Cyclic nucleotide gated channel 1

Overview
NameCyclic nucleotide gated channel 1
Smed IDSMED30004463
Length (bp)3526
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclic nucleotide gated channel 1 (SMED30004463) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclic nucleotide gated channel 1 (SMED30004463) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclic nucleotide gated channel 1 (SMED30004463) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclic nucleotide gated channel 1 (SMED30004463) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004463

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30004463SMESG000038954.1 SmedASXL_016339SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30004463SMESG000038954.1 dd_Smed_v6_21440_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30004463SMESG000038954.1 dd_Smed_v6_13408_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30004463SMESG000038954.1 SMED30004463smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30004463SMESG000038954.1 OX_Smed_1.0.20391ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004463SMESG000038954.1 OX_Smed_1.0.20951ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN4 (hyperpolarization activated cyclic nucleotide gated potassium channel 4 [Source:HGNC Symbol;Acc:HGNC:16882])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 294/542 (54.24%), Postives = 402/542 (74.17%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            + +++ QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIILDP+ I  +Y+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV   N+ +  W KQY++ALFKAMSHML IGYGR  P  +S+ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI +YYEHRYQGKMFDEE IL ELSE LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD II+EGTIG KM+FIQ G+V ++TK G   T L+DGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DLN
Sbjct:  211 AGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVED-NTEIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVETRID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHK--VQHDLN 730          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:HGNC Symbol;Acc:HGNC:4845])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 289/577 (50.09%), Postives = 408/577 (70.71%), Query Frame = 3
Query: 1053 DLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSR---------------EDLKEDLNLVKEIVSSVTPI 2738
            D     R   +++ QF S  QP  NK +L++FG++ AV KE+ R +  G  +IHP S+FRFYWDL+ML++++ NL+++PV I+FF +  +  WI+FN  SDT+F+LD+ +NFRTG +  D + EIILDPK+I   Y+KSWF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+P+L ++P + WV    + +  W KQY++ALFKAMSHML IGYG   P S+S+ WIT++SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I +YYEHRYQGK+FDEE IL EL++ LRE+I+N+NCR LVA +P F  AD +FV+ +++KL+FEV+QPGD II+EG +G KM+FIQ G+  +ITK  +    L+DGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +               E LK+ +   +E+V ++ PI
Sbjct:   83 DAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNED-SSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMD-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIAPI 639          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN2 (hyperpolarization activated cyclic nucleotide gated potassium and sodium channel 2 [Source:HGNC Symbol;Acc:HGNC:4846])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 286/542 (52.77%), Postives = 400/542 (73.80%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            +S+++ QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWD  ML+ ++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIILDP+ I ++Y+++WF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + IC L+ +MLLL HW+ CLQFL+PML ++P   WV    + +  W + Y++ALFKAMSHML IGYGR  P S+++ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMFDE+ IL EL+  LRE+I+N+NCR LVA++P F  AD +FV+ ++TKLKFEV+QPGD II+EGTIG KM+FIQ G+V ++TK G     LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DLN
Sbjct:  160 ASFMQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED-NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPRNCWVSINGMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHK--VQHDLN 679          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:HGNC Symbol;Acc:HGNC:4845])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 280/534 (52.43%), Postives = 391/534 (73.22%), Query Frame = 3
Query: 1053 DLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQ 2654
            D     R   +++ QF S  QP  NK +L++FG++ AV KE+ R +  G  +IHP S+FRFYWDL+ML++++ NL+++PV I+FF +  +  WI+FN  SDT+F+LD+ +NFRTG +  D + EIILDPK+I   Y+KSWF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+P+L ++P + WV    + +  W KQY++ALFKAMSHML IGYG   P S+S+ WIT++SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I +YYEHRYQGK+FDEE IL EL++ LRE+I+N+NCR LVA +P F  AD +FV+ +++KL+FEV+QPGD II+EG +G KM+FIQ G+  +ITK  +    L+DGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +I +
Sbjct:   83 DAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNED-SSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMD-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIAK 596          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN3 (hyperpolarization activated cyclic nucleotide gated potassium channel 3 [Source:HGNC Symbol;Acc:HGNC:19183])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 280/530 (52.83%), Postives = 390/530 (73.58%), Query Frame = 3
Query: 1089 KEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSR 2678
            +    +  QP+ NK +L++FG+  AV  E+ R +  G  +IHP S+FRFYWDL+ML+L++ NLIVLPV I+FF ++ S  WIVFN +SDT F+LD+ +NFRTGI+  + A EI+L P+ I  RY+++WF++DL+SSIP+DY+FLV+   P  +   ++ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV   ++ +  W +QY+ ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI  YYEHRYQGKMFDEE IL ELSE LRE+IIN+ CR LVA +P F +AD  FV+ V+TKL+FEV+QPGDL+++EG++G KM+FIQ G++ ++ + G   T L+DGSYFGEICLLT  +R ASVRA+TYC LYSL  +HF AVLE +P+MRR  E+VA +RL +IG+   I+  +
Sbjct:   46 RRHLGTLLQPTVNKFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKEENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGA-EILLAPRAIRTRYLRTWFLVDLISSIPVDYIFLVVELEPRLD---AEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCRGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLAR-GARDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVAMDRLLRIGKKNSILQRK 557          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 164.851 bits (416), Expect = 1.131e-41
Identity = 129/500 (25.80%), Postives = 225/500 (45.00%), Query Frame = 3
Query: 1209 IHPC-----SNFRFYWDLMMLVLLITNLIVLPVAISFFNDDL---------SLHWIVFNCVSDTIFILDIAVNFRTGIIT-NDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLML---LLGHWNACLQFLIPML-MEYPAESWVIKCNLKDAYWF---------------KQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQ-GKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTN--AKRVASVRAETYCNLYSLDAEHFQAVLENYP 2597
            IH C     S F+  WD ++L+L+I   +  P   +F   +L         +    + + + D +FI+DI +NFRT  +  ND A +++ DP  IA  Y K WFI+D+++++P D L +  N   D+           R LR+ R                   V++  ++Y                    S++ G   L+LLM    L+ HW AC+ + I    + +   +W+ + + + A  +                +Y  +L+  +S + SIG+G    T+ SE   TI+ M+ G+  YA   G+ +AIIQ   +    Y  +  ++ E++ + ++P  LRQR+  Y++H +      D  ++L    +CL+  I  +  R L++    F  +    +  +  + +     PGD ++  G I T ++FI  G V+I+  D  V   L     FGE  LL +   K   +VRA TYC+L+ +  +    VL+ YP
Sbjct:   68 IHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLVSTNS--DETTTLIGLLKTARLLRLVR-------------------VARKLDRY--------------------SEY-GAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 525          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 165.622 bits (418), Expect = 1.150e-41
Identity = 129/500 (25.80%), Postives = 225/500 (45.00%), Query Frame = 3
Query: 1209 IHPC-----SNFRFYWDLMMLVLLITNLIVLPVAISFFNDDL---------SLHWIVFNCVSDTIFILDIAVNFRTGIIT-NDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLML---LLGHWNACLQFLIPML-MEYPAESWVIKCNLKDAYWF---------------KQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQ-GKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTN--AKRVASVRAETYCNLYSLDAEHFQAVLENYP 2597
            IH C     S F+  WD ++L+L+I   +  P   +F   +L         +    + + + D +FI+DI +NFRT  +  ND A +++ DP  IA  Y K WFI+D+++++P D L +  N   D+           R LR+ R                   V++  ++Y                    S++ G   L+LLM    L+ HW AC+ + I    + +   +W+ + + + A  +                +Y  +L+  +S + SIG+G    T+ SE   TI+ M+ G+  YA   G+ +AIIQ   +    Y  +  ++ E++ + ++P  LRQR+  Y++H +      D  ++L    +CL+  I  +  R L++    F  +    +  +  + +     PGD ++  G I T ++FI  G V+I+  D  V   L     FGE  LL +   K   +VRA TYC+L+ +  +    VL+ YP
Sbjct:   68 IHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLVSTNS--DETTTLIGLLKTARLLRLVR-------------------VARKLDRY--------------------SEY-GAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 525          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 165.622 bits (418), Expect = 1.279e-41
Identity = 129/500 (25.80%), Postives = 225/500 (45.00%), Query Frame = 3
Query: 1209 IHPC-----SNFRFYWDLMMLVLLITNLIVLPVAISFFNDDL---------SLHWIVFNCVSDTIFILDIAVNFRTGIIT-NDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLML---LLGHWNACLQFLIPML-MEYPAESWVIKCNLKDAYWF---------------KQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQ-GKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTN--AKRVASVRAETYCNLYSLDAEHFQAVLENYP 2597
            IH C     S F+  WD ++L+L+I   +  P   +F   +L         +    + + + D +FI+DI +NFRT  +  ND A +++ DP  IA  Y K WFI+D+++++P D L +  N   D+           R LR+ R                   V++  ++Y                    S++ G   L+LLM    L+ HW AC+ + I    + +   +W+ + + + A  +                +Y  +L+  +S + SIG+G    T+ SE   TI+ M+ G+  YA   G+ +AIIQ   +    Y  +  ++ E++ + ++P  LRQR+  Y++H +      D  ++L    +CL+  I  +  R L++    F  +    +  +  + +     PGD ++  G I T ++FI  G V+I+  D  V   L     FGE  LL +   K   +VRA TYC+L+ +  +    VL+ YP
Sbjct:   98 IHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLVSTNS--DETTTLIGLLKTARLLRLVR-------------------VARKLDRY--------------------SEY-GAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 555          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 165.622 bits (418), Expect = 1.351e-41
Identity = 129/500 (25.80%), Postives = 225/500 (45.00%), Query Frame = 3
Query: 1209 IHPC-----SNFRFYWDLMMLVLLITNLIVLPVAISFFNDDL---------SLHWIVFNCVSDTIFILDIAVNFRTGIIT-NDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLML---LLGHWNACLQFLIPML-MEYPAESWVIKCNLKDAYWF---------------KQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQ-GKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTN--AKRVASVRAETYCNLYSLDAEHFQAVLENYP 2597
            IH C     S F+  WD ++L+L+I   +  P   +F   +L         +    + + + D +FI+DI +NFRT  +  ND A +++ DP  IA  Y K WFI+D+++++P D L +  N   D+           R LR+ R                   V++  ++Y                    S++ G   L+LLM    L+ HW AC+ + I    + +   +W+ + + + A  +                +Y  +L+  +S + SIG+G    T+ SE   TI+ M+ G+  YA   G+ +AIIQ   +    Y  +  ++ E++ + ++P  LRQR+  Y++H +      D  ++L    +CL+  I  +  R L++    F  +    +  +  + +     PGD ++  G I T ++FI  G V+I+  D  V   L     FGE  LL +   K   +VRA TYC+L+ +  +    VL+ YP
Sbjct:  106 IHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLVSTNS--DETTTLIGLLKTARLLRLVR-------------------VARKLDRY--------------------SEY-GAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 563          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 165.622 bits (418), Expect = 1.530e-41
Identity = 129/500 (25.80%), Postives = 225/500 (45.00%), Query Frame = 3
Query: 1209 IHPC-----SNFRFYWDLMMLVLLITNLIVLPVAISFFNDDL---------SLHWIVFNCVSDTIFILDIAVNFRTGIIT-NDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLML---LLGHWNACLQFLIPML-MEYPAESWVIKCNLKDAYWF---------------KQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQ-GKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTN--AKRVASVRAETYCNLYSLDAEHFQAVLENYP 2597
            IH C     S F+  WD ++L+L+I   +  P   +F   +L         +    + + + D +FI+DI +NFRT  +  ND A +++ DP  IA  Y K WFI+D+++++P D L +  N   D+           R LR+ R                   V++  ++Y                    S++ G   L+LLM    L+ HW AC+ + I    + +   +W+ + + + A  +                +Y  +L+  +S + SIG+G    T+ SE   TI+ M+ G+  YA   G+ +AIIQ   +    Y  +  ++ E++ + ++P  LRQR+  Y++H +      D  ++L    +CL+  I  +  R L++    F  +    +  +  + +     PGD ++  G I T ++FI  G V+I+  D  V   L     FGE  LL +   K   +VRA TYC+L+ +  +    VL+ YP
Sbjct:  140 IHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLVSTNS--DETTTLIGLLKTARLLRLVR-------------------VARKLDRY--------------------SEY-GAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 597          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0290110)

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 362/554 (65.34%), Postives = 455/554 (82.13%), Query Frame = 3
Query: 1074 ASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTC--------------DQGYLTFPQ---KFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSRED 2684
            ++++LK Q  S+FQP+DN+LA+KLFG++ A+ KER RQ+  G  VIHPCS+FRFYWDL ML+LL+ NLI+LPVAISFFNDDLS  WI FNC+SDTIF++DI VNFRTGI+  D A+++ILDPK+IA+ Y+++WF LDL+SSIP+DY+FL+ N   D ++++ Q  HAGR LRI RLAKLLS++RLLRLSRLVRYVSQWEE Y++                 D+  LT      KFLNMAS F+ I  L+ +MLL+GHW+ CLQFL+PML  +P+ SWV    L+++YW +QY+WALFKAMSHML IGYGRFPP S+++ W+T++SM++GATCYALF+GHA  +IQS D+S+R YREK KQVEEYMAYRKLPR +RQRI  Y+EHRYQGK FDEE+IL ELSE LRE +INYNCR+LVA+VPFF  AD +FVS+VVTKLK+EV+QPGD+IIKEGTIGTKM+FIQEG+VDI+  +GEVATSLSDGSYFGEICLLTNA+RVASVRAETYCNL+SL  +HF  VL+ YPLMR+TME+VAAERL+KIG+NP I+  +++
Sbjct:  701 SANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQ--DFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYILQNLQKKSADRRGRMNRKDKDGLTKSNLILKFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNPNIMHQKDE 1251          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0100369)

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 358/537 (66.67%), Postives = 448/537 (83.43%), Query Frame = 3
Query: 1074 ASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSRED 2684
            ++++LK Q  S+FQP+DN+LA+KLFG++ A+ KER RQ+  G  VIHPCS+FRFYWDL ML+LL+ NLI+LPVAISFFNDDLS  WI FNC+SDTIF++DI VNFRTGI+  D A+++ILDPK+IA+ Y+++WF LDL+SSIP+DY+FL+ N   D ++++ Q  HAGR LRI RLAKLLS++RLLRLSRLVRYVSQWEE Y               FLNMAS F+ I  L+ +MLL+GHW+ CLQFL+PML  +P+ SWV    L+++YW +QY+WALFKAMSHML IGYGRFPP S+++ W+T++SM++GATCYALF+GHA  +IQS D+S+R YREK KQVEEYMAYRKLPR +RQRI  Y+EHRYQGK FDEE+IL ELSE LRE +INYNCR+LVA+VPFF  AD +FVS+VVTKLK+EV+QPGD+IIKEGTIGTKM+FIQEG+VDI+  +GEVATSLSDGSYFGEICLLTNA+RVASVRAETYCNL+SL  +HF  VL+ YPLMR+TME+VAAERL+KIG+NP I+  +++
Sbjct:  701 SANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQ--DFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVY---------------FLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNPNIMHQKDE 1219          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0100372)

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 363/557 (65.17%), Postives = 455/557 (81.69%), Query Frame = 3
Query: 1074 ASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYS---QFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTC--------------DQGYLTFPQ---KFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSRED 2684
            ++++LK Q  S+FQP+DN+LA+KLFG++ A+ KER RQ+  G  VIHPCS+FRFYWDL ML+LL+ NLI+LPVAISFFNDDLS  WI FNC+SDTIF++DI VNFRTGI+  D A+++ILDPK+IA+ Y+++WF LDL+SSIP+DY+FL+ N    K +++S   Q  HAGR LRI RLAKLLS++RLLRLSRLVRYVSQWEE Y++                 D+  LT      KFLNMAS F+ I  L+ +MLL+GHW+ CLQFL+PML  +P+ SWV    L+++YW +QY+WALFKAMSHML IGYGRFPP S+++ W+T++SM++GATCYALF+GHA  +IQS D+S+R YREK KQVEEYMAYRKLPR +RQRI  Y+EHRYQGK FDEE+IL ELSE LRE +INYNCR+LVA+VPFF  AD +FVS+VVTKLK+EV+QPGD+IIKEGTIGTKM+FIQEG+VDI+  +GEVATSLSDGSYFGEICLLTNA+RVASVRAETYCNL+SL  +HF  VL+ YPLMR+TME+VAAERL+KIG+NP I+  +++
Sbjct:  701 SANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQ-IMKLQDFSDSFQILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYILQNLQKKSADRRGRMNRKDKDGLTKSNLILKFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNPNIMHQKDE 1256          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0290109)

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 359/540 (66.48%), Postives = 448/540 (82.96%), Query Frame = 3
Query: 1074 ASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYS---QFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSRED 2684
            ++++LK Q  S+FQP+DN+LA+KLFG++ A+ KER RQ+  G  VIHPCS+FRFYWDL ML+LL+ NLI+LPVAISFFNDDLS  WI FNC+SDTIF++DI VNFRTGI+  D A+++ILDPK+IA+ Y+++WF LDL+SSIP+DY+FL+ N    K +++S   Q  HAGR LRI RLAKLLS++RLLRLSRLVRYVSQWEE Y               FLNMAS F+ I  L+ +MLL+GHW+ CLQFL+PML  +P+ SWV    L+++YW +QY+WALFKAMSHML IGYGRFPP S+++ W+T++SM++GATCYALF+GHA  +IQS D+S+R YREK KQVEEYMAYRKLPR +RQRI  Y+EHRYQGK FDEE+IL ELSE LRE +INYNCR+LVA+VPFF  AD +FVS+VVTKLK+EV+QPGD+IIKEGTIGTKM+FIQEG+VDI+  +GEVATSLSDGSYFGEICLLTNA+RVASVRAETYCNL+SL  +HF  VL+ YPLMR+TME+VAAERL+KIG+NP I+  +++
Sbjct:  701 SANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQ-IMKLQDFSDSFQILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVY---------------FLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNPNIMHQKDE 1224          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0290292)

HSP 1 Score: 738.413 bits (1905), Expect = 0.000e+0
Identity = 358/537 (66.67%), Postives = 448/537 (83.43%), Query Frame = 3
Query: 1074 ASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSRED 2684
            ++++LK Q  S+FQP+DN+LA+KLFG++ A+ KER RQ+  G  VIHPCS+FRFYWDL ML+LL+ NLI+LPVAISFFNDDLS  WI FNC+SDTIF++DI VNFRTGI+  D A+++ILDPK+IA+ Y+++WF LDL+SSIP+DY+FL+ N   D ++++ Q  HAGR LRI RLAKLLS++RLLRLSRLVRYVSQWEE Y               FLNMAS F+ I  L+ +MLL+GHW+ CLQFL+PML  +P+ SWV    L+++YW +QY+WALFKAMSHML IGYGRFPP S+++ W+T++SM++GATCYALF+GHA  +IQS D+S+R YREK KQVEEYMAYRKLPR +RQRI  Y+EHRYQGK FDEE+IL ELSE LRE +INYNCR+LVA+VPFF  AD +FVS+VVTKLK+EV+QPGD+IIKEGTIGTKM+FIQEG+VDI+  +GEVATSLSDGSYFGEICLLTNA+RVASVRAETYCNL+SL  +HF  VL+ YPLMR+TME+VAAERL+KIG+NP I+  +++
Sbjct:   12 SANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQ--DFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVY---------------FLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNPNIMHQKDE 530          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn4 (hyperpolarization activated cyclic nucleotide-gated potassium channel 4 [Source:ZFIN;Acc:ZDB-GENE-050420-360])

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 296/542 (54.61%), Postives = 405/542 (74.72%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            + ++  QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D A EIILDP+ I  +Y++SWF++D +SSIP+DY+FL++    D     S F+   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++PA+ WV K  + +  W +QY++ALFKAMSHML IGYG +PP  +++ W+TI+SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMFDEE IL EL+E LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD II+EGTIG KM+FIQ G+V ++TK G   T LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DLN
Sbjct:  172 AGFMHRQFGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDEHTPPWIVFNVVSDTFFLMDLVLNFRTGIVKEDNA-EIILDPQQIKIKYLRSWFVVDFISSIPVDYIFLIVETRID-----SDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPADCWVAKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSIL--QHKVQHDLN 691          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn4l (hyperpolarization activated cyclic nucleotide-gated potassium channel 4l [Source:ZFIN;Acc:ZDB-GENE-110411-3])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 295/558 (52.87%), Postives = 408/558 (73.12%), Query Frame = 3
Query: 1062 NKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTP 2735
              S+  + LK   F+F  P  NK +L++FG++ AV  E+ R +  G  +IHP S+FRFYWDL+ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D + EIILDP+ I  RY++SWF +D LSSIP+DY+FL++    D     S F+   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P++ WV K  + +  W +QY++ALFKAMSHML IGYG +PP  +++ W+TI+SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMFDEE IL EL+E LRE+II++NCR LVA +P F  AD +FV+ ++TKL+FEV+QPGD II+EGT+G KM+FIQ G++ ++TK G   T +SDGSYFGEICLLT  +R ASVRA+TYC LYSL  +HF  VLE YP+MRR  E+VA +RL +IG++       E +++ +   +++  S TP
Sbjct:   10 KPSKNQTALKRHLFTFLLPGVNKFSLRMFGSEKAVEHEQERVKSAGFWIIHPYSDFRFYWDLIMLLLMVGNLIIIPVGITFFKDEHTPAWIVFNVVSDTFFLVDLVLNFRTGIVKED-STEIILDPQQIKVRYLRSWFAVDFLSSIPVDYIFLIVETRID-----SDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVAKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIISFNCRKLVATMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVLTVLTK-GSKETKISDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFETVALDRLDRIGESFLNYQENEIIQQIVQHDRDMAHSPTP 547          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn4 (hyperpolarization activated cyclic nucleotide-gated potassium channel 4 [Source:ZFIN;Acc:ZDB-GENE-050420-360])

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 294/542 (54.24%), Postives = 401/542 (73.99%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            + ++  QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D A EIILDP+ I  +Y++SWF++D +SSIP+DY+FL++    D     S F+   R LRI R  K+LS+LRLLRLSRL+RY+       L       +L F   + ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++PA+ WV K  + +  W +QY++ALFKAMSHML IGYG +PP  +++ W+TI+SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMFDEE IL EL+E LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD II+EGTIG KM+FIQ G+V ++TK G   T LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DLN
Sbjct:  152 AGFMHRQFGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDEHTPPWIVFNVVSDTFFLMDLVLNFRTGIVKEDNA-EIILDPQQIKIKYLRSWFVVDFISSIPVDYIFLIVETRID-----SDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHHTHTTIL-------HLIFHMTY-DLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPADCWVAKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILQHK--VQHDLN 676          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn2b (hyperpolarization activated cyclic nucleotide-gated potassium channel 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8228])

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 287/541 (53.05%), Postives = 402/541 (74.31%), Query Frame = 3
Query: 1080 SYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            +Y++ QF +  QP  NK +L++FG++ AV KE+ R +  G  +IHP S+FRFYWD  ML+ ++ NLI++PV I+FF ++ +  WI+FN VSDT F++D+ +NFRTGI+  D   EIILDP+ I ++Y+K+WF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P++ WV    + +  W + Y++ALFKAMSHML IGYGR  P S+S+ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMFDEE IL EL+E LRE+I+N+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD II+EGTIG KM+FIQ G+V ++TK G +   LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DLN
Sbjct:   80 TYMQRQFSAMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKEETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYED-NTEIILDPEKIKKKYLKTWFVVDFVSSIPVDYIFLIVEKGID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILMHK--VQHDLN 598          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn1 (hyperpolarization activated cyclic nucleotide-gated potassium channel 1 [Source:ZFIN;Acc:ZDB-GENE-110520-1])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 287/550 (52.18%), Postives = 406/550 (73.82%), Query Frame = 3
Query: 1053 DLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            D++  SR   +++ QF +  QP  NK +L++FG++ AV KE+ R Q  G  +IHP S+FRFYWDL+ML++++ NLI++PV I+FF++  +  W+VFN  SDTIF++D+ +NFRTGI+ N+ + EIILDPK+I   Y+KSWF++D LSSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+P+L ++P + WV    + +  W KQY++ALFKAMSHML IGYG   P S+S+ WIT++SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I +YYEHRYQGK+FDE+ IL EL++ L+E+I+N+NCR LVA +P F  AD +FV+ +++KLKFEV+QP D II+EGT+G KM+FIQ G+  +ITK  +    L+DGSYFGEICLLT  +R ASVRA+TYC L+SL  +HF  VLE YP+MRR  E+VA +RL +IG+   ++   +  ++DLN
Sbjct:   60 DIDAASRQYGFMQRQFGAMMQPGVNKFSLRMFGSQKAVEKEQERVQTAGYWIIHPYSDFRFYWDLIMLIMMMGNLIIIPVGITFFSEQTTTSWLVFNVASDTIFLVDLVMNFRTGIV-NEESSEIILDPKVIKMNYLKSWFVVDFLSSIPVDYIFLIVEKGFD-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNGMVNDSWGKQYSYALFKAMSHMLCIGYGARAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEDSILNELNDPLKEEIVNFNCRKLVATMPLFANADPNFVTGMLSKLKFEVFQPNDYIIREGTVGKKMYFIQHGVASVITKFNK-ELKLTDGSYFGEICLLTKGRRTASVRADTYCRLFSLSVDHFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSLL--LQKFQKDLN 587          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054882.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 292/533 (54.78%), Postives = 397/533 (74.48%), Query Frame = 3
Query: 1059 NNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQN 2657
              +    S++  QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF ++ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIIL+P+ I  RY+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R AK+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV   ++++A W KQY++ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  LRQRI +YYEHRYQGKMFDEE IL ELSE LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD +I+EGT+G KMFFIQ G+V I++K G   T LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  +HF  VLE YP+MRR  ESVA +RL +IG+ 
Sbjct:  170 GGEDEQGSFMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLED-NTEIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVETRID-----SEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESVALDRLDRIGKK 682          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054880.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 292/533 (54.78%), Postives = 397/533 (74.48%), Query Frame = 3
Query: 1059 NNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQN 2657
              +    S++  QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF ++ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIIL+P+ I  RY+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R AK+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV   ++++A W KQY++ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  LRQRI +YYEHRYQGKMFDEE IL ELSE LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD +I+EGT+G KMFFIQ G+V I++K G   T LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  +HF  VLE YP+MRR  ESVA +RL +IG+ 
Sbjct:   65 GGEDEQGSFMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLED-NTEIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVETRID-----SEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESVALDRLDRIGKK 577          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054879.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 292/533 (54.78%), Postives = 397/533 (74.48%), Query Frame = 3
Query: 1059 NNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQN 2657
              +    S++  QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF ++ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIIL+P+ I  RY+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R AK+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV   ++++A W KQY++ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  LRQRI +YYEHRYQGKMFDEE IL ELSE LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD +I+EGT+G KMFFIQ G+V I++K G   T LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  +HF  VLE YP+MRR  ESVA +RL +IG+ 
Sbjct:   18 GGEDEQGSFMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLED-NTEIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVETRID-----SEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESVALDRLDRIGKK 530          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054883.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 292/533 (54.78%), Postives = 397/533 (74.48%), Query Frame = 3
Query: 1059 NNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQN 2657
              +    S++  QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF ++ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIIL+P+ I  RY+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R AK+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV   ++++A W KQY++ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  LRQRI +YYEHRYQGKMFDEE IL ELSE LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD +I+EGT+G KMFFIQ G+V I++K G   T LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  +HF  VLE YP+MRR  ESVA +RL +IG+ 
Sbjct:   40 GGEDEQGSFMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLED-NTEIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVETRID-----SEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESVALDRLDRIGKK 552          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054881.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 292/533 (54.78%), Postives = 397/533 (74.48%), Query Frame = 3
Query: 1059 NNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQN 2657
              +    S++  QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF ++ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIIL+P+ I  RY+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R AK+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV   ++++A W KQY++ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  LRQRI +YYEHRYQGKMFDEE IL ELSE LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD +I+EGT+G KMFFIQ G+V I++K G   T LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  +HF  VLE YP+MRR  ESVA +RL +IG+ 
Sbjct:   32 GGEDEQGSFMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLED-NTEIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVETRID-----SEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESVALDRLDRIGKK 544          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn4 (hyperpolarization-activated, cyclic nucleotide-gated K+ 4 [Source:MGI Symbol;Acc:MGI:1298209])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 294/542 (54.24%), Postives = 401/542 (73.99%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            S +++ QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIILDP+ I  +Y+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV    + +  W KQY++ALFKAMSHML IGYGR  P  +S+ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI +YYEHRYQGKMFDEE IL ELSE LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD II+EGTIG KM+FIQ G+V ++TK G   T L+DGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DLN
Sbjct:  211 SGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVED-NTEIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVETRID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSINGMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHK--VQHDLN 730          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn2 (hyperpolarization-activated, cyclic nucleotide-gated K+ 2 [Source:MGI Symbol;Acc:MGI:1298210])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 285/535 (53.27%), Postives = 398/535 (74.39%), Query Frame = 3
Query: 1065 KSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIV 2669
            +   +S+L+ QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWD  ML+ ++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIILDP+ I ++Y+++WF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + IC L+ +MLLL HW+ CLQFL+PML ++P++ WV   N+ +  W + Y++ALFKAMSHML IGYGR  P S+++ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMFDE+ IL EL+  LRE+I+N+NCR LVA++P F  AD +FV+ ++TKLKFEV+QPGD II+EGTIG KM+FIQ G+V ++TK G     LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+
Sbjct:  129 RGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED-NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL 643          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn2 (hyperpolarization-activated, cyclic nucleotide-gated K+ 2 [Source:MGI Symbol;Acc:MGI:1298210])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 285/535 (53.27%), Postives = 398/535 (74.39%), Query Frame = 3
Query: 1065 KSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIV 2669
            +   +S+L+ QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWD  ML+ ++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIILDP+ I ++Y+++WF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + IC L+ +MLLL HW+ CLQFL+PML ++P++ WV   N+ +  W + Y++ALFKAMSHML IGYGR  P S+++ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMFDE+ IL EL+  LRE+I+N+NCR LVA++P F  AD +FV+ ++TKLKFEV+QPGD II+EGTIG KM+FIQ G+V ++TK G     LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+
Sbjct:  129 RGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED-NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL 643          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:MGI Symbol;Acc:MGI:1096392])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 289/577 (50.09%), Postives = 408/577 (70.71%), Query Frame = 3
Query: 1053 DLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSR---------------EDLKEDLNLVKEIVSSVTPI 2738
            D     R   +++ QF S  QP  NK +L++FG++ AV KE+ R +  G  +IHP S+FRFYWDL+ML++++ NL+++PV I+FF +  +  WI+FN  SDT+F+LD+ +NFRTG +  D + EIILDPK+I   Y+KSWF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+P+L ++P + WV    + +  W KQY++ALFKAMSHML IGYG   P S+S+ WIT++SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I +YYEHRYQGK+FDEE IL EL++ LRE+I+N+NCR LVA +P F  AD +FV+ +++KL+FEV+QPGD II+EG +G KM+FIQ G+  +ITK  +    L+DGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +               E LK+ +   +E+V ++ PI
Sbjct:   72 DAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNED-SSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMD-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIPPI 628          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn3 (hyperpolarization-activated, cyclic nucleotide-gated K+ 3 [Source:MGI Symbol;Acc:MGI:1298211])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 281/530 (53.02%), Postives = 391/530 (73.77%), Query Frame = 3
Query: 1089 KEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSR 2678
            + Q  +  QP+ NK +L++FG+  AV  E+ R +  G  +IHP S+FRFYWDL+ML+L++ NLIVLPV I+FF ++ S  WIVFN +SDT F+LD+ +NFRTGI+  + A EI+L P+ I  RY+++WF++DL+SSIP+DY+FLV+   P  +   ++ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P++ WV    + +  W +QY+ ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI  YYEHRYQGKMFDEE IL ELSE LRE+IIN+ CR LVA +P F +AD  FV+ V+TKL+FEV+QPGDL+++EG++G KM+FIQ G++ ++ + G   T L+DGSYFGEICLLT  +R ASVRA+TYC LYSL  +HF AVLE +P+MRR  E+VA +RL +IG+   I+  +
Sbjct:   45 RRQLGTLLQPTVNKFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKEENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGA-EILLAPRAIRTRYLRTWFLVDLISSIPVDYIFLVVELEPRLD---AEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSMNRMVNHSWGRQYSHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCRGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLAR-GARDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVAMDRLRRIGKKNSILQRK 556          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9Y3Q4|HCN4_HUMAN (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Homo sapiens OX=9606 GN=HCN4 PE=1 SV=1)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 294/542 (54.24%), Postives = 402/542 (74.17%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            + +++ QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIILDP+ I  +Y+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV   N+ +  W KQY++ALFKAMSHML IGYGR  P  +S+ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI +YYEHRYQGKMFDEE IL ELSE LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD II+EGTIG KM+FIQ G+V ++TK G   T L+DGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DLN
Sbjct:  211 AGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVED-NTEIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVETRID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHK--VQHDLN 730          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9TV66|HCN4_RABIT (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Oryctolagus cuniculus OX=9986 GN=HCN4 PE=2 SV=1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 291/531 (54.80%), Postives = 396/531 (74.58%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIV 2669
            + +++ QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D  D IILDP+ I  +Y+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV   N+ +  W KQY++ALFKAMSHML IGYGR  P  +S+ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI +YYEHRYQGKMFDEE IL ELSE LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD II+EGTIG KM+FIQ G+V ++TK G   T L+DGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+
Sbjct:  212 AGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVEDNTD-IILDPRRIKMKYLKSWFVVDFVSSIPVDYIFLIVETRID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSLNNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPMGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSIL 722          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9JKA7|HCN4_RAT (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Rattus norvegicus OX=10116 GN=Hcn4 PE=1 SV=1)

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 294/542 (54.24%), Postives = 401/542 (73.99%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            S +++ QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIILDP+ I  +Y+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV    + +  W KQY++ALFKAMSHML IGYGR  P  +S+ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI +YYEHRYQGKMFDEE IL ELSE LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD II+EGTIG KM+FIQ G+V ++TK G   T L+DGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DLN
Sbjct:  211 SGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVED-NTEIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVETRID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSINGMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHK--VQHDLN 730          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9JKA9|HCN2_RAT (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Rattus norvegicus OX=10116 GN=Hcn2 PE=1 SV=3)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 285/535 (53.27%), Postives = 398/535 (74.39%), Query Frame = 3
Query: 1065 KSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIV 2669
            +   +S+L+ QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWD  ML+ ++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIILDP+ I ++Y+++WF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + IC L+ +MLLL HW+ CLQFL+PML ++P++ WV   N+ +  W + Y++ALFKAMSHML IGYGR  P S+++ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMFDE+ IL EL+  LRE+I+N+NCR LVA++P F  AD +FV+ ++TKLKFEV+QPGD II+EGTIG KM+FIQ G+V ++TK G     LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+
Sbjct:  129 RGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED-NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL 643          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|O88703|HCN2_MOUSE (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Mus musculus OX=10090 GN=Hcn2 PE=1 SV=1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 285/535 (53.27%), Postives = 398/535 (74.39%), Query Frame = 3
Query: 1065 KSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIV 2669
            +   +S+L+ QF +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWD  ML+ ++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIILDP+ I ++Y+++WF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + IC L+ +MLLL HW+ CLQFL+PML ++P++ WV   N+ +  W + Y++ALFKAMSHML IGYGR  P S+++ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMFDE+ IL EL+  LRE+I+N+NCR LVA++P F  AD +FV+ ++TKLKFEV+QPGD II+EGTIG KM+FIQ G+V ++TK G     LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+
Sbjct:  129 RGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED-NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL 643          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A267GGH4 (Cyclic nucleotide-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003625g4 PE=4 SV=1)

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 471/628 (75.00%), Postives = 527/628 (83.92%), Query Frame = 3
Query: 1050 GDLNN-KSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSXXXXXKCNPDECENLMQSNSSMNARXXXXXXXXXXCRNSFSQRKSALRQGIQNVLRLTKSKS 2930
            G+L + K   SSYLKEQFF+FFQPSDNKLA+KLFGNKNA+ KE+RRQQQ GK +IHPCSNFRFYWDL+MLVLLITNL+VLPVAISFFNDDLS  WI+FNCVSDTIF+ DIAVNFRTG+ITNDFA+EI+LDPK+IA+ Y+KSWF LDL+SSIPMDY+FLVLN    +  N SQ  HAGR LRI RLAKLLS+LRLLRLSRLVRYVSQWEE                 F  +ASK  GI KLVL+M+LLGHWNAC QFLIP L ++P +SWV K  LK+A+WF+QYTWALFKAMSHMLSIGYG+ PPTSISEAWITIVSMMTG++CYALFVGHAAA+IQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMF+E  IL ELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVT+LK+EV+QPGDLIIKEGTIGTKM+FIQEGIVDIIT+DGEVATSLSDGSYFGEICLLTNA+RVASVRAETYCNLYSL+ E+F +VL+NYPLMRRTMESVAAERLSKIGQNPQ+VSSR DLKEDLNLVKEIV+ VTP  SDD     N D C     + +   +        S        +RKS ++ G+Q +   +KSKS
Sbjct:  286 GELEDPKQSTSSYLKEQFFAFFQPSDNKLAMKLFGNKNALLKEKRRQQQSGKWIIHPCSNFRFYWDLLMLVLLITNLVVLPVAISFFNDDLSPQWIIFNCVSDTIFLSDIAVNFRTGVITNDFAEEIVLDPKMIAQHYMKSWFFLDLISSIPMDYIFLVLN----QRNNMSQLMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEE-----------------FFQIASKCFGIIKLVLIMMLLGHWNACFQFLIPFLNDFPPDSWVAKRGLKEAHWFRQYTWALFKAMSHMLSIGYGQHPPTSISEAWITIVSMMTGSSCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFNENDILSELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTRLKYEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITRDGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLYSLERENFLSVLDNYPLMRRTMESVAAERLSKIGQNPQLVSSRADLKEDLNLVKEIVNQVTPATSDD-----NDDSCGGGAGAGACGGSAVCGDGKKSSPPHTE--RRKSVVKLGLQKLGLSSKSKS 885          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A267GPW9 (Cyclic nucleotide-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003625g3 PE=4 SV=1)

HSP 1 Score: 909.442 bits (2349), Expect = 0.000e+0
Identity = 471/628 (75.00%), Postives = 527/628 (83.92%), Query Frame = 3
Query: 1050 GDLNN-KSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSXXXXXKCNPDECENLMQSNSSMNARXXXXXXXXXXCRNSFSQRKSALRQGIQNVLRLTKSKS 2930
            G+L + K   SSYLKEQFF+FFQPSDNKLA+KLFGNKNA+ KE+RRQQQ GK +IHPCSNFRFYWDL+MLVLLITNL+VLPVAISFFNDDLS  WI+FNCVSDTIF+ DIAVNFRTG+ITNDFA+EI+LDPK+IA+ Y+KSWF LDL+SSIPMDY+FLVLN    +  N SQ  HAGR LRI RLAKLLS+LRLLRLSRLVRYVSQWEE                 F  +ASK  GI KLVL+M+LLGHWNAC QFLIP L ++P +SWV K  LK+A+WF+QYTWALFKAMSHMLSIGYG+ PPTSISEAWITIVSMMTG++CYALFVGHAAA+IQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMF+E  IL ELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVT+LK+EV+QPGDLIIKEGTIGTKM+FIQEGIVDIIT+DGEVATSLSDGSYFGEICLLTNA+RVASVRAETYCNLYSL+ E+F +VL+NYPLMRRTMESVAAERLSKIGQNPQ+VSSR DLKEDLNLVKEIV+ VTP  SDD     N D C     + +   +        S        +RKS ++ G+Q +   +KSKS
Sbjct:  290 GELEDPKQSTSSYLKEQFFAFFQPSDNKLAMKLFGNKNALLKEKRRQQQSGKWIIHPCSNFRFYWDLLMLVLLITNLVVLPVAISFFNDDLSPQWIIFNCVSDTIFLSDIAVNFRTGVITNDFAEEIVLDPKMIAQHYMKSWFFLDLISSIPMDYIFLVLN----QRNNMSQLMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEE-----------------FFQIASKCFGIIKLVLIMMLLGHWNACFQFLIPFLNDFPPDSWVAKRGLKEAHWFRQYTWALFKAMSHMLSIGYGQHPPTSISEAWITIVSMMTGSSCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFNENDILSELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTRLKYEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITRDGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLYSLERENFLSVLDNYPLMRRTMESVAAERLSKIGQNPQLVSSRADLKEDLNLVKEIVNQVTPATSDD-----NDDSCGGGAGAGACGGSAVCGDGKKSSPPHTE--RRKSVVKLGLQKLGLSSKSKS 889          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A4Z2DGN8 (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_001166 PE=4 SV=1)

HSP 1 Score: 900.197 bits (2325), Expect = 0.000e+0
Identity = 455/576 (78.99%), Postives = 502/576 (87.15%), Query Frame = 3
Query: 1065 KSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSS-VTPIGSXXXXXKCNPDECENL 2789
            K   SSYLKEQF +FFQPSDNKLA+KLFG+KNA+ KE+RRQ QQGK VIHPCSNFRFYWDL+ML+LLI NLI+LPVAISFFNDDLS+HWI+FN +SD +FI DIAV FRTG++ ND+ADEIIL+PK IAR Y+KSWF+LD +SSIPMDYL+L+ N    K ++Y+QFF AGRTLRI RLAKLLSMLRLLRL+RLVRYVSQWEE                 FLN+ASKF+GI  LVLLMLLLGHWNACLQ+LIPMLME+P +SWV +C L++A WF+QYTWALFKAMSHMLSIGYGRFPPTSI EAWITIVSMM+GATCYALFVGHAAA+IQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDE  IL E SECLREQ+INYNCRALVAAVPFFTYADQDFVSEVVTKLKFEV+QPGDLIIKEGTIG KM+FIQEGIVDIITKDGEVATSLSDGSYFGEI LLTNA+RVASV+A  Y NLYSLD E F +VLENYPLMRRTMESVAAERL+KIGQNP IVS+REDLKEDL+LVKEIVSS VTP  S    +  N D   +L
Sbjct:  592 KQSTSSYLKEQFQAFFQPSDNKLAMKLFGSKNALLKEKRRQVQQGKWVIHPCSNFRFYWDLLMLMLLIANLIILPVAISFFNDDLSIHWIIFNSISDVVFIADIAVKFRTGVVANDYADEIILNPKEIARHYLKSWFVLDFISSIPMDYLYLIFN----KKDHYNQFFSAGRTLRILRLAKLLSMLRLLRLTRLVRYVSQWEE-----------------FLNIASKFMGIFNLVLLMLLLGHWNACLQYLIPMLMEFPPDSWVKRCKLENADWFQQYTWALFKAMSHMLSIGYGRFPPTSIGEAWITIVSMMSGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEAQILNEFSECLREQVINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVFQPGDLIIKEGTIGNKMYFIQEGIVDIITKDGEVATSLSDGSYFGEITLLTNARRVASVKAVVYSNLYSLDRESFLSVLENYPLMRRTMESVAAERLNKIGQNPSIVSNREDLKEDLSLVKEIVSSAVTPEDSSSGQETENDDNQAHL 1146          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A068WH89 (Hyperpolarization activated cyclic OS=Echinococcus granulosus OX=6210 GN=EgrG_001053800 PE=4 SV=1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 455/556 (81.83%), Postives = 494/556 (88.85%), Query Frame = 3
Query: 1062 NKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSV 2729
            +K   SSYLKEQFF+FFQPSDNKLA+KLFG+K+A+NKE+RRQQQ GK +IHPCS+FRFYWDL+ML LLI NLI+LPVAISFF DDL  HWIVFN VSD +FI DIAV FRTGIITND+ADEIILDPK IAR+YV+SWF+LDL+SSIPMDY+F VLN    K+ENY+Q   AGRTLRI RLAKLLSMLRLLRL+RLVRYVSQWEE                 FLN+ASKF+GI  LVLLMLLLGHWNACLQFLIP+LM+YP +SWV +C LKDA WF+QYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAA+IQSFDTSKR YREKFKQVEEYMAYRKLPRALRQRIA+YYEHRYQGKMFDE  IL ELSECLREQIINYNCR LVAAVPFFTYADQDFVSE+V  LKFEV+QPGDLIIKEGTIGTKM+FIQEGIVDIITKDGE+AT+LSDGSYFGEICLLTNAKRVASVRAE Y NLYSLD + F AVL+NYPLMRRTMESVAAERLSKIGQNP IVS+R DLK DL+LVKEIVSSV
Sbjct:  376 SKQSTSSYLKEQFFAFFQPSDNKLAMKLFGSKSALNKEKRRQQQHGKWIIHPCSSFRFYWDLLMLTLLIANLIILPVAISFFYDDLRAHWIVFNSVSDAVFIADIAVKFRTGIITNDYADEIILDPKEIARQYVRSWFLLDLISSIPMDYIFWVLN----KHENYNQILTAGRTLRILRLAKLLSMLRLLRLTRLVRYVSQWEE-----------------FLNIASKFMGIFNLVLLMLLLGHWNACLQFLIPLLMDYPEDSWVQRCRLKDADWFEQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRHYREKFKQVEEYMAYRKLPRALRQRIADYYEHRYQGKMFDEAQILQELSECLREQIINYNCRELVAAVPFFTYADQDFVSEMVANLKFEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITKDGEIATTLSDGSYFGEICLLTNAKRVASVRAEVYSNLYSLDRDSFLAVLDNYPLMRRTMESVAAERLSKIGQNPSIVSARADLKADLSLVKEIVSSV 910          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A068YDH1 (Hyperpolarization activated cyclic OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001053800 PE=4 SV=1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 455/556 (81.83%), Postives = 494/556 (88.85%), Query Frame = 3
Query: 1062 NKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSV 2729
            +K   SSYLKEQFF+FFQPSDNKLA+KLFG+K+A+NKE+RRQQQ GK +IHPCS+FRFYWDL+ML LLI NLI+LPVAISFF DDL  HWIVFN VSD +FI DIAV FRTGIITND+ADEIILDPK IAR+YV+SWF+LDL+SSIPMDY+F VLN    K+ENY+Q   AGRTLRI RLAKLLSMLRLLRL+RLVRYVSQWEE                 FLN+ASKF+GI  LVLLMLLLGHWNACLQFLIP+LM+YP +SWV +C LKDA WF+QYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAA+IQSFDTSKR YREKFKQVEEYMAYRKLPRALRQRIA+YYEHRYQGKMFDE  IL ELSECLREQIINYNCR LVAAVPFFTYADQDFVSE+V  LKFEV+QPGDLIIKEGTIGTKM+FIQEGIVDIITKDGE+AT+LSDGSYFGEICLLTNAKRVASVRAE Y NLYSLD + F AVL+NYPLMRRTMESVAAERLSKIGQNP IVS+R DLK DL+LVKEIVSSV
Sbjct:  403 SKQSTSSYLKEQFFAFFQPSDNKLAMKLFGSKSALNKEKRRQQQHGKWIIHPCSSFRFYWDLLMLTLLIANLIILPVAISFFYDDLRAHWIVFNSVSDAVFIADIAVKFRTGIITNDYADEIILDPKEIARQYVRSWFLLDLISSIPMDYIFWVLN----KHENYNQILTAGRTLRILRLAKLLSMLRLLRLTRLVRYVSQWEE-----------------FLNIASKFMGIFNLVLLMLLLGHWNACLQFLIPLLMDYPEDSWVQRCRLKDADWFEQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRHYREKFKQVEEYMAYRKLPRALRQRIADYYEHRYQGKMFDEAQILQELSECLREQIINYNCRELVAAVPFFTYADQDFVSEMVANLKFEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITKDGEIATTLSDGSYFGEICLLTNAKRVASVRAEVYSNLYSLDRDSFLAVLDNYPLMRRTMESVAAERLSKIGQNPAIVSARADLKADLSLVKEIVSSV 937          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn4l (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3-like [Source:NCBI gene;Acc:103030119])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 291/542 (53.69%), Postives = 404/542 (74.54%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            + ++  Q  +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL+ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D + EIILDP++I  RY++SWF +D +SSIP+DY+FL++    D     S F+   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P++ WV K  + +  W +QY++ALFKAMSHML IGYG +PP  +++ W+TI+SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMFDEE IL EL+E LRE+II++NCR LVA +P F  AD +FV+ ++TKL+FEV+QPGD II+EGT+G KM+FIQ G++ ++TK G   T +SDGSYFGEICLLT  +R ASVRAETYC LYSL  +HF  VLE YP+MRR  E+VA +RL +IG+   ++  +  ++ DLN
Sbjct:  159 AGFMHRQLGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLIMLLLMVGNLIIIPVGITFFKDEHTPAWIVFNVVSDTFFLVDLVLNFRTGIVKED-STEIILDPQLIKVRYLRSWFAVDFISSIPVDYIFLIVETRID-----SDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIISFNCRKLVATMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVLTVLTK-GSKETKISDGSYFGEICLLTRGRRTASVRAETYCRLYSLSVDHFNEVLEEYPMMRRAFETVALDRLDRIGKRNSVLQHK--VQRDLN 678          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn4l (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3-like [Source:NCBI gene;Acc:103030119])

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 291/542 (53.69%), Postives = 404/542 (74.54%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            + ++  Q  +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL+ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D + EIILDP++I  RY++SWF +D +SSIP+DY+FL++    D     S F+   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P++ WV K  + +  W +QY++ALFKAMSHML IGYG +PP  +++ W+TI+SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMFDEE IL EL+E LRE+II++NCR LVA +P F  AD +FV+ ++TKL+FEV+QPGD II+EGT+G KM+FIQ G++ ++TK G   T +SDGSYFGEICLLT  +R ASVRAETYC LYSL  +HF  VLE YP+MRR  E+VA +RL +IG+   ++  +  ++ DLN
Sbjct:  180 AGFMHRQLGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLIMLLLMVGNLIIIPVGITFFKDEHTPAWIVFNVVSDTFFLVDLVLNFRTGIVKED-STEIILDPQLIKVRYLRSWFAVDFISSIPVDYIFLIVETRID-----SDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIISFNCRKLVATMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVLTVLTK-GSKETKISDGSYFGEICLLTRGRRTASVRAETYCRLYSLSVDHFNEVLEEYPMMRRAFETVALDRLDRIGKRNSVLQHK--VQRDLN 699          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn2b (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 [Source:NCBI gene;Acc:103044493])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 294/570 (51.58%), Postives = 411/570 (72.11%), Query Frame = 3
Query: 1041 QTNGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN----------LVKEIV 2720
            Q  GD      A ++++ QF S  QP  NK +L++FG++ AV KE+ R +  G  +IHP S+FRFYWD  ML+ ++ NLI++PV I+FF D+ +  WI+FN VSDT F++D+ +NFRTGI+  D   EIILDPK I ++Y+++WF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P++ WV    + +  W + Y++ALFKAMSHML IGYGR  P S+S+ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMFDEE IL EL+E LRE+I+N+NCR LVA++P F  AD +FV+ ++TKL+FEV+QP D II+EGTIG KM+FIQ G+V ++TK G +   LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL ++G+   I+  +  ++ DLN          L++EIV
Sbjct:  151 QLAGDDGEARDAQTFMQRQFSSMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKDETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYED-NTEIILDPKQIKKKYLRTWFVVDFISSIPVDYIFLIVEKGID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLRFEVFQPLDYIIREGTIGKKMYFIQHGVVSVLTK-GSIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRLGKKNSILMHK--VQHDLNSGVFNNHENELIQEIV 698          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn2b (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 [Source:NCBI gene;Acc:103044493])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 294/570 (51.58%), Postives = 411/570 (72.11%), Query Frame = 3
Query: 1041 QTNGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN----------LVKEIV 2720
            Q  GD      A ++++ QF S  QP  NK +L++FG++ AV KE+ R +  G  +IHP S+FRFYWD  ML+ ++ NLI++PV I+FF D+ +  WI+FN VSDT F++D+ +NFRTGI+  D   EIILDPK I ++Y+++WF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P++ WV    + +  W + Y++ALFKAMSHML IGYGR  P S+S+ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMFDEE IL EL+E LRE+I+N+NCR LVA++P F  AD +FV+ ++TKL+FEV+QP D II+EGTIG KM+FIQ G+V ++TK G +   LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL ++G+   I+  +  ++ DLN          L++EIV
Sbjct:  103 QLAGDDGEARDAQTFMQRQFSSMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKDETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYED-NTEIILDPKQIKKKYLRTWFVVDFISSIPVDYIFLIVEKGID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLRFEVFQPLDYIIREGTIGKKMYFIQHGVVSVLTK-GSIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRLGKKNSILMHK--VQHDLNSGVFNNHENELIQEIV 650          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 [Source:NCBI gene;Acc:103022855])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 285/550 (51.82%), Postives = 404/550 (73.45%), Query Frame = 3
Query: 1053 DLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            D +   R+  +++ Q  +  QP  NK +L++FG++ AV KE+ R Q  G  +IHP S+FRFYWDL+ML++++ NLI++PV I+FF++  +  W+VFN  SDTIF++D+ +NFRTGI+ N+ + EIILDPK+I   Y+KSWF++D LSSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+P+L ++P + WV    + +  W KQY++ALFKAMSHML IGYG   P S+S+ WIT++SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I +YYEHRYQGK+FDE+ IL EL++ L+E+I+N+NCR LVA +P F  AD +FV+ +++KLKFEV+QP D II+EGT+G KM+FIQ G+  +ITK  +    L+DGSYFGEICLLT  +R ASVRA+TYC L+SL  +HF  VLE YP+MRR  E+VA +RL +IG+   ++   +  ++DLN
Sbjct:   90 DADPAGRSHGFMQRQIGAMLQPGVNKFSLRMFGSQKAVEKEQERVQTAGYWIIHPYSDFRFYWDLIMLIMMMGNLIIIPVGITFFSEQTTTTWLVFNVASDTIFLVDLVMNFRTGIV-NEESSEIILDPKVIKMNYLKSWFVVDFLSSIPVDYIFLIVEKGFD-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNGMVNDSWGKQYSYALFKAMSHMLCIGYGARAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEDNILNELNDPLKEEIVNFNCRKLVATMPLFANADPNFVTGMLSKLKFEVFQPNDYIIREGTVGKKMYFIQHGVASVITKHNK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLFSLSVDHFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSLL--LQKFQKDLN 617          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007865.1 (pep scaffold:Pmarinus_7.0:GL480431:10244:18565:-1 gene:ENSPMAG00000007113.1 transcript:ENSPMAT00000007865.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 260.381 bits (664), Expect = 7.792e-79
Identity = 145/307 (47.23%), Postives = 209/307 (68.08%), Query Frame = 3
Query: 1239 WDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWV--------------------IKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFK 2099
            WD++ML+L++ NLIV+PV I+FF+++ +  WIVFN +SDT F++D+ +NFRTGI+  D  D IILDP++I  RY+KSWF++D +SSIP+DY+FL++    D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE           +T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML E+P + W+                    I    ++  W KQY++ALFKAMSHML IGYG+  P S+++ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK +
Sbjct:    1 WDIIMLLLMVGNLIVIPVGITFFHEEDTTAWIVFNVLSDTCFLVDLVLNFRTGIVVEDNTD-IILDPQVIKMRYLKSWFLVDFVSSIPVDYIFLIVETRID-----SEMYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEE-----------MTY-----DLASAVVRIVNLIAMMLLLCHWDGCLQFLVPMLQEFPHDCWISLNGMVVGLAASRTHLRFFAITPVCQNDSWGKQYSYALFKAMSHMLCIGYGQRAPVSMADLWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKMQ 285          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005594.1 (pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1 gene:ENSPMAG00000005049.1 transcript:ENSPMAT00000005594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.614 bits (405), Expect = 4.036e-41
Identity = 131/501 (26.15%), Postives = 217/501 (43.31%), Query Frame = 3
Query: 1221 SNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLH------------WIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLML---LLGHWNACLQFLIPMLMEYPAES-------WVIKC-----------------NLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQ-GKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEIC--LLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYP 2597
            S F+  WD ++L+L+I   I  P   +F   D  +               + + + D +F++DI +NFRT  I  +  +E++  P  IA  Y K WF++D++++IP D L      G  +           R LR+ R                   V++  ++Y                    S++ G   LVLLM    L+ HW AC+ + I   ME P +S       W+ +                  ++KD     +Y  AL+   S + S+G+G   P +  E   +I  M+ G+  YA   G+ +AIIQ   +    Y  +  +V+E++ + ++P  LRQR+  Y++H +      D  ++L    ECL+  I  +  R L+ +   F  A +  +  +  K K     PGD ++  G + T M+F+  G ++I+ +D  VA  L     FGE         K  A VRA TYC+L+ +  E    VL+ YP
Sbjct:   95 SPFKAVWDWLILLLVIYTAIFTPYTAAFLLSDQQVENERQKCGYSCNPLNIVDLMVDIMFMVDIFINFRTTYINKN--EEVVSHPGKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSGSGETTTLIGLLKTARLLRLVR-------------------VARKLDRY--------------------SEY-GAAVLVLLMCTFALIAHWLACIWYAIGN-MERPVDSLAKDRIGWLDQLGGQIGKPYNDTDTSSGPSIKD-----KYVTALYFTFSSLTSVGFGNVSPNTNYEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNMVLKGFPECLQADICLHLNRTLLESCKAFNGASKGCLRALAMKFKTTHAPPGDTLVHSGDVITAMYFLSRGSIEILREDIVVAI-LGKNDIFGEPVNQYSRPGKSSADVRALTYCDLHKIVREDMLEVLDMYP 546          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 156.762 bits (395), Expect = 4.457e-39
Identity = 126/494 (25.51%), Postives = 216/494 (43.72%), Query Frame = 3
Query: 1203 LVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLG---HWNACLQFLIPMLMEYPA----------ESWVIKCN--LKDAYWFKQYTW------------ALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQ-GKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTN--AKRVASVRAETYCNLYSLDAEHFQAVLENY 2594
            +++H C+ F+  WD ++L+L     I++P  +SF     ++ W+V + V D IF++DI +NF T  +    A E+I DPK+I   Y+K+WF++DLLS +P D +        +  EN  +   A +    F       +L            S +    ++     G +    + L+   ++ G   LVLL+ + G   HW AC+ + I    +Y             SW+ +    +   Y F    W            +L+  M+ + SIG+G   PT+  E    +  MM G+  YA   G+   I Q    +   Y E    V +++   ++P+ L +R+ +Y    +   K  D E +L    + +R  I  +  R +    P F  A    +  +  + +     PGDLI   G     + F+  G +++I +D EV   L  G  FG++       A   A+VRA TYC+L+ +  +    VL+ Y
Sbjct:  189 IILHYCA-FKTTWDWIILILTFYTAIMVPYNVSFKTKQNNVAWLVVDSVVDVIFLVDIVLNFHTTFVGP--AGEVISDPKLIRMNYLKTWFVIDLLSCLPYDII--------NAFENVDEVVRAAQIRGPFGSRSPSRLLDAWPRVAPQGISSLFSSLKVVRLLRLGRVA---RKLDHYIEY-GAAVLVLLVCVFGLAAHWLACIWYSI---GDYEVIDEATNLIRKHSWLYQLGETIGTPYHFNGTQWEGGPSKDAVYISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLHICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTHHCAPGDLIYHAGESVDTLCFVVSGSLEVI-QDDEVVAILGKGDVFGDVFWKERVIAPSCANVRALTYCDLHVIRRDALVKVLDFY 663          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 106.301 bits (264), Expect = 3.803e-24
Identity = 76/278 (27.34%), Postives = 131/278 (47.12%), Query Frame = 3
Query: 1791 HWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGK-MFDEEVILIELSECLREQI---INYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGE--VATSLSDGSYFGEICLLT---NAKRVASVRAETYCNLYSLDAEHFQAVLENYP 2597
            H NAC  + +  +    +  WV   N K   + + Y WA+      +++IG G   P+++ E    + +   G    ++ +G    +I +    +  YR        YM    + RA++ R+  +YE+ +  + M DE  +L +L   +R +I   +NY    +V  V  F   D+  + +++ +LK  VY PGD + K+G +G +M+ I+ G V ++       V  +L  GS FGEI LL      +R A+V A  + NL+ LD      +L  YP
Sbjct:  201 HLNACFYYFVSDMEGLGSTRWVY--NGKGYRYIRCYYWAV----KTLITIG-GLPEPSNLIEIVFQLSNYFLGVFVVSIMIGQMGDVIGAATAGQNYYRTCMDNTLSYMNMYHISRAVQNRVRMWYEYTWASQGMLDESELLEKLPIKMRLEIAIDVNYT---IVNKVALFKGCDRQMIYDMLLRLKSVVYLPGDFVCKKGELGREMYIIKAGEVQVVGGPDNKIVFVTLRTGSVFGEISLLAVGGGNRRTANVMAHGFANLFILDKRDLNEILRIYP 468          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: kcnh5b (potassium voltage-gated channel, subfamily H (eag-related), member 5b [Source:ZFIN;Acc:ZDB-GENE-090319-1])

HSP 1 Score: 88.1965 bits (217), Expect = 1.192e-18
Identity = 75/291 (25.77%), Postives = 128/291 (43.99%), Query Frame = 3
Query: 1203 LVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFI--GICKLVLLMLLLG---HWNACLQFLIPMLMEYPAESWV--IKCNLKDAYWFKQ---------------YTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTG 2009
            +++H C+ F+  WD ++L+L     I++P  +SF     ++ W+V + V D IF++DI +NF T  + +  A E+I DP +I  +Y+K+WF++DLLS +P D    ++N   + +E+ +    A  T                R   +   +S      L S      L    +       +I  G   LVLL+ + G   HW AC+ F I          W+  +  ++   Y +                 Y  AL+  MS + S+G+G   P + +E    +  MM G
Sbjct:  105 IILHYCA-FKTTWDWLILILTFYTAIMVPYNVSFRTRQSNVAWLVVDSVVDAIFLVDIVLNFHTTYVGS--AGEVISDPALIRTKYLKTWFLIDLLSCLPYD----IINAFENADEDTT----AASTHHHLLSQSSSVGQAAARSLHVAEGISS-----LFSALKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLVAHWLACIWFSIGDAEAAREYGWLHQLAHSVGQPYRYSGDGGGRWEGGPSRRTLYVSALYFTMSSLTSVGFGNIAPNTDAEKMFAVAMMMIG 379          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 64.6994 bits (156), Expect = 3.214e-11
Identity = 32/90 (35.56%), Postives = 48/90 (53.33%), Query Frame = 3
Query: 2316 SEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVL 2585
            +++   L  ++YQPG+ II+EG  G   + I+ G VD+  K   V   L D  YFGE+ LL +  R A+V A     + +L    FQ +L
Sbjct:  312 AKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSKKGQGVINKLKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGFQRLL 401          

HSP 2 Score: 58.5362 bits (140), Expect = 2.984e-9
Identity = 36/110 (32.73%), Postives = 56/110 (50.91%), Query Frame = 3
Query: 2286 FFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTM 2615
             F   D D    V+  L+ +    G  IIK+G  G   + +++G VD    D +V +S   GS FGE+ L+ N+ R A+V A + C L++LD   F+ +L      +R M
Sbjct:  184 LFNKLDSDSKRLVINCLEEKSVPKGATIIKQGDQGDYFYVVEKGTVDFYVNDNKVNSS-GPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLM 292          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO49064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI02])

HSP 1 Score: 525.013 bits (1351), Expect = 1.924e-175
Identity = 265/516 (51.36%), Postives = 373/516 (72.29%), Query Frame = 3
Query: 1122 DNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTN-AKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQI 2666
            DNKLALKLFGNK AV  E+RRQ QQGK VIHP S FR+YWD+++++ +  ++++LPV+I+F +DDLS+HW++ N VSD  F++DI +NFRTGI+  +  +E+ILD K+I+  Y++ WFI+DL SS+P DY + + +   ++         A R LRI +LAKLLS+LRLLR+SRLVRY++++EE                  LN+A   + I KL+  ML+L HWN C+QF +P L E+P +SWV   NLK A   +QY+W+LF+A+SHML IGYG +PP ++++ W+T+ SM  GAT YA+F+G  +++I S D+S RL+ EK  QVEEYM YRKLP  +R ++ ++YEHR+  K+FDE+ IL ELS+ LRE I+ +N + L+  VPFF+ A   F++++VTKLKFEV+  GD I + G  G KM+FIQ+GIVDI+T++G +ATSL DGS+FGEICLLT  A+RVASVRA T C++YSL A HF  VL++YP M+  +E VA ERLS++G  P++
Sbjct:    1 DNKLALKLFGNKAAVMLEQRRQSQQGKGVIHPFSTFRWYWDILLIIFIFMHVLLLPVSIAFLSDDLSIHWLILNGVSDVFFVVDIFLNFRTGIVDPNNQEEVILDKKVISMMYLRGWFIIDLASSLPFDYAYFIASSTTEEQ----TLLRASRALRILKLAKLLSLLRLLRVSRLVRYMTRFEE-----------------LLNIAKGQLRIMKLICCMLVLSHWNGCIQFFVPYLQEFPDDSWVSTSNLKTASPGEQYSWSLFRALSHMLCIGYGHYPPQNLTDLWLTVCSMTAGATFYAVFIGIMSSLIMSIDSSGRLFNEKLNQVEEYMRYRKLPLRIRLQVQDFYEHRFHHKLFDEDAILTELSKNLRETILVHNIKPLLTTVPFFSGASISFITDIVTKLKFEVFLNGDYICRSGHRGDKMYFIQKGIVDILTREGALATSLGDGSHFGEICLLTKEARRVASVRAATTCDVYSLSATHFHEVLQDYPEMKSVLEEVAKERLSRLGLKPKL 495          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO34316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPS0])

HSP 1 Score: 522.316 bits (1344), Expect = 2.246e-174
Identity = 274/517 (53.00%), Postives = 369/517 (71.37%), Query Frame = 3
Query: 1104 SFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQ 2654
            S+ +P DNK+ +K+FG+K A+  E+ R  + G  VIHP S FR YWD+ +L+LL+ NL  LPV ISFF D++S  WI FN VSDT F+LDI +NFRTG++ +   ++ ILDPKIIA+RY+K+WF +DL+SS+P+DY+         K+        A RTL++ R AKLL +L+LLRLSRLVRYV Q+EE                  LN+    I    LV ++LL+ HWN CLQFL+P L ++P  SWV   NL D  W++QY W+LFKAMSHML IGYGR+PP +I+E W+T  SM+TGAT YA+F+ +    IQ  D+  R YREK +Q+EEYM+YR+LP  LR R+  YY+HRYQG+MFDEE IL E+S+ LREQIINYNCR LV +VPFFT A+ DFVS ++T+L FEVY  GD+I++EG +GT+M+F++EG+V  +T  G+ A  L DG+YFGEICLLTNA+R ASV A+T C+++ L+AEHF+ V++ +P MR  ME VA +RL+K+G+
Sbjct:    7 SWLKPMDNKMNMKVFGSKRAMKDEQLRYSRAG-WVIHPTSIFRLYWDMWVLLLLLINLFALPVLISFFADNVSARWIAFNAVSDTAFLLDILLNFRTGVLVHGSPNKFILDPKIIAKRYLKTWFFIDLISSLPIDYIVEAATQSSTKS-----LIGATRTLKLLRFAKLLGLLKLLRLSRLVRYVQQYEE-----------------ILNVTRSVIRFINLVSIILLIAHWNGCLQFLVPYLQDFPETSWVSIHNLMDNDWWEQYCWSLFKAMSHMLCIGYGRYPPQNIAEVWVTTFSMLTGATFYAMFIAYCINFIQQLDSPGRNYREKIQQIEEYMSYRRLPVELRDRMTKYYDHRYQGRMFDEEKILHEISKPLREQIINYNCRDLVQSVPFFTEAEPDFVSAIITRLSFEVYLEGDIIVREGELGTEMYFLREGVVS-VTVGGKHANELCDGAYFGEICLLTNARRTASVTAKTVCDVFILNAEHFRDVVDEFPTMRILMEIVAEDRLNKMGK 499          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO35393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM8])

HSP 1 Score: 163.696 bits (413), Expect = 2.490e-43
Identity = 125/491 (25.46%), Postives = 239/491 (48.68%), Query Frame = 3
Query: 1233 FYWDLMMLVLLITNL--IVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDP--KIIARRYVKSW-FILDLLSSIPMDYLFLVLNHGPDKNEN----YSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIK------CNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMF-DEEVILIELSECLREQI-INYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDG-EVATSLSDGSYFGEICLLTNA----KRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERL 2639
            ++W L++ + ++ N   I+L  A    ND ++  W++ +   D I+I DI V+ RTG     F +E IL      + R Y+ ++ F LD  + IP+D  ++ + H P    N    + +F+H                           ++ + E +           TFP          + +  LV  +LL+ HWNAC+ F++   + + ++ WV         N  +    + Y ++ + +   + +IG    PP S  E  I  +  + G   +A  VG+   II + + ++  ++ K   ++ YM + K+P+ L++R+  ++++ +  K   DEE IL+ L + LR +I IN +  +L   V  F   +  F+ E+V +L+ +++ PGD + ++G +G +M+ +  G ++++++ G ++   L  GSYFGEI +L+ +    +R ASVR+  Y  L+ L       VL+ YP ++  +E +A E+L
Sbjct:    6 YFWLLVVSLAVLYNCWAIILRTAFPQINDKITYIWLILDYSCDLIYIADILVSMRTG-----FLEEGILQTCSTKMRRHYLHTYEFYLDAGALIPLDIAYIFIEHEPAFRINRILKFHRFWH---------------------------FLDRTESR----------TTFPN--------VVRLASLVQFILLIIHWNACIYFIVSREIGFGSDVWVYPGVRQEILNSSENTISRMYIYSFYWSTLTLTTIGEVP-PPYSEVEYIIVTLDYLIGVLLFATIVGNVGNIITNLNATRLDFQNKMDGIKAYMRFHKIPQHLQRRVIKWFDYLWTYKKHPDEEEILLSLPDKLRAEIAINVHLDSL-RKVAIFQDCEAGFLCELVLRLRSQLFSPGDYVCRKGEVGREMYIVNRGKLEVVSEHGTKIYAVLEAGSYFGEISVLSMSSAGNRRTASVRSVGYTELFCLAKNDLMEVLDEYPNIKEKIEKIAKEKL 444          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO35376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM9])

HSP 1 Score: 150.984 bits (380), Expect = 5.904e-39
Identity = 131/492 (26.63%), Postives = 235/492 (47.76%), Query Frame = 3
Query: 1203 LVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLH------WIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSW-FILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWV-IKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRF-----PPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKM-FDEEVILIELSECLREQI-INYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAK-----RVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTME 2618
            LV+ P   F F W L + + +I N   L V ++F     S+H       I  +   D+IF LD  V FR G + +     +++    + ++Y  S+ F+LDL+S +P D L+L L   P    N  + F A R L                                   CD+G      +  +   K   + KL+  + L+ HW AC+ F++     +  + W+  + + + +    QY ++L+++   M ++G G       P T ++  ++ IV+ +TG   +A  VG+A  +I     S+  Y  K   ++EY+   +LP  L++R+ +++++ ++ K   +E+ +  +L++  + +I I+ N   L+  V  F   D  F+ E+V KL+  +  PGD I ++G  G +M+ + +G ++++ +   V  +LS GS+FGEI LL N K     R ASVR+  + +L+ L     + VLE YP  +  ME
Sbjct:    1 LVLDPSGTFYFLWLLTVSLGVIYNYWALIVYVAF----PSVHEANLKTCIAVDYTFDSIFFLDTLVQFRVGFLEHGV---MVVGCWKLTKKYGCSFGFMLDLISILPFDVLYLYLGVLPILRFN--RLFKAHRFLLF---------------------------------CDRG------EIYSGRPKLFNLAKLIHYLFLIIHWVACVYFILSRYEGFGTDEWLHPRLDGQLSKLSMQYLYSLYRSSVSMTTVGAGVIGTIATPRTELTLCFV-IVTYLTGVLIFATIVGNAGDMIVEMRRSRERYLRKLNGMKEYIEAYQLPAHLKKRVIHWFDYLWRHKRDMNEQELFHKLNDNFKAEIAIHVNLDTLIR-VEMFHDCDPGFLHELVLKLRPVICSPGDFICRQGEKGREMYIVNKGSLEVLDEKETVLATLSAGSHFGEISLL-NMKGIGNLRTASVRSVGFSDLFQLSKTDLEEVLEFYPQAKEQME 441          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO47044 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RND4])

HSP 1 Score: 146.362 bits (368), Expect = 3.715e-37
Identity = 126/500 (25.20%), Postives = 220/500 (44.00%), Query Frame = 3
Query: 1206 VIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFF-NDDLSLH--------------WIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAY-----------WFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQ-GKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSY----FGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRT 2612
            +I   S F+  WD ++LV +I     +P + +F    +LS                  + N   D +F++DI +NFR+  +  +  DE+I++PK IA  Y KSWF++DLLS+IP +++   ++H  D   N       G ++ +  LA  L  L        +  + +  ++Y  S   Q  +                  L    LL+ HW AC+   I         SW+ K +    +              +Y  AL+  M+ + S+G+G   P + +E   +I+ M+ GA  YA   G+  AIIQ   +    +R   + +++++ + K+PR LR  +  Y+ H +   K  D + +L    E L+  I  +  + L A    F  A +  +  +  +     + PG  +IK+G    K++FI +G V+++ KDG     L  G      +     L  AK  AS+  +TYC ++ +D +   +VL  Y   R +
Sbjct:    1 IIRHDSIFKAVWDWVILVFVIYTAFEIPFSATFLLPQELSRMKSSSRFAALVSGSPLAICNLCVDLLFVVDIPINFRSTYV-REGTDELIVNPKKIALNYFKSWFLIDLLSAIPFEFM---VDHRKDGVSN------QGVSMPLTGLATTLMGLLKTARLLRLVRIVRKFDRY--SEYGQAVIIL----------------LTCFFLLVAHWLACIWHAIGQAQLGDHNSWIEKLSRHSQHVSSGNVTHTPGLQTRYITALYFTMTSLSSVGFGNVSPNTNAEKVFSILVMIVGALMYASIFGNMTAIIQRLYSRTSRHRRNLRIIQDFVRFYKIPRNLRDDLEEYFRHEWSYTKGMDIDTVLKRFPESLQADICVHLHKKLFAECSAFQCASEGCLRALARRFDIRRHLPGQYLIKQGDEVKKLYFIAKGFVEVL-KDGHCELVLGKGDVISCDYTSRQSLRTAKANASLLIQTYCQIHVVDWQDLLSVLRVYSKFRES 471          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: hcn4 (hyperpolarization activated cyclic nucleotide-gated potassium channel 4 [Source:ZFIN;Acc:ZDB-GENE-050420-360])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 295/542 (54.43%), Postives = 403/542 (74.35%), Query Frame = 3
Query: 1077 SSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            + ++  Q  +  QP  NK +L++FG++ AV +E+ R +  G  +IHP S+FRFYWDL ML+L++ NLI++PV I+FF D+ +  WIVFN VSDT F++D+ +NFRTGI+  D   EIILDP+ I  +Y++SWF++D +SSIP+DY+FLV+    D     S F+   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++PA+ WV K  + +  W +QY++ALFKAMSHML IGYG +PP  +++ W+TI+SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMFDEE IL EL+E LRE+IIN+NCR LVA++P F  AD +FV+ ++TKLKFEV+QPGD II+EGTIG KM+FIQ G+V ++TK G   T LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DL+
Sbjct:  174 AGFIHRQLGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDEHTPPWIVFNVVSDTFFLMDLVLNFRTGIVKED-NTEIILDPQQIKIKYLRSWFVVDFISSIPVDYIFLVVETRID-----SDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPADCWVSKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSIL--QHKVQHDLS 693          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: ENSORLT00000019258.2 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 [Source:NCBI gene;Acc:101172279])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 293/550 (53.27%), Postives = 405/550 (73.64%), Query Frame = 3
Query: 1053 DLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            D   +   +S+++ QF S  QP  NK +L+++G++ AV +E+ R +  G  +IHP S+FRFYWD  ML+ ++ NLI++PV I+FF D+ +  WI+FN VSDT F++D+ +NFRTGII  D +D IILDPK I  +Y+K+WFI+D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML E+P++ WV    +++  W + Y++A+FKAMSHML IGYGR  P S+S+ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMFDEE IL ELSE LRE+I+N+NCR LVA++P F  A+ +FV+ ++TKL+FEV+QP D II+EGTIG KM+FIQ G+  +ITK G +A  LSDGSYFGEICLLT  +R ASVRAETYC LYSL  +HF  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DLN
Sbjct:  324 DAETRGSQASFMQRQFSSMLQPGVNKFSLRMYGSQKAVEREQERVKSAGNWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTTPWIIFNVVSDTFFLMDLVLNFRTGIIIEDNSD-IILDPKTIKTKYLKTWFIVDFISSIPVDYIFLIVEKGID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVMRIFNLIGMMLLLCHWDGCLQFLVPMLQEFPSDCWVSLNKMENDTWSELYSFAVFKAMSHMLCIGYGRQAPESLSDIWLTMLSMIVGATCYAVFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILGELSEPLREEIVNFNCRKLVASMPLFANAEPNFVTAMLTKLRFEVFQPHDYIIREGTIGKKMYFIQHGVCSVITK-GTLAMKLSDGSYFGEICLLTRGRRTASVRAETYCRLYSLSVDHFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILMHK--VQHDLN 851          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: HCN2 (hyperpolarization activated cyclic nucleotide gated potassium and sodium channel 2 [Source:NCBI gene;Acc:101162512])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 294/549 (53.55%), Postives = 405/549 (73.77%), Query Frame = 3
Query: 1059 NNKSRAS-SYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            +  SR + +Y++ QF S  QP  NK +L++FG++ AV KE+ R +  G  +IHP S+FRFYWD  ML+ ++ NLI++PV I+FF D+ +  WI+FN +SDT F++D+ +NFRTGI+  D   EIILDPK I  +Y+KSWF++D +SSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV   N+ +  W + Y++ALFKAMSHML IGYGR  P S+S+ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMFDEE IL EL+E LRE+IIN+NCR LVA++P F  AD +FV+ ++TKL+FEV+QPGD II+EGTIG KM+FIQ G+V I+TK G ++  L DGSYFGEICLLT  +R ASVRA+TYC LYSL  ++F  VLE YP+MRR  E+VA +RL +IG+   I+  +  ++ DLN
Sbjct:  209 DGDSRGTQTYMQRQFSSLLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKDETTTPWIIFNVISDTFFLMDLVLNFRTGIVFED-NTEIILDPKKIKMKYLKSWFVVDFVSSIPVDYIFLIVEKGID-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSLNNMVNDTWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIIGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIINFNCRKLVASMPLFANADPNFVTAMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSILTK-GNISMKLMDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILMHK--VQHDLN 735          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: hcn1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 [Source:NCBI gene;Acc:101168057])

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 289/550 (52.55%), Postives = 406/550 (73.82%), Query Frame = 3
Query: 1053 DLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLN 2702
            DL   SR S +++ QF +  QP  NK +L++FG++ AV KE+ R Q  G  +IHP S+FRFYWDL+ML++++ NLI++PV I+FF++  +  W+VFN  SDTIF++D+ +NFRTGI+ N+ + EIILDPK+I   Y+KSWF++D LSSIP+DY+FL++  G D     S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQ+L+P+L ++P + WV    + +  W KQY++ALFKAMSHML IGYG   P S+S+ WIT++SM+ GATCYA+FVGHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  LRQ+I +YYEHRYQGK+FDE+ IL EL++ L+E+I+N+NCR LVA +P F  AD +FV+ +++KLKFEV+QP D II+EGT+G KM+FIQ G+  +ITK  +    L+DGSYFGEICLLT  +R ASVRA+TYC L+SL  +HF  VLE YP+MRR  E+VA +RL +IG+   ++   +  ++DLN
Sbjct:   59 DLEGASRQSGFMQRQFGAMMQPGVNKFSLRMFGSQKAVEKEQERVQTAGYWIIHPYSDFRFYWDLIMLIMMMGNLIIIPVGITFFSEQTTTTWLVFNVASDTIFLVDLVMNFRTGIV-NEESSEIILDPKVIKMNYLKSWFVVDFLSSIPVDYIFLIVEKGFD-----SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAVVRIFNLIGMMLLLCHWDGCLQYLVPLLQDFPPDCWVSLNGMVNVSWGKQYSYALFKAMSHMLCIGYGARAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQKIHDYYEHRYQGKIFDEDNILSELNDPLKEEIVNFNCRKLVATMPLFANADPNFVTGMLSKLKFEVFQPYDYIIREGTVGKKMYFIQHGVASVITKFNK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLFSLSVDHFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSLL--LQKFQKDLN 586          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: ENSORLT00000045599.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 [Source:NCBI gene;Acc:101158796])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 282/536 (52.61%), Postives = 395/536 (73.69%), Query Frame = 3
Query: 1047 NGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQ 2654
            +G+  + S  S++++ QF +  QP  NK +L++FG+  AV  E+ R +  G  +IHP S+FRFYWDL+ML+L++ NLIVLPV I+FF D+ +  WI+FN VSDT+F++D+ +NFRTGI+  D   EI+LDP+ I + Y+KSWF++D +SSIP+DY+FL+++         S+ +   R LRI R  K+LS+LRLLRLSRL+RY+ QWEE +        ++T+     ++AS  + I  L+ +MLLL HW+ CLQFL+PML ++P + WV K  + +  W  QY++ALFKAMSHML IGYG   P  +++ W+T++SM+ GATCYA+F+GHA A+IQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I  YYEHR+QGKMFDEE IL ELSE L+E+I+++NCR+LVA +P F  AD +FV+ V+TKL+FEV+QP D II+EGT+G KM+FIQ G V ++T+ G   T LSDGSYFGEICLLT  +R ASVRA+TYC LYSL  + F  VLE +P+MRR  E+VA +RL +IG+
Sbjct:  172 DGEDYSNSNQSTFIQRQFGAMLQPGVNKFSLRMFGSHKAVAMEQERLKSAGAWIIHPYSDFRFYWDLLMLILMMGNLIVLPVGITFFRDENTASWIIFNVVSDTLFMVDLVLNFRTGIVKED-NTEILLDPREIRQNYLKSWFLVDFVSSIPVDYIFLMMD------SLDSEVYRTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF--------HMTY-----DLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSKNLMVNDTWGVQYSYALFKAMSHMLCIGYGAQAPEGMTDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHEYYEHRFQGKMFDEENILGELSEPLKEEIVSFNCRSLVANMPLFANADPNFVTAVLTKLRFEVFQPADFIIREGTVGRKMYFIQHGRVSVLTR-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDSFNEVLEEHPMMRRAFETVAVDRLDRIGR 686          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000038954.1 (SMESG000038954.1)

HSP 1 Score: 1962.58 bits (5083), Expect = 0.000e+0
Identity = 1036/1037 (99.90%), Postives = 1036/1037 (99.90%), Query Frame = 3
Query:   69 MKSRKYSSNILEVPVQLLPDDERSRVEAKYSRKHSEIYFKNLFENPRHLYKESTYRRCSDILAMSSYLGIDPSELSANITPNKSVFHSDVSRPYSKVTHHSKLAHATSLSSTFHNSLEGCNTLPHIPATNSQKHVLRNMHSNLSFEIDIPTSFITNPRLSGRRSSKSLEFSSLQFAEESRQETIPESIMEQFVCPTPCKAYSAIANGDIENNGSSVASTILVSNRNSTTYRTPHKNKRRWPSIXXXXXXXXXXXXVDHLQHSVPLIHRSDHDDNNYQGSEKTAHSLSNIDSSFEKDIIKRSHEADGQFXXXXXXXXXXXXXXXXQTNGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSXXXXXKCNPDECENLMQSNSSMNARXXXXXXXXXXCRNSFSQRKSALRQGIQNVLRLTKSKSNLSFSSAVKRSNARNSSCFVAEKSDSTSKDYLTVHPKKESDTKPTFLSNEGGFENQLQILIXXXXXXXXXXXVYSISDKESCV 3179
            MKSRKYSSNILEVPVQLLPDDERSRVEAKYSRKHSEIYFKNLFENPRHLYKESTYRRCSDILAMSSYLGIDPSELSANITPNKSVFHSDVSRPYSKVTHHSKLAHATSLSSTFHNSLEGCNTLPHIPATNSQKHVLRNMHSNLSFEIDIPTSFITNPRLSGRRSSKSLEFSSLQFAEESRQETIPESIMEQFVCPTPCKAYSAIANGDIENNGSSVASTILVSNRNSTTYRTPHKNKRRWPSIKSKFGKFGSMGKVDHLQHSVPLIHRSDHDDNNYQGSEKTAHSLSNIDSSFEKDIIKRSHEADGQFEDVDERSDESNDENDDQTNGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFRLAKLLSMLRLLRLSRLVRYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSDDDDDKCNPDECENLMQSNSSMNARKKKQSSASKKCRNSFSQRKSALRQGIQNVLRLTKSKSNLSFSSAVKRSNARNSSCFVAEKSDSTSKDYLTVHPKKESDTKPTFLSNEGGFENQ QILITPSPTPDSPPPVYSISDKESCV
Sbjct:    1 MKSRKYSSNILEVPVQLLPDDERSRVEAKYSRKHSEIYFKNLFENPRHLYKESTYRRCSDILAMSSYLGIDPSELSANITPNKSVFHSDVSRPYSKVTHHSKLAHATSLSSTFHNSLEGCNTLPHIPATNSQKHVLRNMHSNLSFEIDIPTSFITNPRLSGRRSSKSLEFSSLQFAEESRQETIPESIMEQFVCPTPCKAYSAIANGDIENNGSSVASTILVSNRNSTTYRTPHKNKRRWPSIKSKFGKFGSMGKVDHLQHSVPLIHRSDHDDNNYQGSEKTAHSLSNIDSSFEKDIIKRSHEADGQFEDVDERSDESNDENDDQTNGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFRLAKLLSMLRLLRLSRLVRYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSDDDDDKCNPDECENLMQSNSSMNARKKKQSSASKKCRNSFSQRKSALRQGIQNVLRLTKSKSNLSFSSAVKRSNARNSSCFVAEKSDSTSKDYLTVHPKKESDTKPTFLSNEGGFENQFQILITPSPTPDSPPPVYSISDKESCV 1037          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000038954.1 (SMESG000038954.1)

HSP 1 Score: 1785.39 bits (4623), Expect = 0.000e+0
Identity = 956/974 (98.15%), Postives = 956/974 (98.15%), Query Frame = 3
Query:  258 MSSYLGIDPSELSANITPNKSVFHSDVSRPYSKVTHHSKLAHATSLSSTFHNSLEGCNTLPHIPATNSQKHVLRNMHSNLSFEIDIPTSFITNPRLSGRRSSKSLEFSSLQFAEESRQETIPESIMEQFVCPTPCKAYSAIANGDIENNGSSVASTILVSNRNSTTYRTPHKNKRRWPSIXXXXXXXXXXXXVDHLQHSVPLIHRSDHDDNNYQGSEKTAHSLSNIDSSFEKDIIKRSHEADGQFXXXXXXXXXXXXXXXXQTNGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSXXXXXKCNPDECENLMQSNSSMNARXXXXXXXXXXCRNSFSQRKSALRQGIQNVLRLTKSKSNLSFSSAVKRSNARNSSCFVAEKSDSTSKDYLTVHPKKESDTKPTFLSNEGGFENQLQILIXXXXXXXXXXXVYSISDKESCV 3179
            MSSYLGIDPSELSANITPNKSVFHSDVSRPYSKVTHHSKLAHATSLSSTFHNSLEGCNTLPHIPATNSQKHVLRNMHSNLSFEIDIPTSFITNPRLSGRRSSKSLEFSSLQFAEESRQETIPESIMEQFVCPTPCKAYSAIANGDIENNGSSVASTILVSNRNSTTYRTPHKNKRRWPSIKSKFGKFGSMGKVDHLQHSVPLIHRSDHDDNNYQGSEKTAHSLSNIDSSFEKDIIKRSHEADGQFEDVDERSDESNDENDDQTNGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFRLAKLLSMLRLLRLSRLVRYVSQWEE                 FLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSDDDDDKCNPDECENLMQSNSSMNARKKKQSSASKKCRNSFSQRKSALRQGIQNVLRLTKSKSNLSFSSAVKRSNARNSSCFVAEKSDSTSKDYLTVHPKKESDTKPTFLSNEGGFENQ QILITPSPTPDSPPPVYSISDKESCV
Sbjct:    1 MSSYLGIDPSELSANITPNKSVFHSDVSRPYSKVTHHSKLAHATSLSSTFHNSLEGCNTLPHIPATNSQKHVLRNMHSNLSFEIDIPTSFITNPRLSGRRSSKSLEFSSLQFAEESRQETIPESIMEQFVCPTPCKAYSAIANGDIENNGSSVASTILVSNRNSTTYRTPHKNKRRWPSIKSKFGKFGSMGKVDHLQHSVPLIHRSDHDDNNYQGSEKTAHSLSNIDSSFEKDIIKRSHEADGQFEDVDERSDESNDENDDQTNGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFRLAKLLSMLRLLRLSRLVRYVSQWEE-----------------FLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSDDDDDKCNPDECENLMQSNSSMNARKKKQSSASKKCRNSFSQRKSALRQGIQNVLRLTKSKSNLSFSSAVKRSNARNSSCFVAEKSDSTSKDYLTVHPKKESDTKPTFLSNEGGFENQFQILITPSPTPDSPPPVYSISDKESCV 957          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000001696.1 (SMESG000001696.1)

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 457/631 (72.42%), Postives = 529/631 (83.84%), Query Frame = 3
Query: 1062 NKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSXXXXXKCNPDECEN--LMQSNSSMNARXXXXXXXXXXCRNSFSQRKSALRQGIQNVLRLTKSKSNLSFSS 2948
            NK   + YLKEQFFSFFQP+DNKLA+KLFGNKNA+NKE+RRQQQ GK +IHPCSNFRFYWDLMML+LLI NLI+LPVAISFFNDDLSLHWIVFNC SDTIF+LDI VNFR+GII ++FADEIILDP  I + Y+ SWF LDL+SSIPMDY+FL++N    + + YSQF HAGR LRI +LAKLLS+LRLLRLSRLVRYVSQWEE                 FLNMA+KF+GICKLVL+MLLL HWNACLQ+LIP+L ++PA+SWV KC L+ AYWF QYTWALFKA+SHMLSIGYGRFPPTSISEAWIT+ S++ G TCYALFVGHAAA+IQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRI +YYEHRYQGKMF+E++IL ELSECLREQIINYNCRALVA+VPFFTYADQDFVSEVVTKLKFEV+QPGDLIIKEGT+GTKM+FIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLD+ HF  VLENYPLMRRTMESVAAERL+KIG+NP++V+ R+DLKEDL+LV+E+V+S           K    E E+  L+ + ++   R                ++ +A+R G+Q +L+  +S+S++S S+
Sbjct:  195 NKLSTTGYLKEQFFSFFQPADNKLAMKLFGNKNALNKEKRRQQQAGKWIIHPCSNFRFYWDLMMLILLIANLIILPVAISFFNDDLSLHWIVFNCASDTIFLLDIMVNFRSGIIADNFADEIILDPNQICKNYIHSWFFLDLISSIPMDYIFLIIN----RKDVYSQFVHAGRGLRILKLAKLLSILRLLRLSRLVRYVSQWEE-----------------FLNMANKFMGICKLVLMMLLLAHWNACLQYLIPVLNDFPADSWVTKCKLQHAYWFHQYTWALFKALSHMLSIGYGRFPPTSISEAWITVTSVLIGVTCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIDSYYEHRYQGKMFNEDLILSELSECLREQIINYNCRALVASVPFFTYADQDFVSEVVTKLKFEVFQPGDLIIKEGTVGTKMYFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDSFHFLEVLENYPLMRRTMESVAAERLNKIGKNPEMVTDRKDLKEDLDLVQEMVNSAEAAA------KLEESEIEDNKLLSAYTTEKPR----------------RKSTAIRLGLQ-LLKFHRSRSHMSLSN 781          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000020049.1 (SMESG000020049.1)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 453/564 (80.32%), Postives = 498/564 (88.30%), Query Frame = 3
Query: 1053 DLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGS 2744
            D  N+   SSYLKEQF SFFQPSDNKLA+KLFGNKNA+NKE+RRQQQQGK VIHPCSNFRFYWDL+ML LLI NLI+LPVAISFFNDDLSL WI+FNC+SDTIF+LDI VNFRTG+ITND+ADEIIL PK IA+ Y+KSWF LD +SSIP+DY+FL+LN    K E ++Q  HAGR LRI RLAKLLS+LRLLRLSRLVRYVSQWEE                  LN+ASKFIGI  LVLLMLLLGHWNACLQFLIPML +YP++SWVIKC LK+AYWF QYTWALFKAMSHMLSIGYGR+PPTSI EAWITIVSMMTGATCYALFVGHAAA+IQSFDTSKRLYREKFKQVEEYMAYRKLPR LRQRIANYYEHRYQGKMF+E  IL ELSECLREQIINYNCRALVAAVPFFTYADQ+FVSEVV KL++EV+QPGDLIIKEG +GT+M+FIQEGIVDIITK+GEVATSLSDGSYFGEICLLTNA+RVASVRAETYCN+YSLD + F +VLENYPLMRRTMESVAAERL KIGQNP +VS+R+DL EDL LVKEIV+  +PI S
Sbjct:  244 DDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDLLMLSLLIANLIILPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILN----KKEYFNQIMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEE-----------------LLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISS 786          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000038402.1 (SMESG000038402.1)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 462/649 (71.19%), Postives = 537/649 (82.74%), Query Frame = 3
Query: 1053 DLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFXXXXXXXXXXXXXXXXXXXYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSXXXXXKCNPDECENLMQSNSSMNARXXXXXXXXXXCRNSFSQRKSALRQGIQNVLRLTKSKSNLSFSSAVKRSNARNSSCFVAEK 2999
            D   K   SSYLKEQF SFFQPSDNKLALKLFG+KNAV +E++RQQ++ K +IHPCS+FRFYWDL MLV+LI NLI+LPV +SFF D + + W++FNC SDT+F+ DIAVNFRTGI+  D +DEIIL+PKIIAR Y++SWF LDL+SSIP+DY+FL +N G    ENY  F +AG+TLRI RLAKLLSMLRLLRLSRLVRYVSQWEE                 FLN+ASKFIGICKLVLLMLLLGHWNAC+QFLIP+LME+P ESWV+KC L+ +YWF+QYTW+LFKAMSHMLSIGYGRFPPTSISEAWITI+SMMTGATCYALFVGHAAA+IQSFDTSKRLYREKFKQVEEYM YRKLPRALRQRIANYYEHRYQGKMF+E+ IL EL+ECLREQ+INYNCRALVAAVPFFTYADQ FVSEVV+KL +EV+QPGDLIIKEGTIGTKM+FIQEGIVDIITKDGEV TSLSDGSYFGEICLLTNAKR A+VRAE YC+LYSLD+E F+AVLENYPLMRRTMESVAAERLSKIG NP I+++RED K+DL++VKEIVSSV+P+ SDD++D  N ++  N    N S+              +   S+RKS ++ G+   L L KSKSN   +S V++ +  NS+    +K
Sbjct:  166 DSQQKQSTSSYLKEQFLSFFQPSDNKLALKLFGSKNAVIQEKKRQQKEAKWIIHPCSSFRFYWDLFMLVMLIANLIILPVIVSFFTDSMRIQWVIFNCFSDTVFLADIAVNFRTGILLTDKSDEIILNPKIIARNYLRSWFFLDLISSIPLDYIFLAVNRG----ENYHHFVYAGKTLRILRLAKLLSMLRLLRLSRLVRYVSQWEE-----------------FLNIASKFIGICKLVLLMLLLGHWNACIQFLIPVLMEFPTESWVVKCKLQHSYWFEQYTWSLFKAMSHMLSIGYGRFPPTSISEAWITIISMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMTYRKLPRALRQRIANYYEHRYQGKMFNEDQILTELNECLREQVINYNCRALVAAVPFFTYADQSFVSEVVSKLMYEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITKDGEVVTSLSDGSYFGEICLLTNAKRCATVRAEVYCSLYSLDSEQFKAVLENYPLMRRTMESVAAERLSKIGCNPDIITNREDFKDDLDMVKEIVSSVSPMVSDDEND--NAEDNGNDKSFNGSLK-------------KPKESRRKSVVKLGLHK-LGLIKSKSN---NSLVEKKDNPNSNVITPKK 774          
The following BLAST results are available for this feature:
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HCN40.000e+054.24hyperpolarization activated cyclic nucleotide gate... [more]
HCN10.000e+050.09hyperpolarization activated cyclic nucleotide gate... [more]
HCN20.000e+052.77hyperpolarization activated cyclic nucleotide gate... [more]
HCN10.000e+052.43hyperpolarization activated cyclic nucleotide gate... [more]
HCN30.000e+052.83hyperpolarization activated cyclic nucleotide gate... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1031.131e-4125.80Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.150e-4125.80Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.279e-4125.80Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.351e-4125.80Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.530e-4125.80Potassium voltage-gated channel unc-103 [Source:U... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ih0.000e+065.34gene:FBgn0263397 transcript:FBtr0290110[more]
Ih0.000e+066.67gene:FBgn0263397 transcript:FBtr0100369[more]
Ih0.000e+065.17gene:FBgn0263397 transcript:FBtr0100372[more]
Ih0.000e+066.48gene:FBgn0263397 transcript:FBtr0290109[more]
Ih0.000e+066.67gene:FBgn0263397 transcript:FBtr0290292[more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcn40.000e+054.61hyperpolarization activated cyclic nucleotide-gate... [more]
hcn4l0.000e+052.87hyperpolarization activated cyclic nucleotide-gate... [more]
hcn40.000e+054.24hyperpolarization activated cyclic nucleotide-gate... [more]
hcn2b0.000e+053.05hyperpolarization activated cyclic nucleotide-gate... [more]
hcn10.000e+052.18hyperpolarization activated cyclic nucleotide-gate... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000054882.10.000e+054.78potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054880.10.000e+054.78potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054879.10.000e+054.78potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054883.10.000e+054.78potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054881.10.000e+054.78potassium/sodium hyperpolarization-activated cycli... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hcn40.000e+054.24hyperpolarization-activated, cyclic nucleotide-gat... [more]
Hcn20.000e+053.27hyperpolarization-activated, cyclic nucleotide-gat... [more]
Hcn20.000e+053.27hyperpolarization-activated, cyclic nucleotide-gat... [more]
Hcn10.000e+050.09hyperpolarization activated cyclic nucleotide gate... [more]
Hcn30.000e+053.02hyperpolarization-activated, cyclic nucleotide-gat... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y3Q4|HCN4_HUMAN0.000e+054.24Potassium/sodium hyperpolarization-activated cycli... [more]
sp|Q9TV66|HCN4_RABIT0.000e+054.80Potassium/sodium hyperpolarization-activated cycli... [more]
sp|Q9JKA7|HCN4_RAT0.000e+054.24Potassium/sodium hyperpolarization-activated cycli... [more]
sp|Q9JKA9|HCN2_RAT0.000e+053.27Potassium/sodium hyperpolarization-activated cycli... [more]
sp|O88703|HCN2_MOUSE0.000e+053.27Potassium/sodium hyperpolarization-activated cycli... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GGH40.000e+075.00Cyclic nucleotide-binding domain-containing protei... [more]
A0A267GPW90.000e+075.00Cyclic nucleotide-binding domain-containing protei... [more]
A0A4Z2DGN80.000e+078.99Potassium/sodium hyperpolarization-activated cycli... [more]
A0A068WH890.000e+081.83Hyperpolarization activated cyclic OS=Echinococcus... [more]
A0A068YDH10.000e+081.83Hyperpolarization activated cyclic OS=Echinococcus... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcn4l0.000e+053.69potassium/sodium hyperpolarization-activated cycli... [more]
hcn4l0.000e+053.69potassium/sodium hyperpolarization-activated cycli... [more]
hcn2b0.000e+051.58potassium/sodium hyperpolarization-activated cycli... [more]
hcn2b0.000e+051.58potassium/sodium hyperpolarization-activated cycli... [more]
hcn10.000e+051.82potassium/sodium hyperpolarization-activated cycli... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007865.17.792e-7947.23pep scaffold:Pmarinus_7.0:GL480431:10244:18565:-1 ... [more]
ENSPMAT00000005594.14.036e-4126.15pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1... [more]
kcnh1b4.457e-3925.51potassium voltage-gated channel, subfamily H (eag-... [more]
cngb1a3.803e-2427.34cyclic nucleotide gated channel subunit beta 1a [S... [more]
kcnh5b1.192e-1825.77potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY13.214e-1135.56Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490641.924e-17551.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343162.246e-17453.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353932.490e-4325.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353765.904e-3926.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470443.715e-3725.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcn40.000e+054.43hyperpolarization activated cyclic nucleotide-gate... [more]
ENSORLT00000019258.20.000e+053.27potassium/sodium hyperpolarization-activated cycli... [more]
HCN20.000e+053.55hyperpolarization activated cyclic nucleotide gate... [more]
hcn10.000e+052.55potassium/sodium hyperpolarization-activated cycli... [more]
ENSORLT00000045599.10.000e+052.61potassium/sodium hyperpolarization-activated cycli... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038954.10.000e+099.90SMESG000038954.1[more]
SMESG000038954.10.000e+098.15SMESG000038954.1[more]
SMESG000001696.10.000e+072.42SMESG000001696.1[more]
SMESG000020049.10.000e+080.32SMESG000020049.1[more]
SMESG000038402.10.000e+071.19SMESG000038402.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004463 ID=SMED30004463|Name=Cyclic nucleotide gated channel 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3526bp
TTATTTTATATCCATAAACCAGTTAATAAGATTGTCGAAAAAACAACAAT
TTGGAAGTCAATTCGTAAATGAAATCGAGAAAATATTCTTCGAATATTCT
TGAAGTGCCCGTTCAATTGTTACCCGATGATGAACGAAGTCGAGTTGAAG
CGAAATATTCCCGAAAACATTCAGAAATATATTTTAAAAATCTATTTGAA
AATCCGAGGCATTTATATAAAGAAAGCACTTATCGCCGTTGTTCGGATAT
ATTAGCCATGTCAAGTTATTTAGGCATAGATCCTAGTGAGTTGTCGGCAA
ACATTACGCCGAACAAATCAGTTTTTCATTCCGATGTTTCAAGACCTTAT
TCAAAAGTCACTCATCATTCAAAATTAGCTCATGCCACATCATTGTCGAG
TACGTTTCATAATTCGTTGGAAGGATGCAACACTCTACCTCATATACCTG
CCACAAATTCTCAAAAACACGTTCTGAGAAACATGCACTCAAATCTCTCG
TTTGAAATTGATATCCCTACCAGTTTTATCACAAATCCTCGACTCAGTGG
TCGACGGTCATCAAAATCTTTAGAGTTTTCCTCGTTACAATTCGCTGAAG
AAAGCCGTCAAGAGACAATTCCTGAGTCAATCATGGAACAATTTGTTTGT
CCAACTCCATGTAAGGCTTATTCGGCCATTGCAAATGGTGATATTGAAAA
CAATGGATCGAGTGTTGCCAGCACAATTTTAGTCTCGAATCGTAATTCTA
CTACCTATCGGACACCCCATAAAAATAAACGTCGTTGGCCGAGTATTAAA
TCGAAATTTGGAAAATTTGGTTCAATGGGAAAAGTTGATCATTTACAACA
TTCAGTTCCATTGATACACCGATCCGATCATGATGATAATAATTATCAAG
GATCCGAGAAAACTGCTCACTCTCTTTCAAACATCGACTCCAGCTTCGAA
AAAGATATCATCAAACGATCACACGAGGCTGATGGTCAATTTGAGGATGT
TGATGAAAGAAGTGATGAATCAAATGATGAAAACGACGATCAAACAAATG
GAGACTTGAATAACAAATCTCGGGCTTCTAGTTATCTGAAAGAACAATTT
TTCTCTTTTTTTCAACCTTCCGACAACAAATTAGCTCTCAAACTGTTTGG
CAATAAAAACGCTGTCAATAAAGAAAGACGCCGACAGCAACAGCAGGGTA
AATTGGTCATTCACCCATGTAGCAATTTTCGATTTTATTGGGATTTAATG
ATGTTGGTCCTGCTCATAACAAACCTCATAGTTCTTCCAGTAGCGATCTC
GTTTTTCAATGACGACCTGAGTTTGCATTGGATTGTTTTCAATTGCGTTT
CAGATACTATTTTTATACTTGATATTGCCGTGAATTTCAGAACTGGTATT
ATAACAAATGATTTTGCGGATGAAATAATTCTTGATCCAAAAATCATTGC
TCGACGATATGTCAAATCTTGGTTCATTCTCGATTTGCTCAGTTCCATTC
CGATGGATTATTTATTCCTTGTACTCAATCATGGGCCGGATAAAAATGAG
AATTACAGTCAATTTTTTCATGCAGGTCGAACCTTACGAATCTTTCGCTT
AGCAAAGCTGCTTAGTATGCTTCGTTTACTAAGATTGTCAAGACTCGTGC
GGTACGTCAGCCAATGGGAAGAGAAGTATTTGATCTCAACATGTGACCAA
GGATATTTAACTTTTCCACAAAAGTTCCTAAATATGGCGAGCAAATTCAT
TGGCATTTGCAAACTTGTTCTATTGATGCTTCTTCTCGGACACTGGAATG
CCTGTCTGCAGTTTTTAATACCAATGCTAATGGAATATCCAGCAGAATCT
TGGGTTATCAAATGTAATTTAAAGGATGCTTATTGGTTCAAGCAGTATAC
TTGGGCATTATTCAAGGCAATGTCTCACATGCTCAGTATCGGTTATGGGA
GATTTCCACCAACAAGCATCAGTGAAGCCTGGATTACGATTGTCAGTATG
ATGACCGGTGCTACGTGCTACGCGTTATTTGTCGGTCATGCTGCAGCAAT
AATTCAATCATTCGATACGTCGAAGAGACTTTACAGGGAAAAGTTTAAAC
AAGTCGAGGAATATATGGCTTATCGTAAACTTCCTCGGGCTTTAAGACAG
AGAATTGCCAATTATTACGAGCATAGATATCAAGGCAAAATGTTTGATGA
AGAAGTAATTTTGATAGAGCTGTCAGAGTGTTTACGAGAACAAATTATCA
ATTACAATTGCCGAGCTTTGGTAGCAGCGGTGCCTTTCTTTACATATGCA
GATCAAGATTTTGTTTCTGAAGTTGTCACTAAATTGAAATTTGAAGTTTA
TCAGCCCGGTGATTTGATAATTAAAGAAGGTACTATAGGGACAAAGATGT
TTTTCATACAAGAAGGAATCGTTGATATTATCACTAAAGACGGAGAAGTT
GCAACTAGTCTTTCAGACGGATCCTATTTCGGAGAAATTTGTCTTCTCAC
TAATGCTAAAAGAGTTGCAAGTGTTCGGGCGGAAACCTACTGCAATTTAT
ATTCACTAGATGCTGAACATTTTCAAGCAGTTCTAGAAAATTACCCGTTA
ATGCGTCGAACTATGGAAAGTGTTGCGGCTGAAAGATTGAGTAAAATTGG
TCAAAATCCTCAAATTGTGTCGAGTAGAGAAGATTTGAAAGAAGATCTGA
ATCTTGTAAAGGAAATCGTCAGTTCTGTCACTCCGATTGGAAGCGACGAT
GACGACGACAAATGCAATCCGGATGAATGCGAAAATTTAATGCAATCGAA
TTCATCAATGAATGCTCGAAAGAAAAAACAGTCAAGCGCATCGAAAAAAT
GTCGGAATTCATTCTCACAGAGAAAATCAGCATTACGACAGGGTATTCAA
AATGTGCTGAGACTGACAAAATCCAAATCCAATCTATCATTCTCCAGTGC
TGTTAAAAGGTCCAATGCTCGAAATTCAAGCTGTTTTGTTGCTGAAAAAT
CGGATTCTACTAGCAAAGACTATCTGACAGTCCATCCGAAAAAAGAATCA
GACACCAAACCAACATTTCTATCCAATGAAGGAGGTTTTGAAAACCAATT
GCAAATTTTGATAACTCCTTCTCCAACCCCAGATAGTCCCCCTCCCGTTT
ACAGTATTAGTGATAAAGAATCTTGTGTTTAATGTTTGGAGTTGTTTTTA
GTTAGTTCTCTTACGATATTACTGTCTCAGATTTCATCAGCTTGATATTG
TATATATTTATATCTTTCTTGCTACGATTTTTTTTAAATGTGATTAGTGA
TATGCGATAACCGAAGTAAGAGAGACATATAAAGAAAGAGAGGGAGAGAA
AGAGAGAGTAAATTAATCTTTTTTTGTAAAGTCTTTTTGTAGTTGACCTT
ATTTTTCATGAAATATGATTTTTTTATGAATTGTTGATAGATTTAATATT
ATGTAATTTTAGAACAGATAAAGTGGATTTTTGAGGGGAAAATGTTATTT
ATCAATTTTGATGTACTGAAAATGAT
back to top

protein sequence of SMED30004463-orf-1

>SMED30004463-orf-1 ID=SMED30004463-orf-1|Name=SMED30004463-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1038bp
MKSRKYSSNILEVPVQLLPDDERSRVEAKYSRKHSEIYFKNLFENPRHLY
KESTYRRCSDILAMSSYLGIDPSELSANITPNKSVFHSDVSRPYSKVTHH
SKLAHATSLSSTFHNSLEGCNTLPHIPATNSQKHVLRNMHSNLSFEIDIP
TSFITNPRLSGRRSSKSLEFSSLQFAEESRQETIPESIMEQFVCPTPCKA
YSAIANGDIENNGSSVASTILVSNRNSTTYRTPHKNKRRWPSIKSKFGKF
GSMGKVDHLQHSVPLIHRSDHDDNNYQGSEKTAHSLSNIDSSFEKDIIKR
SHEADGQFEDVDERSDESNDENDDQTNGDLNNKSRASSYLKEQFFSFFQP
SDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLI
TNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFA
DEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFF
HAGRTLRIFRLAKLLSMLRLLRLSRLVRYVSQWEEKYLISTCDQGYLTFP
QKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCN
LKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATC
YALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYY
EHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVS
EVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSD
GSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTME
SVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGSDDDDDKCN
PDECENLMQSNSSMNARKKKQSSASKKCRNSFSQRKSALRQGIQNVLRLT
KSKSNLSFSSAVKRSNARNSSCFVAEKSDSTSKDYLTVHPKKESDTKPTF
LSNEGGFENQLQILITPSPTPDSPPPVYSISDKESCV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR003938K_chnl_volt-dep_EAG/ELK/ERG
IPR000595cNMP-bd_dom
IPR013621Ion_trans_N
IPR005821Ion_trans_dom
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
IPR009057Homeobox-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003938Potassium channel, voltage-dependent, EAG/ELK/ERGPRINTSPR01463EAGCHANLFMLYcoord: 610..627
score: 37.33
coord: 425..435
score: 35.51
coord: 819..827
score: 71.88
coord: 654..663
score: 45.62
coord: 436..445
score: 46.56
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 740..854
e-value: 5.8E-21
score: 85.6
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 759..842
e-value: 5.2E-19
score: 68.1
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 740..856
score: 28.16
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 740..849
e-value: 5.9383E-27
score: 104.33
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 732..860
e-value: 5.6E-46
score: 157.4
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 389..666
e-value: 3.1E-16
score: 59.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 389..662
e-value: 1.8E-6
score: 29.6
NoneNo IPR availableGENE3DG3DSA:1.10.287.630coord: 663..731
e-value: 1.1E-32
score: 114.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 910..939
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1016..1037
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 310..324
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 304..332
NoneNo IPR availablePANTHERPTHR45689:SF7POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLIC NUCLEOTIDE-GATED CHANNEL 3coord: 329..870
NoneNo IPR availablePANTHERPTHR45689FAMILY NOT NAMEDcoord: 329..870
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 382..663
NoneNo IPR availableTMHMMTMhelixcoord: 421..440
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 566..588
NoneNo IPR availableTMHMMTMhelixcoord: 639..661
NoneNo IPR availableTMHMMTMhelixcoord: 610..627
IPR013621Ion transport N-terminalPFAMPF08412Ion_trans_Ncoord: 344..387
e-value: 5.6E-24
score: 83.5
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 767..783
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 667..857