTG+VI+ Y+ F+   S  +      AI      + G +    Q   V  F+ YL+
Sbjct:   20 TYITERIIAMSFPGT------GLESTYRNNLRDVAKMLQRKHQDKYMVFNL--SERRYDISKLNHQVLD-FGWP--DHLAPPLERLCSIIKSIDSWLKTDPQHVVVVHCKGGKGRTGVVISAYMHFSKMCSSPEAALDWFAIKRFYDDKLGGVTQPSQRRYVHYFSDYLE 178          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Medaka
Match: ptpdc1b (protein tyrosine phosphatase domain-containing protein 1-like [Source:NCBI gene;Acc:101171912])

HSP 1 Score: 235.343 bits (599), Expect = 1.408e-68
Identity = 125/273 (45.79%), Postives = 174/273 (63.74%), Query Frame = 2
Query:  212 IISGDGFCQLFCGRE-CKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIG---QTIEDDSLF--DITD 1009
            +I G   C + CG E CKY  P + +  ++ A+KGLYS+WIT+++LAM+RPS E I ++D+INQFK + IK+VIN+QM GEH+ CG PL+P SGFSY P+  M+N I   NY   DYG   +  M D++K +   L  GK+AVHCHAG GRTG++IAC+L +  R++  QAI+YVR KR  SIQ + Q   V  F ++L PL TVF          ++ + + RQ+ ++HG E   LR++PKI+ +  R L  I    Q IE+D L   DI D
Sbjct:   39 VIPGHMQCSIGCGGEDCKYDNP-AYWREDQQAIKGLYSSWITEHLLAMSRPSTEIIEKFDVINQFKRNGIKSVINLQMVGEHASCGKPLEPDSGFSYRPEVFMENNIFFYNYGWCDYGVANLTTMLDMVKVMAFALQEGKVAVHCHAGLGRTGVLIACFLAYATRMTANQAISYVRAKRPNSIQTRSQLRCVREFVQFLAPLRTVFSQAEPRSIPVTLSQYLNRQRHMLHGYERKELRHLPKIVQLVCRLLVDIAENRQVIEEDILEAPDIQD 310          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Medaka
Match: ptpdc1b (protein tyrosine phosphatase domain-containing protein 1-like [Source:NCBI gene;Acc:101171912])

HSP 1 Score: 234.572 bits (597), Expect = 1.218e-67
Identity = 122/266 (45.86%), Postives = 171/266 (64.29%), Query Frame = 2
Query:  212 IISGDGFCQLFCGRE-CKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIG---QTIEDDSL 994
            +I G   C + CG E CKY  P + +  ++ A+KGLYS+WIT+++LAM+RPS E I ++D+INQFK + IK+VIN+QM GEH+ CG PL+P SGFSY P+  M+N I   NY   DYG   +  M D++K +   L  GK+AVHCHAG GRTG++IAC+L +  R++  QAI+YVR KR  SIQ + Q   V  F ++L PL TVF          ++ + + RQ+ ++HG E   LR++PKI+ +  R L  I    Q IE+D L
Sbjct:  116 VIPGHMQCSIGCGGEDCKYDNP-AYWREDQQAIKGLYSSWITEHLLAMSRPSTEIIEKFDVINQFKRNGIKSVINLQMVGEHASCGKPLEPDSGFSYRPEVFMENNIFFYNYGWCDYGVANLTTMLDMVKVMAFALQEGKVAVHCHAGLGRTGVLIACFLAYATRMTANQAISYVRAKRPNSIQTRSQLRCVREFVQFLAPLRTVFSQAEPRSIPVTLSQYLNRQRHMLHGYERKELRHLPKIVQLVCRLLVDIAENRQVIEEDIL 380          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Medaka
Match: ptpdc1a (protein tyrosine phosphatase domain containing 1 [Source:NCBI gene;Acc:101157363])

HSP 1 Score: 232.646 bits (592), Expect = 1.223e-67
Identity = 117/272 (43.01%), Postives = 172/272 (63.24%), Query Frame = 2
Query:  209 NIISGDGFCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIG---QTIEDDSLFDITD 1009
            ++I G   C + CG + CKY  P SR+  E+ A+KGLYS+WITD++LAMARPS E I +Y II QFK   +KTVIN+Q  GEH+ CG PL+P SGF+Y P+  M  G+ + N+   DYG   +  + D++K +   +  GK+AVHCHAG GRTG+++ACYL+F  R++  QAI +VR KR  SIQ + Q   V  FA++L PL +VF       S  ++ + + RQ+ ++HG E+  ++ VPKI+ +  + L  I    Q + ++   +I D
Sbjct:   22 HVIPGHMQCSMACGGKACKYENP-SRWRDEEQAIKGLYSSWITDSLLAMARPSTEIIEKYGIIEQFKRCGLKTVINLQRPGEHASCGNPLEPESGFTYRPETFMQAGVYYYNFGWKDYGVASLTTILDMVKVMSFAVQEGKMAVHCHAGLGRTGVLLACYLVFTARMNADQAILFVRAKRPNSIQTRGQLLCVREFAQFLVPLRSVFSCAEPRASAVTLSQYLTRQRHLLHGYEARRMKNVPKIVHLVCKLLLDIAANRQVVVEEERLEIPD 292          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Medaka
Match: zgc:77752 (zgc:77752 [Source:ZFIN;Acc:ZDB-GENE-040426-1867])

HSP 1 Score: 207.994 bits (528), Expect = 2.566e-60
Identity = 105/247 (42.51%), Postives = 159/247 (64.37%), Query Frame = 2
Query:  230 FCQLFCG-RECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDP-SGFSYDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYL-KPLTTVFWIKSQTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLS 961
             C L CG R+C+Y  P   +   +  ++G++S+W+TD+I+AMARPSN  I +Y+II+QF    IK++INMQ+ GEH+ CG PLDP SGF+Y P+  MDN I   N+   DYG   +  + D +K +   +  G++A+HCHAG GRTG++IACYLI+  RIS  +A++YVR KR  SIQ + Q   V  FA+ L   L     +  +  + F++Q  + RQ  ++HG+E+  LR+ PK++++   +LS
Sbjct:   31 LCLLACGGRDCRYEGPDC-WKLNQQVIRGIFSSWVTDDIIAMARPSNHLIQKYNIIDQFNRLNIKSIINMQLPGEHAHCGPPLDPDSGFTYSPQTFMDNDIYFYNFGMPDYGVSSLVGIIDGLKVLDFAVKEGRVAIHCHAGLGRTGVLIACYLIYTLRISPSEAVHYVRIKRPRSIQTRTQINQVFDFARLLGTQLVQYPDLSLRHGAPFTLQHYLNRQALLLHGQEARKLRHTPKVVYLLCVRLS 276          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Medaka
Match: dusp23a (dual specificity phosphatase 23 [Source:NCBI gene;Acc:101157498])

HSP 1 Score: 63.929 bits (154), Expect = 8.733e-12
Identity = 44/135 (32.59%), Postives = 65/135 (48.15%), Query Frame = 2
Query:  464 GFPLDPSGFSYDPKKLMDNGIDHINYPCD----DYGALP---------VQYMFDIMKTIQHRLTVGK--------IAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLK 805
              P  P  + Y    L DNGI H+   C+    ++ A P         V +       I   L++ +        +AVHC  G GRTG ++ACYL+ + +ISGI AIN +R  R GSI+   Q + V+ F + +K
Sbjct:   21 AMPRMPCDYRY----LSDNGIKHLVCLCERKPPNHEAFPELQLHHIKIVDFTPPSPAQIDRFLSIVEEANAKKEGVAVHCMHGFGRTGTMLACYLVKSRKISGIDAINEIRRMRAGSIETTEQEKAVVQFYQRIK 151          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000054364.1 (SMESG000054364.1)

HSP 1 Score: 308.531 bits (789), Expect = 3.975e-103
Identity = 145/146 (99.32%), Postives = 146/146 (100.00%), Query Frame = 2
Query:   86 MENLDFISDENEIEFTSYCNEILENTVLNKSSEAITVSAKPNIISGDGFCQLFCGRECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNG 523
            MENLDFISDENEIEFTSYCNEILENTVLNKSSEAITVSAKPNIISGDGFCQLFCGR+CKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNG
Sbjct:    1 MENLDFISDENEIEFTSYCNEILENTVLNKSSEAITVSAKPNIISGDGFCQLFCGRDCKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNG 146          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000054364.1 (SMESG000054364.1)

HSP 1 Score: 224.942 bits (572), Expect = 2.017e-71
Identity = 106/107 (99.07%), Postives = 107/107 (100.00%), Query Frame = 2
Query:   86 MENLDFISDENEIEFTSYCNEILENTVLNKSSEAITVSAKPNIISGDGFCQLFCGRECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFK 406
            MENLDFISDENEIEFTSYCNEILENTVLNKSSEAITVSAKPNIISGDGFCQLFCGR+CKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFK
Sbjct:    1 MENLDFISDENEIEFTSYCNEILENTVLNKSSEAITVSAKPNIISGDGFCQLFCGRDCKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQYDIINQFK 107          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000020520.1 (SMESG000020520.1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.673e-8
Identity = 28/88 (31.82%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  530 HINYPCDDYGALPVQYMFDIMKTIQHRLTVG-KIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSF 790
            HI   CD      +  MF I K I + ++    + VHC  G GRTG+V+AC+ I + ++   ++IN++R  R  S++   Q + + +F
Sbjct:   72 HIATICDR-SYFTIAEMFLIQKVIDYYISRDVPVLVHCSWGRGRTGIVLACFFIIHTKMKAKESINFIRTIRPESVETTSQMKMIYNF 158          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000056023.1 (SMESG000056023.1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.241e-7
Identity = 31/87 (35.63%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  494 YDPKKLMDNGIDHINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSI 754
            YD       GIDH +    D G +P + +      I    T G +AVHC AG GRTG +I CYL+   + +  ++I + R  R GS+
Sbjct:  225 YDKSSFTKVGIDHFDLIFPD-GGVPSEKLVRKFFHIVDNAT-GAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSV 309          
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000020520.1 (SMESG000020520.1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.781e-7
Identity = 27/87 (31.03%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  530 HINYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYLIFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSF 790
            HI   CD      +  MF I K +          VHC  G GRTG+V+AC+ I + ++   ++IN++R  R  S++   Q + + +F
Sbjct:   72 HIATICDR-SYFTIAEMFLIQKPV---------LVHCSWGRGRTGIVLACFFIIHTKMKAKESINFIRTIRPESVETTSQMKMIYNF 148          
The following BLAST results are available for this feature:
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPDC12.282e-6544.98protein tyrosine phosphatase domain containing 1 [... [more]
PTPDC12.282e-6544.98protein tyrosine phosphatase domain containing 1 [... [more]
PTPDC12.966e-6544.98protein tyrosine phosphatase domain containing 1 [... [more]
PTPDC13.576e-6544.98protein tyrosine phosphatase domain containing 1 [... [more]
CDC14B1.413e-1035.43cell division cycle 14B [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T12B3.11.310e-5540.15pep chromosome:WBcel235:IV:7382415:7384752:1 gene:... [more]
cdc-141.885e-725.00Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
cdc-141.934e-725.00Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
cdc-142.017e-725.33Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
cdc-142.017e-725.33Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpdc1a4.739e-6543.82protein tyrosine phosphatase domain containing 1a ... [more]
ptpdc1b5.315e-6443.40protein tyrosine phosphatase domain containing 1b ... [more]
zgc:777528.254e-6442.15zgc:77752 [Source:ZFIN;Acc:ZDB-GENE-040426-1867][more]
BX571879.22.539e-6342.15pep chromosome:GRCz11:CHR_ALT_CTG18_1_3:7591744:76... [more]
zgc:777523.846e-6342.15zgc:77752 [Source:ZFIN;Acc:ZDB-GENE-040426-1867][more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPDC13.299e-6845.32protein tyrosine phosphatase domain containing 1 [... [more]
PTPDC11.252e-6745.32protein tyrosine phosphatase domain containing 1 [... [more]
mettl144.060e-1033.72methyltransferase like 14 [Source:Xenbase;Acc:XB-G... [more]
CDC14A6.539e-939.56cell division cycle 14A [Source:NCBI gene;Acc:1004... [more]
CDC14A7.247e-939.56cell division cycle 14A [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptpdc13.490e-6444.98protein tyrosine phosphatase domain containing 1 [... [more]
Ptpdc13.880e-6444.98protein tyrosine phosphatase domain containing 1 [... [more]
Ptpdc13.895e-6444.98protein tyrosine phosphatase domain containing 1 [... [more]
Cdc14b3.171e-1135.43CDC14 cell division cycle 14B [Source:MGI Symbol;A... [more]
Cdc14b3.171e-1135.43CDC14 cell division cycle 14B [Source:MGI Symbol;A... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2A3K4|PTPC1_HUMAN1.096e-6444.98Protein tyrosine phosphatase domain-containing pro... [more]
sp|A1L1R5|PTPC1_DANRE3.614e-6443.82Protein tyrosine phosphatase domain-containing pro... [more]
sp|Q6NZK8|PTPC1_MOUSE2.441e-6344.98Protein tyrosine phosphatase domain-containing pro... [more]
sp|A7E379|PTPC1_BOVIN8.595e-6242.97Protein tyrosine phosphatase domain-containing pro... [more]
sp|Q6PFY9|CC14B_MOUSE2.218e-1035.43Dual specificity protein phosphatase CDC14B OS=Mus... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1RBN72.874e-7647.89Tyrosine phosphatase domain-containing protein 1 O... [more]
A0A210PSS52.218e-7447.86Protein tyrosine phosphatase domain-containing pro... [more]
A0A4Z2CLU08.516e-7140.05Protein tyrosine phosphatase domain-containing pro... [more]
A0A3Q0KU342.481e-6935.70TYR_PHOSPHATASE_2 domain-containing protein OS=Sch... [more]
R7VFV84.592e-6933.91Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpdc1a1.247e-6945.11protein tyrosine phosphatase domain containing 1 [... [more]
ptpdc1a2.096e-6945.11protein tyrosine phosphatase domain containing 1 [... [more]
zgc:777528.637e-5839.85protein tyrosine phosphatase domain-containing pro... [more]
zgc:777529.763e-5839.85protein tyrosine phosphatase domain-containing pro... [more]
ptpdc1b3.519e-5742.86protein tyrosine phosphatase domain containing 1b ... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dusp23b1.124e-943.64dual specificity phosphatase 23b [Source:ZFIN;Acc:... [more]
cdc14ab1.528e-938.20cell division cycle 14Ab [Source:NCBI gene;Acc:565... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC141.729e-626.42Protein phosphatase required for mitotic exit; req... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO333311.426e-2545.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380433.644e-1129.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382711.543e-1033.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329011.754e-628.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457826.936e-627.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpdc1b1.408e-6845.79protein tyrosine phosphatase domain-containing pro... [more]
ptpdc1b1.218e-6745.86protein tyrosine phosphatase domain-containing pro... [more]
ptpdc1a1.223e-6743.01protein tyrosine phosphatase domain containing 1 [... [more]
zgc:777522.566e-6042.51zgc:77752 [Source:ZFIN;Acc:ZDB-GENE-040426-1867][more]
dusp23a8.733e-1232.59dual specificity phosphatase 23 [Source:NCBI gene;... [more]
back to top
BLAST of Tyrosine phosphatase domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054364.13.975e-10399.32SMESG000054364.1[more]
SMESG000054364.12.017e-7199.07SMESG000054364.1[more]
SMESG000020520.11.673e-831.82SMESG000020520.1[more]
SMESG000056023.11.241e-735.63SMESG000056023.1[more]
SMESG000020520.13.781e-731.03SMESG000020520.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004467 ID=SMED30004467|Name=Tyrosine phosphatase domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1774bp
TATATAAATCTTATATGATAAAATTTCAAATTTAAAAGTATTTACATTAA
AAATTAAAGTATTTGATTAATTTGAAAATTGAATTATGGAAAACCTAGAC
TTCATTTCTGATGAAAATGAAATTGAATTTACATCTTATTGTAATGAAAT
TCTAGAGAACACAGTTTTAAACAAATCATCTGAAGCAATAACAGTTTCTG
CAAAGCCGAATATAATATCAGGTGATGGATTTTGTCAATTGTTTTGCGGC
AGAGAATGTAAATATTGTAAACCTATGTCACGATTCCCGGCGGAAAAAAT
GGCCTTAAAAGGTCTTTATTCGACATGGATTACCGATAACATTTTGGCCA
TGGCTCGTCCAAGCAACGAGTACATTGGACAGTATGATATTATCAACCAA
TTTAAAAATCATAAAATCAAAACTGTTATCAATATGCAAATGTTTGGCGA
GCATAGTTTTTGTGGTTTTCCTTTGGATCCAAGCGGATTTTCTTATGATC
CTAAAAAATTAATGGATAATGGAATCGATCACATAAATTATCCATGTGAT
GATTATGGAGCATTGCCTGTGCAATATATGTTTGACATCATGAAAACCAT
CCAACATCGGCTAACAGTTGGAAAAATTGCTGTTCATTGTCATGCAGGAC
ACGGTAGGACTGGTATGGTGATAGCCTGTTATTTGATATTTAACAACAGA
ATCAGTGGAATTCAGGCCATTAATTATGTTAGAGGTAAAAGAAAAGGATC
AATCCAAAATAAAATCCAAGCCGAAACTGTCTTATCGTTCGCAAAATATC
TCAAACCACTGACAACGGTGTTTTGGATAAAATCTCAAACTGTTTCAAAA
TTCAGTATCCAAGAAGCTGTTATGCGTCAAAAAAAGATTGTACATGGAAA
AGAGAGTTATATATTGCGCTATGTACCCAAAATTATATTCGTATGCCTTC
GAAAGCTGTCACAAATAGGACAGACAATTGAAGATGATAGTTTATTTGAT
ATAACAGATGCAAAATCTTCCAGTGATTCGTCTGTCGTTACATCATCCCT
CCCTGTTGAAAATGACAATTATGTTCTTCGTGAGCATTTTTTTCGGTGGA
TTCGTCGAATCAAAGGATGTTTCAAAAAACCTCTTTCCAAAACCTACGCA
GAGAAAATATTAAAGTTACTGAAAACTCAATACGGAAATGAAGAAAATAT
TAATAAAATTAAAGCAGATTTAAATAATGATGATAAAATATGGGGGCAGC
TCTATGCAATGGAGGAAATTCATTTGCATTGCCAGCTGATCTTGGATTGG
TTCGATGATCTGAAGTTTCCTATTTTGAGAATTCCTGATATTGAAGAAAT
GAAAATCTCAGACTCTGAGGATTTGGTTACAATTCTTTTGAGACTTGAAA
CGATTGTTGGTAAAACCCTTGCGTTTCTTTTGGAATTTCTCGATCAATTT
CAAAACCTTTCAGATGAATCATTTTGGGATCTTCATGGAATATTTTTTTC
CAGACTCACTCAGAAAAATGTGAATTTCTTGAAAAATACAAAACGTTCTA
ATATGTTTCGTTTTGATTTAAAAAGTCACCTAGTTCAAATTCTTAAGTCC
ATTATACAGAGACGAATCGACCAAAACTAATAAACTTAATTAATCAAAAT
GAAAGTCAAAAAGCAATCCAAATTATTCTTTTGTTAGAATTGGCATCTGT
TTTGGAGTCTATATTCATTTATTGAAGATTTTTATATTTATTGTAATTCC
AATGTTTGACAGCTGATCAACGCT
back to top

protein sequence of SMED30004467-orf-1

>SMED30004467-orf-1 ID=SMED30004467-orf-1|Name=SMED30004467-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=515bp
MENLDFISDENEIEFTSYCNEILENTVLNKSSEAITVSAKPNIISGDGFC
QLFCGRECKYCKPMSRFPAEKMALKGLYSTWITDNILAMARPSNEYIGQY
DIINQFKNHKIKTVINMQMFGEHSFCGFPLDPSGFSYDPKKLMDNGIDHI
NYPCDDYGALPVQYMFDIMKTIQHRLTVGKIAVHCHAGHGRTGMVIACYL
IFNNRISGIQAINYVRGKRKGSIQNKIQAETVLSFAKYLKPLTTVFWIKS
QTVSKFSIQEAVMRQKKIVHGKESYILRYVPKIIFVCLRKLSQIGQTIED
DSLFDITDAKSSSDSSVVTSSLPVENDNYVLREHFFRWIRRIKGCFKKPL
SKTYAEKILKLLKTQYGNEENINKIKADLNNDDKIWGQLYAMEEIHLHCQ
LILDWFDDLKFPILRIPDIEEMKISDSEDLVTILLRLETIVGKTLAFLLE
FLDQFQNLSDESFWDLHGIFFSRLTQKNVNFLKNTKRSNMFRFDLKSHLV
QILKSIIQRRIDQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR000340Dual-sp_phosphatase_cat-dom
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
IPR018042Aspartate_kinase_CS
Vocabulary: molecular function
TermDefinition
GO:0004072aspartate kinase activity
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0016791phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0008652cellular amino acid biosynthetic process
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation