Cytoplasmic FMR1-interacting protein

Overview
NameCytoplasmic FMR1-interacting protein
Smed IDSMED30004459
Length (bp)4019
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytoplasmic FMR1-interacting protein (SMED30004459) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytoplasmic FMR1-interacting protein (SMED30004459) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytoplasmic FMR1-interacting protein (SMED30004459) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytoplasmic FMR1-interacting protein (SMED30004459) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004459

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004459SMESG000062092.1 Contig3712GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30004459SMESG000062092.1 dd_Smed_v4_1820_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004459SMESG000062092.1 dd_Smed_v4_1820_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004459SMESG000062092.1 dd_Smed_v4_1820_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004459SMESG000062092.1 dd_Smed_v4_1820_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004459SMESG000062092.1 dd_Smed_v6_1820_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Human
Match: CYFIP2 (cytoplasmic FMR1 interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:13760])

HSP 1 Score: 840.877 bits (2171), Expect = 0.000e+0
Identity = 471/1239 (38.01%), Postives = 728/1239 (58.76%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLN ++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ L K++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGC+I+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN +F  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Human
Match: CYFIP2 (cytoplasmic FMR1 interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:13760])

HSP 1 Score: 840.877 bits (2171), Expect = 0.000e+0
Identity = 471/1239 (38.01%), Postives = 728/1239 (58.76%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLN ++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ L K++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGC+I+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN +F  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Human
Match: CYFIP2 (cytoplasmic FMR1 interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:13760])

HSP 1 Score: 834.328 bits (2154), Expect = 0.000e+0
Identity = 472/1257 (37.55%), Postives = 727/1257 (57.84%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPK----------ASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKI--PPGSTQ--------LYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I      W  G +P                +I +P +A   S  +              Q   R +  P G TQ        LY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLN ++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ L K++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGC+I+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN +F  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREPPNDPCLRGEKDPKGGFDIKVPRRAVGPSSTQAC------------QWSPRALFHPTGGTQGRRGCRSLLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVE 1254          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Human
Match: AC270230.1 (pep chromosome:GRCh38:CHR_HG2365_PATCH:23539361:23616629:-1 gene:ENSG00000288461.1 transcript:ENST00000672091.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AC270230.1)

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 459/1235 (37.17%), Postives = 725/1235 (58.70%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXA-----YDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFV----PMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NFNTN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL  F  FQ  A+++FC E+  LC   +R++F+SEA ++ +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L+ +L  ISG+E+   +++NLCV  Y  + YL   EKH L+ V+ F L+LMD S S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   S+W   T++  S Q  I   ++Q R ++    +ELA+YSN+ V+  +   +     A     +DLAL+ LQLLS+W+  +++ +SWKL H  D + N + P  AE+YE+ATRYNY S+EKFAL+EVIAMIK +Q  + RME  F   I   +Y  +Q F  ++L E   +  KK  N +  +LQ+I     D +  +E     P     L  +K              ++  R + P STQLY++R ++ESL  +K+ +K  LR   +  ++  +E+FH++SFF+++L+NF++TL   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++ + +EY+LY LDLYNDSA  AL +F +QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KR ++   N   + I+ PP  RY TL+KQRH+QLLGRS +L +LI+ R++ ++Y+SLE  I +F+   LTSI+E D L+ I+R+ ++ LS+YL LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV    P  + ++    +   + +   L GSK LN  +  I   Y  ++G  H   IC+ +GY GI  ++ +L  + +SLL+  +  Y+  LME MP           +  +++ F+ +L+ ++E   L T     L   GN I+F L IE +L++ E  D+  A PF NI P+       E +D    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    +N  +   +   F+ +WS + + +  P    +  +++ FG+GL WAGC I+ LLGQQR F   D C  +++  +   K EI     L  + +RIR    +N+ I   L++YL + D
Sbjct:   27 PCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRW-TCTSSGSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHE-----PFNDPALRGEKDPKS------GFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQ-GATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQR---DKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPR-VHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFL-------DDPI----W-RGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGD 1230          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Human
Match: AC270230.1 (pep chromosome:GRCh38:CHR_HG2365_PATCH:23539361:23616629:-1 gene:ENSG00000288461.1 transcript:ENST00000671714.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AC270230.1)

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 459/1235 (37.17%), Postives = 725/1235 (58.70%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXA-----YDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFV----PMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NFNTN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL  F  FQ  A+++FC E+  LC   +R++F+SEA ++ +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L+ +L  ISG+E+   +++NLCV  Y  + YL   EKH L+ V+ F L+LMD S S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   S+W   T++  S Q  I   ++Q R ++    +ELA+YSN+ V+  +   +     A     +DLAL+ LQLLS+W+  +++ +SWKL H  D + N + P  AE+YE+ATRYNY S+EKFAL+EVIAMIK +Q  + RME  F   I   +Y  +Q F  ++L E   +  KK  N +  +LQ+I     D +  +E     P     L  +K              ++  R + P STQLY++R ++ESL  +K+ +K  LR   +  ++  +E+FH++SFF+++L+NF++TL   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++ + +EY+LY LDLYNDSA  AL +F +QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KR ++   N   + I+ PP  RY TL+KQRH+QLLGRS +L +LI+ R++ ++Y+SLE  I +F+   LTSI+E D L+ I+R+ ++ LS+YL LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV    P  + ++    +   + +   L GSK LN  +  I   Y  ++G  H   IC+ +GY GI  ++ +L  + +SLL+  +  Y+  LME MP           +  +++ F+ +L+ ++E   L T     L   GN I+F L IE +L++ E  D+  A PF NI P+       E +D    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    +N  +   +   F+ +WS + + +  P    +  +++ FG+GL WAGC I+ LLGQQR F   D C  +++  +   K EI     L  + +RIR    +N+ I   L++YL + D
Sbjct:   27 PCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRW-TCTSSGSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHE-----PFNDPALRGEKDPKS------GFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQ-GATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQR---DKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPR-VHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFL-------DDPI----W-RGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGD 1230          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Celegans
Match: gex-2 (Cytoplasmic FMR1-interacting protein homolog [Source:UniProtKB/Swiss-Prot;Acc:O44518])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 437/1224 (35.70%), Postives = 675/1224 (55.15%), Query Frame = 3
Query:  138 DVPCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPS--PNINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKT--RKIPPGSTQLYLIRCIVESLFQNK---TRNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLE-LDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQL--WGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAE-QVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSA-FYMIWSVILYSFSKPD-DKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIF 3755
            D+P ++A  L + Y  NF+TN ED + F    A Y +EA  H + + +L +G      +YTWR CSRA+P      N+      I E  +E+LKP + KL  F  F   A+++FCEE+  LC   KR +F+SEA +L +   + MF ++DE+KNMKA +KND + ++RA+Q L  +       D  + SM+LA Q+ ++ DLK ++  I G+E+   +++N+C  MY  + YL   EKH  V VIAFSLFLMD   +    +++ ++L +S++D+I K  EVV ++GDM I PF F++ + +Y+ SKWP +          I+  +   RS++ S   + AK +N   I     +   N+    LAL  +QLL +W+  +++T SWKL +  +   N E P+ AE+YE+ATRYNY   EK ALI++IAMIK +Q+ L + E     +    +Y E+Q F+H +++E   K  K   + L  ILQS+     D  A NEL      K     KKK +A       +  S ++   R   PGSTQLY+ R  +ESL  +K    +  LR+E D +++  +  F +KS  W  L   +D+++ + +LSQLW+REF+LEMT G+RIQFPIE S+P ILT++IL   +P+ IE  LY LDLYND+A  +L  F +QFLY+E+EAEVN    Q V +LS+ +F  YKQ AS MLL+KRFK  I  S  + I +P   R+ +L++QRH+QLLGRS +L +++S R+N +L ++L+A I KF+   L+SI+E D LI  +RLC+  LS  L  +  FD +  E   +  S  G ++  +  E+     PNF +N  T+RFV     +R  P       ++ Q+  WGSK+L + F  I   Y+  +G +H+  I + + Y GI  +L +L  +   LL + ++ ++  +   MP           +  L++ +   L  V + P L +E    L   GN I+F  Q+E  L   EA D+  A  +    PQP + +  E+M +L  KL  K+S   +  ++D +   + Q  ++K    +TKERLC   + F+ FL  ++++L    I          WT         +F  D+   +Y ++S + +   +P  D  +   +E+FG+ LQW G  ++ LLGQ R FE  D C  + R N+A  K+  I    L  + +RIR    +NN+IF
Sbjct:   25 DLPDIEARALPLLYRSNFDTNFEDRSAFVTGIAKYSEEATRHAQFNDMLSEGLQHAANMYTWRCCSRAVPMAK--SNDQPNRTEINEMVVEVLKPEVSKLGSFMRFTLTAIQRFCEEVRRLCHSEKRRDFVSEAYLLTLGRFINMFAVLDELKNMKASIKNDFSTFRRASQFLTAMSDTQAVHDMQNLSMFLATQNKIKDDLKLQMKTIEGYEELLCDVVNICAHMYEHQLYLSPNEKHMFVKVIAFSLFLMDGDAANVAKLDQKKRLSISRLDKIFKTLEVVPLYGDMQIQPFAFVRRSSHYEPSKWPLSDKESDRCHVNIVEKVQSIRSDHESYVTQFAKINNEVAICDRPGNDSENREITSLALSGIQLLCQWSCAVVETISWKLLNPTNPKDNRECPENAEEYERATRYNYSPAEKTALIQIIAMIKGLQSMLGKTESDMSNSTRKCVYVELQAFIHHTINEPLQKAVKHKKDLLASILQSVKDSISD--AGNELNRMTDVKG----KKKSSAPKGDSANSSSSDIRIPRRTAAPGSTQLYMARTQLESLISDKLCGGKKILRKELDSKTIEKISVFLRKSAHWPALFRLSDSMTEAGELSQLWFREFYLEMTMGQRIQFPIEMSMPWILTDYILSCNEPSLIESALYQLDLYNDAAQYSLFNFNKQFLYDEVEAEVNLCFDQFVYKLSEMVFTHYKQLASCMLLDKRFKAEILRS-GTMIRSPSAARFESLLQQRHVQLLGRSVDLNRVVSQRVNMALLKALDAAIWKFESEPLSSIVELDMLIDTNRLCHTLLSDVLHSIAPFDDLFQEANHAVNSPHGRITLHVFWELNYDFVPNFVYNGSTHRFVRARHVFRKTPAREKP-PQVGQVYYWGSKSLMAAFMNICNAYSQCIGTQHLKAITRLLHYQGIAVILDELLKMTNRLLNDKIRRHVRNVFNMMPKVCKLPRSDYGSNALLQYYVHHLEAVGKYPELKSEFCQDLRELGNMIVFCQQLEVALGQEEAHDLFLAAAYTGTVPQPPARNAQEQMKQL-AKLEDKYSRIHLTEIIDKISPDDGQAAIAKDAELMTKERLCCGLNAFENFLVRIKQMLAADDI----------WT--GGYPTNGVFWIDECVEWYRVYSALQFFLCQPTRDDNEVYAEELFGDSLQWGGLTLITLLGQHRRFEVLDFCYHLHRVNKADGKDEVISGIRLAKMVERIRRFQLLNNQIF 1225          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Celegans
Match: gex-2 (Cytoplasmic FMR1-interacting protein homolog [Source:UniProtKB/Swiss-Prot;Acc:O44518])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 437/1224 (35.70%), Postives = 675/1224 (55.15%), Query Frame = 3
Query:  138 DVPCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPS--PNINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKT--RKIPPGSTQLYLIRCIVESLFQNK---TRNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLE-LDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQL--WGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAE-QVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSA-FYMIWSVILYSFSKPD-DKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIF 3755
            D+P ++A  L + Y  NF+TN ED + F    A Y +EA  H + + +L +G      +YTWR CSRA+P      N+      I E  +E+LKP + KL  F  F   A+++FCEE+  LC   KR +F+SEA +L +   + MF ++DE+KNMKA +KND + ++RA+Q L  +       D  + SM+LA Q+ ++ DLK ++  I G+E+   +++N+C  MY  + YL   EKH  V VIAFSLFLMD   +    +++ ++L +S++D+I K  EVV ++GDM I PF F++ + +Y+ SKWP +          I+  +   RS++ S   + AK +N   I     +   N+    LAL  +QLL +W+  +++T SWKL +  +   N E P+ AE+YE+ATRYNY   EK ALI++IAMIK +Q+ L + E     +    +Y E+Q F+H +++E   K  K   + L  ILQS+     D  A NEL      K     KKK +A       +  S ++   R   PGSTQLY+ R  +ESL  +K    +  LR+E D +++  +  F +KS  W  L   +D+++ + +LSQLW+REF+LEMT G+RIQFPIE S+P ILT++IL   +P+ IE  LY LDLYND+A  +L  F +QFLY+E+EAEVN    Q V +LS+ +F  YKQ AS MLL+KRFK  I  S  + I +P   R+ +L++QRH+QLLGRS +L +++S R+N +L ++L+A I KF+   L+SI+E D LI  +RLC+  LS  L  +  FD +  E   +  S  G ++  +  E+     PNF +N  T+RFV     +R  P       ++ Q+  WGSK+L + F  I   Y+  +G +H+  I + + Y GI  +L +L  +   LL + ++ ++  +   MP           +  L++ +   L  V + P L +E    L   GN I+F  Q+E  L   EA D+  A  +    PQP + +  E+M +L  KL  K+S   +  ++D +   + Q  ++K    +TKERLC   + F+ FL  ++++L    I          WT         +F  D+   +Y ++S + +   +P  D  +   +E+FG+ LQW G  ++ LLGQ R FE  D C  + R N+A  K+  I    L  + +RIR    +NN+IF
Sbjct:   25 DLPDIEARALPLLYRSNFDTNFEDRSAFVTGIAKYSEEATRHAQFNDMLSEGLQHAANMYTWRCCSRAVPMAK--SNDQPNRTEINEMVVEVLKPEVSKLGSFMRFTLTAIQRFCEEVRRLCHSEKRRDFVSEAYLLTLGRFINMFAVLDELKNMKASIKNDFSTFRRASQFLTAMSDTQAVHDMQNLSMFLATQNKIKDDLKLQMKTIEGYEELLCDVVNICAHMYEHQLYLSPNEKHMFVKVIAFSLFLMDGDAANVAKLDQKKRLSISRLDKIFKTLEVVPLYGDMQIQPFAFVRRSSHYEPSKWPLSDKESDRCHVNIVEKVQSIRSDHESYVTQFAKINNEVAICDRPGNDSENREITSLALSGIQLLCQWSCAVVETISWKLLNPTNPKDNRECPENAEEYERATRYNYSPAEKTALIQIIAMIKGLQSMLGKTESDMSNSTRKCVYVELQAFIHHTINEPLQKAVKHKKDLLASILQSVKDSISD--AGNELNRMTDVKG----KKKSSAPKGDSANSSSSDIRIPRRTAAPGSTQLYMARTQLESLISDKLCGGKKILRKELDSKTIEKISVFLRKSAHWPALFRLSDSMTEAGELSQLWFREFYLEMTMGQRIQFPIEMSMPWILTDYILSCNEPSLIESALYQLDLYNDAAQYSLFNFNKQFLYDEVEAEVNLCFDQFVYKLSEMVFTHYKQLASCMLLDKRFKAEILRS-GTMIRSPSAARFESLLQQRHVQLLGRSVDLNRVVSQRVNMALLKALDAAIWKFESEPLSSIVELDMLIDTNRLCHTLLSDVLHSIAPFDDLFQEANHAVNSPHGRITLHVFWELNYDFVPNFVYNGSTHRFVRARHVFRKTPAREKP-PQVGQVYYWGSKSLMAAFMNICNAYSQCIGTQHLKAITRLLHYQGIAVILDELLKMTNRLLNDKIRRHVRNVFNMMPKVCKLPRSDYGSNALLQYYVHHLEAVGKYPELKSEFCQDLRELGNMIVFCQQLEVALGQEEAHDLFLAAAYTGTVPQPPARNAQEQMKQL-AKLEDKYSRIHLTEIIDKISPDDGQAAIAKDAELMTKERLCCGLNAFENFLVRIKQMLAADDI----------WT--GGYPTNGVFWIDECVEWYRVYSALQFFLCQPTRDDNEVYAEELFGDSLQWGGLTLITLLGQHRRFEVLDFCYHLHRVNKADGKDEVISGIRLAKMVERIRRFQLLNNQIF 1225          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Fly
Match: Sra-1 (gene:FBgn0038320 transcript:FBtr0083085)

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 500/1264 (39.56%), Postives = 739/1264 (58.47%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQ--EKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNINR---NRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSN--ANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNG-----------------------KRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPM---LESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLS-KLKYLNESLLKNNLKHYISLLMEHMPSN--LFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++A   ++ Y+ NF+TN ED NGF    A Y +EA  H  L+ LL++G+   +MLYTWR CSRA+P       + E  N ++  EKT+E+L P ++KL  F  FQ +A++ F  E+  LC   KR++F+SEA +L +   + MF ++DE+KNMK+ +KND++ Y+RAAQ LK++       ++ + SM+LA Q+ +R  +K  L KI G+ED   +++N+CV M+  K YL  EEKH LV V+ F LFLMD S + NIN+    +K+ L +ID+I K  EVV +FGDM I PF +IK + ++DSSKWP +++N IS Q  +M H+ Q R ++    +ELA+Y+N     + +N    EN  +A DLAL+ LQLLS+WT+ + + +SWKL H  D H N E P EAE+YE+ATRYNY S+EKFALIEVIAMIK +Q  ++R+E    E I   IY E+Q F+ +SL E   K  K   + +  I+ S+      W  G +P           D      KK             + Q+    + P STQLY++R ++ESL  +K+  K  LR++ D   L  ++ FHK SF+WSYLLNF+DTL   CDLSQLWYREF+LEMT G                       KRIQFPIE S+P ILT+HIL T++P+ +E++LYPLDLYNDSA  AL  F++QFLY+E+EAEVN    Q V +LS+QIF  YKQ A S+ L+KRF+        +  + P   RY TL+KQRH+QLLGRS +L KLI+ RIN ++++S+E  I +F+ N +T I+E + L+  +R+C++ LSKYL LD+FD ++ E   +  + +G ++  +  E+      N+ +N+ TNRF+     L S ++   E         LWGSK LN+ +      Y G++G  H   +C+ +GY GI  ++   LK + + L++ +L  +   LM  MP +  L  C  G     ++  +   L  +++ P+  TE+  +   FGN IIF L IE  L+  E  D+  A  F NIFP+P    N E+ +  + +L  +F+  +I + ++ +GTA+Q  ++++   LT+ERLC   SIF+  LN ++             L+   W       N  I   + S F+ +WS + + +  P    +  I+E+FGEGL WAGC ++ LLGQQR FE  D C  I+R  R   K+  ++  +L  +  RIR    +N++IF  LN+YL   D
Sbjct:   27 PCIEAQPCSIIYKANFDTNFEDRNGFVTGIAKYIEEATTHANLNVLLDEGQKHAVMLYTWRCCSRAIP----QPKSNEQPNRVEIYEKTVEVLAPEVNKLLNFMYFQRKAIEAFSGEVKRLCHAEKRKDFVSEAYLLTLGKFINMFAVLDELKNMKSSVKNDYSTYRRAAQFLKVMSDSHTLQESQNLSMFLATQNKIRDTVKDTLEKIVGYEDLLSDVVNICVHMFETKMYLTPEEKHMLVKVMGFGLFLMD-SDACNINKLDQKKKIRLDRIDRIFKNLEVVPLFGDMQIAPFNYIKRSKHFDSSKWPLSSSNAISPQADLMVHLPQIREDHVKYISELARYTNEVTTTVKENPSDAENRITA-DLALRGLQLLSEWTSVVTELYSWKLLHPTDHHQNKECPVEAEEYERATRYNYTSEEKFALIEVIAMIKGLQVLMARIETVLCEAIRRNIYSELQDFVQLSLREPLRKAVKNKKDLIRSIIMSVRETSADWQKGYEPT----------DDPVAKGKKDPDG-------GFRIQVPRLNVGPSSTQLYMVRTMLESLIADKSGGKRTLRKDIDGNCLLQIDTFHKTSFYWSYLLNFSDTLQKCCDLSQLWYREFYLEMTMGRKVNKCLVRHQHNEECKDLITMEKRIQFPIEMSMPWILTDHILQTKEPSMMEFVLYPLDLYNDSAYYALTVFRKQFLYDEVEAEVNLCFDQFVYKLSEQIFAHYKQLAGSIFLDKRFRLECEVLGFNFQSYPRNNRYETLLKQRHVQLLGRSIDLNKLITQRINANMHKSIELAISRFEGNDITGIVELEGLLEANRICHKLLSKYLALDNFDGMVKEANHNVLAPYGRITLHVFVELNYDFLVNYCYNAATNRFIRTKVNLSSSQAIQREKPPQMSHYYLWGSKQLNAAYSTQYGQYTGFVGSPHFHAMCRLLGYQGIAVVMDIILKDIVKPLIQGSLLQFTKTLMIAMPKSCKLPRCEYGSPG--VLSYYQAHLTDIVQYPDAKTELFQSFREFGNSIIFCLLIEQALSQEEVCDLLHAALFQNIFPRPFCKEN-EKPEAKQKRLEAQFANLQIVSNVEKIGTAKQAMIAREGDLLTRERLCCGLSIFEVILNRVKSY-----------LDDPVWCGPP-PANGIIHVDECSEFHRLWSALQFVYCIPVRGTEYTIEELFGEGLNWAGCVMIVLLGQQRRFEALDFCYHILRVQRVDGKDEDVKGIQLKRMVDRIRRFQVLNSQIFSILNKYLKGGD 1252          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Zebrafish
Match: cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:ZFIN;Acc:ZDB-GENE-080724-2])

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 473/1233 (38.36%), Postives = 730/1233 (59.21%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K  +VV +FGDM I    +I+ + +Y+   SKW   T + IS Q  +   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+T +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFAL+EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I     D + + E     P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDS   AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ LSK++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN ++F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +DN+    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+  V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK-LQVVPLFGDMQIELSRYIETSAHYEENKSKW-TCTQSSISPQYNLCEQMVQIREDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSTHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNQAIRHTIYSALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGARE----PPNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEDFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSGYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLSKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAVLFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFL-------QDNV----W-RGPPPTNGVMHVDECMEFHRLWSAMQFVYCIPVGTHEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAILNKYMKAVE 1228          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Zebrafish
Match: cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:ZFIN;Acc:ZDB-GENE-080724-2])

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 473/1233 (38.36%), Postives = 730/1233 (59.21%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K  +VV +FGDM I    +I+ + +Y+   SKW   T + IS Q  +   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+T +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFAL+EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I     D + + E     P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDS   AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ LSK++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN ++F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +DN+    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+  V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK-LQVVPLFGDMQIELSRYIETSAHYEENKSKW-TCTQSSISPQYNLCEQMVQIREDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSTHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNQAIRHTIYSALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGARE----PPNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEDFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSGYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLSKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAVLFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFL-------QDNV----W-RGPPPTNGVMHVDECMEFHRLWSAMQFVYCIPVGTHEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAILNKYMKAVE 1228          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Zebrafish
Match: cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:ZFIN;Acc:ZDB-GENE-080724-2])

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 473/1234 (38.33%), Postives = 730/1234 (59.16%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNL-NISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K  +VV +FGDM I    +I+ + +Y+   SKW   T + IS Q  +   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+T +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFAL+EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I     D + + E     P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDS   AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ LSK++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN ++F L IE  L +  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +DN+    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+  V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK-LQVVPLFGDMQIELSRYIETSAHYEENKSKW-TCTQSSISPQYNLCEQMVQIREDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSTHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNQAIRHTIYSALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGARE----PPNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEDFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSGYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLSKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAVLFCLLIEQALVSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFL-------QDNV----W-RGPPPTNGVMHVDECMEFHRLWSAMQFVYCIPVGTHEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAILNKYMKAVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Zebrafish
Match: cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:ZFIN;Acc:ZDB-GENE-080724-2])

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 473/1234 (38.33%), Postives = 730/1234 (59.16%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNL-NISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K  +VV +FGDM I    +I+ + +Y+   SKW   T + IS Q  +   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+T +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFAL+EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I     D + + E     P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDS   AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ LSK++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN ++F L IE  L +  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +DN+    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+  V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK-LQVVPLFGDMQIELSRYIETSAHYEENKSKW-TCTQSSISPQYNLCEQMVQIREDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSTHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNQAIRHTIYSALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGARE----PPNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEDFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSGYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLSKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAVLFCLLIEQALVSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFL-------QDNV----W-RGPPPTNGVMHVDECMEFHRLWSAMQFVYCIPVGTHEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAILNKYMKAVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Zebrafish
Match: cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:ZFIN;Acc:ZDB-GENE-080724-2])

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 473/1234 (38.33%), Postives = 730/1234 (59.16%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNL-NISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K  +VV +FGDM I    +I+ + +Y+   SKW   T + IS Q  +   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+T +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFAL+EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I     D + + E     P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDS   AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ LSK++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN ++F L IE  L +  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +DN+    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+  V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK-LQVVPLFGDMQIELSRYIETSAHYEENKSKW-TCTQSSISPQYNLCEQMVQIREDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSTHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNQAIRHTIYSALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGARE----PPNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEDFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSGYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLSKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAVLFCLLIEQALVSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFL-------QDNV----W-RGPPPTNGVMHVDECMEFHRLWSAMQFVYCIPVGTHEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAILNKYMKAVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Xenopus
Match: cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:NCBI gene;Acc:100126215])

HSP 1 Score: 842.417 bits (2175), Expect = 0.000e+0
Identity = 476/1239 (38.42%), Postives = 728/1239 (58.76%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAM+K +Q  + RME  F + I   IY  +Q F   SL E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +EEFHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +LSDQIF +YK  + S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ LSK+L LD FD +  E   + ++ +G  +  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +    + +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCNEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMVKGLQVLMGRMESVFNQAIRNTIYAALQDFAQSSLREPLRQAVRKKKNVLISVLQAIRKTVCDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEEFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLSDQIFAYYKAMSGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLDINRLTHRLLSKHLTLDSFDAMFREANHNVSAPYGRNTLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVELHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAVLNKYMKSVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Xenopus
Match: cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:NCBI gene;Acc:100126215])

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 476/1252 (38.02%), Postives = 728/1252 (58.15%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQ-------------LYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAM+K +Q  + RME  F + I   IY  +Q F   SL E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQ             LY++R ++ESL  +K+ +K  LR   D   +  +EEFHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +LSDQIF +YK  + S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ LSK+L LD FD +  E   + ++ +G  +  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +    + +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCNEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMVKGLQVLMGRMESVFNQAIRNTIYAALQDFAQSSLREPLRQAVRKKKNVLISVLQAIRKTVCDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQVGCCGNPRYLFLQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEEFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLSDQIFAYYKAMSGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLDINRLTHRLLSKHLTLDSFDAMFREANHNVSAPYGRNTLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVELHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAVLNKYMKSVE 1242          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Xenopus
Match: CYFIP1 (cytoplasmic FMR1 interacting protein 1 [Source:NCBI gene;Acc:101734874])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 462/1252 (36.90%), Postives = 728/1252 (58.15%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXA-----YDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDP----------KASNELEISIPDKASTLSKKKGAAEL-LQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFV----PMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ ++ NFNTN ED N F    A Y ++A VH  ++ +LE+G+++ IMLYTWRSCSRA+P   +  N       I EKT+++L+P + KL  F  FQ  A ++FC E+  LC   +R++F+SEA ++ +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L+ +L  I G+E+   +++NLCV  Y  K YL   EKH L+ V+ F L+LMD S S    ++  +++ L+KID+  K+ +VV +FGDM I    +IK + +Y+   S+W   T++  S Q  I   ++Q R ++    +ELA+YSN+ V+  +   +     A     +DL+L+ LQLLS+W+  +++ +SWKL H  D + N + P  AE+YE+ATRYNY S+EKFAL+EVIAMIK +Q  + RME  F   I   IY E+Q F  ++L E   +  KK  N +  +LQ+I      W  G +P             +  +I +P +A   S  +    + + F E     +         TQLY++R ++ESL  +K+ +K  LR   +  ++  +E+FH++SFF+++L+NF++TL   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++ + +EY+LY LDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF  YK  A  +LL+KR +    N   S I+ P   RY TL+KQRH+QLLGRS +L +LI+ RI+ +LY SLE  I +F+   LTSI+E D LI I+RL ++ LSKYL LD FD +  E   + ++ +G ++  +  E+     PN+ +N  T RFV    P  + ++    +   + +   L+GSK LN  +  +   Y  ++G  H   IC+ +GY GI  ++ +L  + +SLL+  +  Y+  LME MP           +  +++ F+ +L+ ++E   L T     L   GN ++F L IE +L++ E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  +Q  L       +D +    W R    +N  +   +   F+ +WS + + +  P    +  +++ FG+GL WAGC I+ALLGQ R F+  D C  +++  +   K+  I++  L  + +RIR    +N+ IF  L++Y  +VD
Sbjct:   27 PCIEPPPSSILFQPNFNTNFEDRNAFVTGIARYIEQATVHSGMNEMLEEGQEYAIMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVDVLEPEVTKLMNFMYFQRNATERFCAEVKRLCHAERRKDFVSEAYLMTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVIPGYEELLADIVNLCVDYYENKMYLTPGEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLNKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRW-TCTSSSSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLSLQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDNAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTIYAELQDFAQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWGAGCEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQYDFSMYIPFFECFSLLI---------TQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAHYKVVAGGLLLDKRLRADCKNQGAS-ISQPTSNRYDTLLKQRHVQLLGRSIDLNRLITQRISAALYRSLELAIGRFESEDLTSIVELDGLIEINRLTHKLLSKYLTLDSFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTYRFVRTVMPFSQEFQR---DKQPNAQPQYLFGSKLLNLAYSSMFSYYRHFVGPPHFKVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNTLLFCLLIEQSLSLEEVCDLLHAAPFQNILPR-VHVKEGERLEAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRVQTFL-------DDAI----W-RGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLNWAGCMIIALLGQHRRFDVLDFCYHLLKVQKHDGKDEVIKNVPLKKMVERIRKFQILNDEIFGILDKYSKSVD 1249          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Xenopus
Match: cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:NCBI gene;Acc:100126215])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 464/1238 (37.48%), Postives = 707/1238 (57.11%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAM+K +Q  + RME  F + I   IY  +Q F   SL E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +EEFHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +LSDQIF +YK  + S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ LSK+L LD FD +  E   + ++ +G  +  +  E+     PN+ +N  TNRFV     +   P      D+   ++GS T                           + Y    W    L  L+   L+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +    + +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCNEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMVKGLQVLMGRMESVFNQAIRNTIYAALQDFAQSSLREPLRQAVRKKKNVLISVLQAIRKTVCDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEEFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLSDQIFAYYKAMSGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLDINRLTHRLLSKHLTLDSFDAMFREANHNVSAPYGRNTLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEP----QRDKPANVFGSFT--------------------------NVSYTIRIWPGDSLLCLSHFQLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVELHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAVLNKYMKSVE 1198          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Xenopus
Match: cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:NCBI gene;Acc:100126215])

HSP 1 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 461/1239 (37.21%), Postives = 705/1239 (56.90%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  +                            +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAM+K +Q  + RME  F + I   IY  +Q F   SL E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +EEFHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +LSDQIF +YK  + S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ LSK+L LD FD +  E   + ++ +G  +  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +    + +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSM----------------------------VKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCNEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMVKGLQVLMGRMESVFNQAIRNTIYAALQDFAQSSLREPLRQAVRKKKNVLISVLQAIRKTVCDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEEFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLSDQIFAYYKAMSGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLDINRLTHRLLSKHLTLDSFDAMFREANHNVSAPYGRNTLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVELHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAVLNKYMKSVE 1203          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Mouse
Match: Cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:MGI Symbol;Acc:MGI:1924134])

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 472/1239 (38.10%), Postives = 728/1239 (58.76%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G D+ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLN ++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ L K++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGC+I+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN +F  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHDYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Mouse
Match: Cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:MGI Symbol;Acc:MGI:1924134])

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 472/1239 (38.10%), Postives = 728/1239 (58.76%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G D+ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLN ++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ L K++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGC+I+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN +F  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHDYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Mouse
Match: Cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:MGI Symbol;Acc:MGI:1924134])

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 472/1239 (38.10%), Postives = 728/1239 (58.76%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G D+ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLN ++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ L K++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGC+I+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN +F  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHDYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Mouse
Match: Cyfip1 (cytoplasmic FMR1 interacting protein 1 [Source:MGI Symbol;Acc:MGI:1338801])

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 456/1235 (36.92%), Postives = 725/1235 (58.70%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXA-----YDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFV----PMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NFNTN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL  F  FQ  A+++FC E+  LC   +R++F+SEA ++ +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L+ +L  ISG+E+   +++NLCV  Y  + YL   EKH L+ V+ F L+LMD S S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   S+W   +++  S Q  I   ++Q R ++    +ELA+YSN+ V+  +   +     A     +DLAL+ LQLLS+W+  +++ +SWKL H  D + N + P  AE+YE+ATRYNY ++EKFAL+EVIAMIK +Q  + RME  F   I   +Y  +Q F  ++L E   +  KK  N +  +LQ+I     D +  +E     P     L  +K              ++  R + P STQLY++R ++ESL  +K+ +K  LR   +  ++  +E+FH++SFF+++L+NF++TL   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++ + +EY+LY LDLYNDSA  AL KF +QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KR ++   N   + I+ PP  RY TL+KQRH+QLLGRS +L +LI+ R++ ++Y+SLE  I +F+   LTS++E D L+ I+R+ ++ LS+YL LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV    P  + ++    +   + +   L GSK LN  +  I   Y  ++G  H   IC+ +GY GI  ++ +L  + +SLL+  +  Y+  LME MP           +  +++ F+ +L+ ++E   L T     L   GN ++F L IE +L++ E  D+  A PF NI P+       E +D    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    +N  +   +   F+ +WS + + +  P    +  +++ FG+GL WAGC I+ LLGQQR F   D C  +++  +   K EI     L  + +RIR    +N+ I   L++YL + D
Sbjct:   27 PCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCASSSS-SPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDNAEEYERATRYNYTTEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHE-----PFNDPALRGEKDPKS------GFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTKFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQ-GATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSVVELDGLLEINRMTHKLLSRYLTLDSFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQR---DKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAVLFCLLIEQSLSLEEVCDLLHAAPFQNILPR-IHVKEGERVDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRTFL-------DDPI----W-RGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGD 1230          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Mouse
Match: Cyfip1 (cytoplasmic FMR1 interacting protein 1 [Source:MGI Symbol;Acc:MGI:1338801])

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 456/1235 (36.92%), Postives = 725/1235 (58.70%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXA-----YDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFV----PMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NFNTN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL  F  FQ  A+++FC E+  LC   +R++F+SEA ++ +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L+ +L  ISG+E+   +++NLCV  Y  + YL   EKH L+ V+ F L+LMD S S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   S+W   +++  S Q  I   ++Q R ++    +ELA+YSN+ V+  +   +     A     +DLAL+ LQLLS+W+  +++ +SWKL H  D + N + P  AE+YE+ATRYNY ++EKFAL+EVIAMIK +Q  + RME  F   I   +Y  +Q F  ++L E   +  KK  N +  +LQ+I     D +  +E     P     L  +K              ++  R + P STQLY++R ++ESL  +K+ +K  LR   +  ++  +E+FH++SFF+++L+NF++TL   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++ + +EY+LY LDLYNDSA  AL KF +QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KR ++   N   + I+ PP  RY TL+KQRH+QLLGRS +L +LI+ R++ ++Y+SLE  I +F+   LTS++E D L+ I+R+ ++ LS+YL LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV    P  + ++    +   + +   L GSK LN  +  I   Y  ++G  H   IC+ +GY GI  ++ +L  + +SLL+  +  Y+  LME MP           +  +++ F+ +L+ ++E   L T     L   GN ++F L IE +L++ E  D+  A PF NI P+       E +D    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    +N  +   +   F+ +WS + + +  P    +  +++ FG+GL WAGC I+ LLGQQR F   D C  +++  +   K EI     L  + +RIR    +N+ I   L++YL + D
Sbjct:   27 PCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCASSSS-SPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDNAEEYERATRYNYTTEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHE-----PFNDPALRGEKDPKS------GFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTKFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQ-GATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSVVELDGLLEINRMTHKLLSRYLTLDSFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQR---DKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAVLFCLLIEQSLSLEEVCDLLHAAPFQNILPR-IHVKEGERVDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRTFL-------DDPI----W-RGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGD 1230          
BLAST of Cytoplasmic FMR1-interacting protein vs. UniProt/SwissProt
Match: sp|Q9VF87|CYFIP_DROME (Cytoplasmic FMR1-interacting protein OS=Drosophila melanogaster OX=7227 GN=Sra-1 PE=1 SV=1)

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 500/1264 (39.56%), Postives = 739/1264 (58.47%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQ--EKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNINR---NRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSN--ANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNG-----------------------KRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPM---LESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLS-KLKYLNESLLKNNLKHYISLLMEHMPSN--LFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++A   ++ Y+ NF+TN ED NGF    A Y +EA  H  L+ LL++G+   +MLYTWR CSRA+P       + E  N ++  EKT+E+L P ++KL  F  FQ +A++ F  E+  LC   KR++F+SEA +L +   + MF ++DE+KNMK+ +KND++ Y+RAAQ LK++       ++ + SM+LA Q+ +R  +K  L KI G+ED   +++N+CV M+  K YL  EEKH LV V+ F LFLMD S + NIN+    +K+ L +ID+I K  EVV +FGDM I PF +IK + ++DSSKWP +++N IS Q  +M H+ Q R ++    +ELA+Y+N     + +N    EN  +A DLAL+ LQLLS+WT+ + + +SWKL H  D H N E P EAE+YE+ATRYNY S+EKFALIEVIAMIK +Q  ++R+E    E I   IY E+Q F+ +SL E   K  K   + +  I+ S+      W  G +P           D      KK             + Q+    + P STQLY++R ++ESL  +K+  K  LR++ D   L  ++ FHK SF+WSYLLNF+DTL   CDLSQLWYREF+LEMT G                       KRIQFPIE S+P ILT+HIL T++P+ +E++LYPLDLYNDSA  AL  F++QFLY+E+EAEVN    Q V +LS+QIF  YKQ A S+ L+KRF+        +  + P   RY TL+KQRH+QLLGRS +L KLI+ RIN ++++S+E  I +F+ N +T I+E + L+  +R+C++ LSKYL LD+FD ++ E   +  + +G ++  +  E+      N+ +N+ TNRF+     L S ++   E         LWGSK LN+ +      Y G++G  H   +C+ +GY GI  ++   LK + + L++ +L  +   LM  MP +  L  C  G     ++  +   L  +++ P+  TE+  +   FGN IIF L IE  L+  E  D+  A  F NIFP+P    N E+ +  + +L  +F+  +I + ++ +GTA+Q  ++++   LT+ERLC   SIF+  LN ++             L+   W       N  I   + S F+ +WS + + +  P    +  I+E+FGEGL WAGC ++ LLGQQR FE  D C  I+R  R   K+  ++  +L  +  RIR    +N++IF  LN+YL   D
Sbjct:   27 PCIEAQPCSIIYKANFDTNFEDRNGFVTGIAKYIEEATTHANLNVLLDEGQKHAVMLYTWRCCSRAIP----QPKSNEQPNRVEIYEKTVEVLAPEVNKLLNFMYFQRKAIEAFSGEVKRLCHAEKRKDFVSEAYLLTLGKFINMFAVLDELKNMKSSVKNDYSTYRRAAQFLKVMSDSHTLQESQNLSMFLATQNKIRDTVKDTLEKIVGYEDLLSDVVNICVHMFETKMYLTPEEKHMLVKVMGFGLFLMD-SDACNINKLDQKKKIRLDRIDRIFKNLEVVPLFGDMQIAPFNYIKRSKHFDSSKWPLSSSNAISPQADLMVHLPQIREDHVKYISELARYTNEVTTTVKENPSDAENRITA-DLALRGLQLLSEWTSVVTELYSWKLLHPTDHHQNKECPVEAEEYERATRYNYTSEEKFALIEVIAMIKGLQVLMARIETVLCEAIRRNIYSELQDFVQLSLREPLRKAVKNKKDLIRSIIMSVRETSADWQKGYEPT----------DDPVAKGKKDPDG-------GFRIQVPRLNVGPSSTQLYMVRTMLESLIADKSGGKRTLRKDIDGNCLLQIDTFHKTSFYWSYLLNFSDTLQKCCDLSQLWYREFYLEMTMGRKVNKCLVRHQHNEECKDLITMEKRIQFPIEMSMPWILTDHILQTKEPSMMEFVLYPLDLYNDSAYYALTVFRKQFLYDEVEAEVNLCFDQFVYKLSEQIFAHYKQLAGSIFLDKRFRLECEVLGFNFQSYPRNNRYETLLKQRHVQLLGRSIDLNKLITQRINANMHKSIELAISRFEGNDITGIVELEGLLEANRICHKLLSKYLALDNFDGMVKEANHNVLAPYGRITLHVFVELNYDFLVNYCYNAATNRFIRTKVNLSSSQAIQREKPPQMSHYYLWGSKQLNAAYSTQYGQYTGFVGSPHFHAMCRLLGYQGIAVVMDIILKDIVKPLIQGSLLQFTKTLMIAMPKSCKLPRCEYGSPG--VLSYYQAHLTDIVQYPDAKTELFQSFREFGNSIIFCLLIEQALSQEEVCDLLHAALFQNIFPRPFCKEN-EKPEAKQKRLEAQFANLQIVSNVEKIGTAKQAMIAREGDLLTRERLCCGLSIFEVILNRVKSY-----------LDDPVWCGPP-PANGIIHVDECSEFHRLWSALQFVYCIPVRGTEYTIEELFGEGLNWAGCVMIVLLGQQRRFEALDFCYHILRVQRVDGKDEDVKGIQLKRMVDRIRRFQVLNSQIFSILNKYLKGGD 1252          
BLAST of Cytoplasmic FMR1-interacting protein vs. UniProt/SwissProt
Match: sp|Q299G2|CYFIP_DROPS (Cytoplasmic FMR1-interacting protein OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Sra-1 PE=3 SV=1)

HSP 1 Score: 868.996 bits (2244), Expect = 0.000e+0
Identity = 499/1264 (39.48%), Postives = 739/1264 (58.47%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQ--EKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNINR---NRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSN--ANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNG-----------------------KRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPM---LESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLS-KLKYLNESLLKNNLKHYISLLMEHMPSN--LFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++A   ++ Y+ NF+TN ED NGF    A Y +EA  H  L+ LL++G+   +MLYTWR CSRA+P       + E  N ++  EKT+E+L P ++KL  F  FQ +A++ F  E+  LC   KR++F+SEA +L +   + MF ++DE+KNMK+ +KND++ Y+RAAQ LK++       ++ + SM+LA Q+ +R  +K  L KI G+ED   +++N+CV M+  K YL  EEKH LV V+ F LFLMD S + NIN+    +K+ L +ID+I K  EVV +FGDM I PF +IK + ++DSSKWP +++N IS Q  +M H+ Q R ++    +ELA+Y+N     + +N    EN  +A DLAL+ LQLLS+WT+ + + +SWKL H  D H N E P EAE+YE+ATRYNY S+EKFALIEVIAMIK +Q  ++R+E    E I   IY E+Q F+ +SL E   K  K   + +  I+ S+      W  G +P           D   +  KK             +  +    + P STQLY++R ++ESL  +K+  K  LR++ D   L  +E FH  SF+WSYLLNF+DTL   CDLSQLWYREF+LEMT G                       KRIQFPIE S+P ILT+HIL T++P+ +E++LYPLDLYNDSA  AL  F++QFLY+E+EAEVN    Q V +LS+QIF  YKQ A S+ L+KRF+        +  + P   RY TL+KQRH+QLLGRS +L KL++ RIN ++++S+E  I +F+ N +T I+E + L+  +R+C++ LSKYL LD+FD ++ E   +  + +G ++  +  E+      N+ +N+ TNRF+     L S ++   E         LWGSK LN+ +      Y G++G  H   +C+ +GY GI  ++   LK + + L++ +L  +   LM  MP +  L  C  G     ++  +   L  +++ P+  TE+  +   FGNCIIF L IE  L+  E  D+  A  F NIFP+P    N E+ +  + +L  +F+  +I + ++ +GTA+Q  ++++   LT+ERLC   SIF+  LN ++             L+   W       N  I   + S F+ +WS + + +  P    +  I+E+FGEGL WAGC ++ LLGQQR FE  D C  I+R  R   K+  ++  +L  +  RIR    +N++IF  LN+YL   D
Sbjct:   27 PCIEAQPCSIIYKANFDTNFEDRNGFVTGIAKYIEEATTHANLNVLLDEGQKHAVMLYTWRCCSRAIP----QPKSNEQPNRVEIYEKTVEVLAPEVNKLLNFMYFQRKAIEAFSGEVKRLCHAEKRKDFVSEAYLLTLGKFINMFAVLDELKNMKSSVKNDYSTYRRAAQFLKVMSDSHTLQESQNLSMFLATQNKIRDTVKDTLEKIVGYEDLLSDVVNICVHMFETKMYLTPEEKHMLVKVMGFGLFLMD-SDACNINKLDQKKKIRLDRIDRIFKNLEVVPLFGDMQIAPFNYIKRSKHFDSSKWPLSSSNAISPQADLMVHLPQIREDHVKYISELARYTNEVTTTVKENPSDAENRITA-DLALRGLQLLSEWTSVVTELYSWKLLHPTDHHQNKECPVEAEEYERATRYNYTSEEKFALIEVIAMIKGLQVLMARIETVLCEAIRRNIYSELQDFVQLSLREPLRKAVKNKKDLIRSIIMSVRETSADWQKGYEPT----------DDPVSKGKKDPDG-------GFRIHVPRLNVGPSSTQLYMVRTMLESLTADKSGGKRTLRKDIDGNCLMQIETFHNTSFYWSYLLNFSDTLQKCCDLSQLWYREFYLEMTMGRKVNKCMVRHQHNEECKDLITMEKRIQFPIEMSMPWILTDHILQTKEPSMMEFVLYPLDLYNDSAHYALTVFRKQFLYDEVEAEVNLCFDQFVYKLSEQIFAHYKQLAGSIFLDKRFRLECEVLGFNFQSYPRNNRYETLLKQRHVQLLGRSIDLNKLVTQRINANMHKSIELAISRFEANDITGIVELEGLLEANRICHKLLSKYLALDNFDGMVKEANHNVLAPYGRITLHVFVELNYDFLVNYCYNAATNRFIRTKVNLSSTQAIQREKPPQMSHYYLWGSKQLNAAYSTQYGQYTGFVGSPHFHAMCRLLGYQGIAVVMDIILKDIVKPLIQGSLLQFTKTLMIAMPKSCKLPRCEYGSPG--VLSYYQAHLTDIVQYPDTKTELFQSFREFGNCIIFCLLIEQALSQEEVCDLLHAALFQNIFPRPFCKEN-EKPEAKQKRLEAQFANLQIVSNVEKIGTAKQAMIAREGDLLTRERLCCGLSIFEVILNRVKSY-----------LDDPVWCGPP-PANGIIHVDECSEFHRLWSALQFVYCIPVRGTEYTIEELFGEGLNWAGCVMIVLLGQQRRFEALDFCYHILRVQRVDGKDEDVKGIQLKRMVDRIRRFQVLNSQIFSILNKYLKGGD 1252          
BLAST of Cytoplasmic FMR1-interacting protein vs. UniProt/SwissProt
Match: sp|Q5SQX6|CYFP2_MOUSE (Cytoplasmic FMR1-interacting protein 2 OS=Mus musculus OX=10090 GN=Cyfip2 PE=1 SV=2)

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 472/1239 (38.10%), Postives = 728/1239 (58.76%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G D+ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +IK + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLN ++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ L K++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGC+I+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN +F  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHDYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. UniProt/SwissProt
Match: sp|Q6GQD1|CYFP2_XENLA (Cytoplasmic FMR1-interacting protein 2 OS=Xenopus laevis OX=8355 GN=cyfip2 PE=2 SV=1)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 475/1233 (38.52%), Postives = 727/1233 (58.96%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +I+ + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAM+K +Q  + RME  F + I   IY  +Q F   SL E   +  +K  N L  +LQ+I     D +A  E     P+      +K  KG  ++          +  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +EEFHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +LSDQIF +YK  + S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ LSK+L LD FD +  E   + ++ +G  +  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +    + +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCNEVKRLCHTERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIETSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMVKGLQVLMGRMESVFNQAIRNTIYAALQDFAQSSLREPLRQAVRKKKNVLISVLQAIRKTVCDWEAGRE----PPNDPCLRGEKDPKGGFDI---------NVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEEFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLSDQIFAYYKAMSGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLDINRLTHRLLSKHLTLDSFDAMFREANHNVSAPYGRNTLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTVLQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVELHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAVLNKYMKSVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. UniProt/SwissProt
Match: sp|Q5R414|CYFP2_PONAB (Cytoplasmic FMR1-interacting protein 2 OS=Pongo abelii OX=9601 GN=CYFIP2 PE=2 SV=1)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 471/1239 (38.01%), Postives = 728/1239 (58.76%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K+ +VV +FGDM I    +I+ + +Y+   SKW   T + IS Q  I   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFA +EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I      W  G +P          P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLN ++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ L K++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + ESLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGC+I+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN +F  LN+Y+ +V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIETSAHYEENKSKW-TCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREP----------PNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANIQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVESLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYL-------QDPI----W-RGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVE 1229          
BLAST of Cytoplasmic FMR1-interacting protein vs. TrEMBL
Match: A0A4E0RRZ5 (Cytoplasmic FMR1-interacting protein 2 OS=Fasciola hepatica OX=6192 GN=D915_005645 PE=4 SV=1)

HSP 1 Score: 935.25 bits (2416), Expect = 0.000e+0
Identity = 518/1296 (39.97%), Postives = 782/1296 (60.34%), Query Frame = 3
Query:  138 DVPCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG---DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSP-------SPNINR-NRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITN----QLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKT------------------------------RKIPPGSTQLYLIRCIVESLFQNKT--RNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERY-VTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFV-------PMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQ----------PSSTSNSEEMDKLR----NKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEIL----------YQMKILDEDNLEINFWTRKENNTNYA--IFDYDD-SAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYL 3776
            DVP +QAAN ++ ++ N +TN  D   F+   A   ++A+V+ +L+T+LE+G++F IMLYTWRS SRALP   I  N       I +KT+EIL+PY +KLK+F  FQ+ A  +F EE+  L  + ++  F+++A ++ +  MLKMF L+DEMKNMKA MKND++ YKRA Q L+  D     ++ D SM+LA+Q ++R  LK  L  + G+ED  VE+I+    MY  K Y+   EKHT V+V+AFSL+L+D+S          N+N+ +++L + K+D+I+KECEVVN+FGDMS+ PF +++ T ++DSSKWPE  ++++S+QG ++ H+ +FR EYTSLT++LA  +N      +E S + N+  Y+LAL+ LQ LS W+ Q++DTF+WKL H A    N + PK+AE YEKATRYNY+S E+FA+IEVI+MIK++QTQL R+E ++ E I   +Y E+QT +   L     K  KK       +L + +Q+  A  +  +  ++   S      T SK    +   +F+ + +  L T                              R++ P S+QLYL+R ++E +       R+ +R++ D  +L  +E F K SF+W YLLNF++TL   CDLSQLWYREFFLE+TNG  IQFPIE S+P I T+HIL+T+ P +IEY LYPLDLYND+A CAL +F+R+FLY EIEAE N +  QLV +LSDQ+F  YK++ASS+LL+KRF+     + +     PPP RY   L++QRH+QLLGR+ ++ +LIS R+N ++++SLE  I +F+ + LT I+E +++I  +RLC++ LS++L+LD+FD +L E     TS  G ++  +  E+T  +  N+ +N  TNRFV        +LE  R +P     H     LWGS++LN+C+E I +LY G++G  H   IC+ +GY G+Y +++++  + +SLL   L+ Y+  L+  MP +L   +  K +         +L ++ + P+L T V       GN II  LQ+E NL+I +A D++ A PFI   P+          P+    + E  + R     +L KK     + NV+  +GT +Q+ L+K++  LTKERLC+   +F+  LN L++ L          Y +      N  ++   R  +N+  A  I   +  S F+ IWS I   F  P  + +  ++E+FGEGL WAGC I+ LLGQQR FE  D  G ++R  RA  K++  E   L+ ++ R+     +N +IF TLN YL
Sbjct:   29 DVPSIQAANCSLLFQSNMDTNFNDIIAFKSAFARSAEDARVYAQLNTMLEQGQEFAIMLYTWRSISRALPF--IRSNEQPHRMEIYQKTVEILEPYANKLKEFMHFQDAASTRFVEEVKRLAHKDQKNFFVNQAYLITLGKMLKMFALLDEMKNMKASMKNDYSNYKRATQFLQHHDPALMKESQDVSMFLAKQKIIRDTLKERLNAVDGYEDLLVEIIHNSAQMYDNKVYVLPAEKHTHVIVLAFSLYLLDSSRIIDGKQIGVNLNKISKRLNIPKLDRILKECEVVNLFGDMSVEPFSYVRQTASFDSSKWPECMSSRVSSQGALLMHMPRFREEYTSLTSDLAWNTNVTSTRMSERSSKENRELYELALRGLQYLSGWSVQVLDTFTWKLAHCASHETNRDCPKDAESYEKATRYNYNSDERFAMIEVISMIKSVQTQLLRLEAYYSEAIRRSVYRELQTIVVGQLSGPLIKAQKKKDRINLVRLIYAVQATCADQIIEQPDSDTLQSGGGTGGTHSKSWSRSAASRFVHSNQGSLTTGSNSTLAQVAASLGHDYGSVGSGSAFDLNKRRVGPSSSQLYLVRTMLELMVDQTVSGRHVMRKDLDTATLTAIETFLKNSFYWPYLLNFSETLIRCCDLSQLWYREFFLEITNGACIQFPIEMSLPWIFTDHILETEHPGFIEYTLYPLDLYNDAADCALNRFRRRFLYEEIEAEANLVFDQLVYKLSDQVFRHYKRYASSILLDKRFRAEAQRA-QWREAYPPPNRYAAALLRQRHVQLLGRTIDISRLISQRMNAAIFKSLEVAIARFQSSDLTGIMELEAIIDCNRLCHRMLSEHLDLDNFDALLREANNLVTSPLGKITVHVFWELTYDLVKNYCYNDATNRFVRTKFTLTEVLE--REKPPAVEPH----YLWGSRSLNTCYEAIFRLYRGFVGSPHFAAICRLLGYRGLYIVVTEVMKVAQSLLNQTLRDYVRRLVRAMPQSLKIPSAAKGSDATFSALYAQLMQIYQYPDLRTNVCQNFRELGNIIICCLQLEKNLSIEDACDLRHAGPFIGQVPKLYLPPIGLQDPTKAKLAAEWRRERELQIKELQKKQESMTVVNVVAKIGTPDQMSLAKENEILTKERLCSGLVLFEHVLNRLRDFLNEEDSGGSTWYSLPSGSIGN-SVSTAARDSSNSGVANDILSLESCSHFHRIWSAIQLVFCTPFGQNEYTVEEMFGEGLSWAGCTIILLLGQQRRFEILDFGGHLLRLQRADKKDMTPEGVSLERMAARLSRFSVLNRQIFATLNVYL 1314          
BLAST of Cytoplasmic FMR1-interacting protein vs. TrEMBL
Match: A0A4S2M2F5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003197 PE=4 SV=1)

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 515/1289 (39.95%), Postives = 774/1289 (60.05%), Query Frame = 3
Query:  138 DVPCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG---DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSP-------SPNINR-NRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITN----QLPFILQSIWAIGL-DPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKT--------------------------------RKIPPGSTQLYLIRCIVESLFQNKT--RNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERY-VTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQ--LWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQP-------------SSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFW------TRKENN--TNYAIFDYDD-SAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYL 3776
            D P +QAAN ++ ++ N +TN  D   FR   A    +A+++ EL+TLLE+G+++ IMLYTWRS SRALP   I  N       I +KT+EIL+PY  KLK+F  FQN A ++F +E+  L  + ++  F+++A ++ +  MLKMF ++DEMKNMKA MKND++ YKRA Q L+  D     ++ + SM+LA+Q ++R  LK  L  + G+ED  V++I+    MY  K Y+  EEKHT V+V+AF+L+L+D++          N+N+  ++L + K+D I+KECEVVN+FGDMS+ PF +++ T ++D SKWPE    + S+QG ++ H+ +FR EYTSLTA+LA ++N      NE S + N+  Y+LAL+ LQ LS W+ Q++DTF+WKL H A    N   P+EAE YEKAT+YNY S E+FA++EVI+MIK++Q QL R+E ++ E I   +Y ++QT +   L    +K  KK       +L + +Q+  A  + D   S+ L  S     ST SK    +   +F  +  + L +                                R++ P S+QLYL+R ++E +       +N +R++ D  +L  +E F K SF+W YLLNF++TL   CDLSQLWYREFFLEMTNG  IQFPIE S+P I T+H+L T++P +IEY+LYPLDLYND+A CAL +F R+FLY EIEAE + ++ QLV +LSDQ+F  YK++A+S+LL+KRF+     S       PPP+RY   L++QRH+QLLGR+ +L +L++ R+N ++++SLE  I KF+ + LT I+E ++ I   RLC++ LS++LELDDFD +L E     TS FG ++  +  E+T  +  N+ +N  TNRFV    +  S  LE      +D   LWGS++L +CFE I  L+ G++G  H   +C+ +GY G+Y + +++  + +SLL   L+ Y+  L+  MP +L      + +        ++LR+V + P+L T V       GN II  LQ+E  L+I +A D++ A PFI   P+P              +     E D    +L KK     + NV+  +GT +Q+ L+K++  LTKERLC+   +F++ LN ++E       L E++   + W      T++ +N  T+  I   ++ + F+ IWS I   F  P  + +  ++E+FGEGL WAGCAI+ LLGQQR FE  D+ G ++R  RA  KE   E   LD ++ R+     +N +IF TLN YL
Sbjct:   42 DAPSIQAANCSMLFQSNTDTNFNDITAFRSAFARSADDARIYAELNTLLEEGQEYAIMLYTWRSISRALPF--IRSNEQPHRMEIYKKTVEILEPYAIKLKRFMAFQNAATERFAKEVERLAHKDQKNFFVNQAYLVTLGKMLKMFAILDEMKNMKASMKNDYSNYKRATQFLQHHDPKAMEESQNVSMFLAKQKIIRDTLKERLNAVDGYEDLLVDIIHNSAQMYDSKMYVLPEEKHTHVVVLAFALYLLDSTRIVDGKQVGVNLNKLAKRLNIPKLDHILKECEVVNLFGDMSVEPFSYVRQTTSFDPSKWPECQGTRASSQGALLLHMPRFREEYTSLTADLAWHTNITSTRLNERSSKENRELYELALRGLQYLSGWSVQVLDTFTWKLAHCASHETNPHCPREAESYEKATKYNYSSDERFAMVEVISMIKSVQAQLLRLETYYSEAIRRSVYRDLQTIVVGQLSGPLSKAQKKKDRINLVRLIYAIQATCADQIIDQLDSDTLHSS---GGSTHSKSWSKSATSRFTGSNNNSLTSGSNTALSSVAASMTMESSSGTVTSGSVFDLNKRRVGPSSSQLYLVRTMLELMVDQTASGKNTMRKDLDATTLTAIEGFLKNSFYWPYLLNFSETLLKCCDLSQLWYREFFLEMTNGSCIQFPIEMSLPWIFTDHVLQTENPGFIEYMLYPLDLYNDAADCALNRFHRRFLYEEIEAEASLVLDQLVYKLSDQVFKHYKRYAASILLDKRFRAEAQRSGWREA-YPPPKRYAAALLRQRHVQLLGRTVDLNRLVTQRMNTAIHKSLEIAIAKFQGSDLTGIVELEAAIDCTRLCHRMLSEHLELDDFDALLREANNFVTSPFGKIAVHVFWELTYDVVKNYCYNDATNRFVRTKFTL-SEVLEREKPPAVDAQYLWGSQSLTTCFESIFGLFRGFVGAPHFAAVCRLLGYRGLYIVTTEVMKVAQSLLNQTLRSYVRRLIRLMPRSLSLPPSAQGSDAAFSALYDQLRQVYQYPDLRTNVCQNFRELGNIIICCLQLEKQLSIEDACDLRHAGPFIGQMPKPFFPPLQDVANKGKVTAEQRRERDIQLRELQKKQESMNMVNVVAKIGTPDQLTLAKENEILTKERLCSGLVLFEYVLNRIRE------FLSEEDSGGSTWHGFLNLTKEGSNGPTSSDILGLENCTYFHRIWSAIQLVFCTPFGQNEYTVEEMFGEGLNWAGCAIILLLGQQRRFEILDVGGLLLRLQRADKKETTQEGVSLDKMAARLSRFAVLNRQIFATLNIYL 1317          
BLAST of Cytoplasmic FMR1-interacting protein vs. TrEMBL
Match: A0A3R7F6F5 (Cytoplasmic FMR1-interacting protein OS=Clonorchis sinensis OX=79923 GN=Sra-1 PE=3 SV=1)

HSP 1 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 508/1286 (39.50%), Postives = 772/1286 (60.03%), Query Frame = 3
Query:  138 DVPCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG---DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSP-------SPNINR-NRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITN----QLPFILQSI-------------------------WAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKS-----QLKTRKIPPGSTQLYLIRCIVESLFQNKT--RNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERY-VTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQ--LWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQP-------------SSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFW------TRKENN--TNYAIFDYDD-SAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYL 3776
            D P +QAAN ++ ++ N +TN  D   FR   A    +A+++ EL+TLLE+G+++ IMLYTWRS SRALP   I  N       I +KT+EIL+PY  KLK+F  FQN A ++F +E+  L  + ++  F+++A ++ +  MLKMF ++DEMKNMKA MKND++ YKRA Q L+  D     ++ + SM+LA+Q ++R  LK  L  + G+ED  V++I+    MY  K Y+  EEKHT V+V+AF+L+L+D++          N+N+  ++L + K+D I+KECEVVN+FGDMS+ PF +++ T ++D SKWPE    + S+QG ++ H+ +FR EYTSLTA+LA ++N      NE S + N+  Y+LAL+ LQ LS W+ Q++DTF+WKL H A    N   P+EAE YEKAT+YNY S E+FA++EVI+MIK++Q QL R+E ++ E I   +Y ++QT +   L    +K  KK       +L + +Q+                          W+     + +     S+   ++T      A+  ++      +      L  R++ P S+QLYL+R ++E +    +  +N +R++ D  +L  +E F + SF+W YLLNF++TL   CDLSQLWYREFFLEMTNG  IQFPIE S+P I T+H+L T++P +IEY+LYPLDLYND+A CAL +F R+FLY EIEAE + ++ QLV +LSDQ+F  YK++A+S+LL+KRF+     S       PPP+RY   L++QRH+QLLGR+ +L +L++ R+N ++++SLE  I +F+ + LT I+E ++ I   RLC++ LS++LELDDFD +L E     TS FG ++  +  E+T  +  N+ +N  TNRFV    +  S  LE      +D   LWGS++L +CFE I  LY G++G  H   +C+ +GY G+Y + +++  + +SLL   L+ Y+  L+  MP +L      + +        ++LR+V + P+L T V       GN II  LQ+E  L+I +A D++ A PFI   P+P              +     E D    +L KK     + NV+  +GT +Q+ L+K++  LTKERLC+   +F++ LN ++E       L E++   + W      T++ +N  T+  I   ++ + F+ IWS I   F  P  + +  ++E+FGEGL WAGCAI+ LLGQQR FE  D+ G ++R  RA  KE   E   LD ++ R+     +N +IF TLN YL
Sbjct:   29 DAPSIQAANCSMLFQSNTDTNFNDITAFRSAFARSADDARIYAELNTLLEEGQEYAIMLYTWRSISRALPF--IRSNEQPHRMEIYKKTVEILEPYAIKLKRFMAFQNAATERFAKEVERLAHKDQKNFFVNQAYLVTLGKMLKMFAILDEMKNMKASMKNDYSNYKRATQFLQHHDPKAMEESQNVSMFLAKQKIIRDTLKERLNAVDGYEDLLVDIIHNSAQMYDSKMYVLPEEKHTHVVVLAFALYLLDSTRIVDGKQVGVNLNKLAKRLNIPKLDHILKECEVVNLFGDMSVEPFSYVRQTTSFDPSKWPECQGARASSQGALLLHMPRFREEYTSLTADLAWHTNITSTRLNERSSKENRELYELALRGLQYLSGWSVQVLDTFTWKLAHCASHETNPHCPREAESYEKATKYNYSSDERFAMVEVISMIKSVQAQLLRLETYYSEAIRRSVYRDLQTIVVGQLSGPLSKAQKKKDRINLVRLIYAIQATCADQIIDQLDSDTLHSGGGSTHSKSWSKSATSRFTGSNNNSLTSGSNTALSSVAASMTMESSSGTVTSGSVYDLNKRRVGPSSSQLYLVRTMLELMVDQTSSGKNTMRKDLDATTLTAIEGFLRNSFYWPYLLNFSETLLKCCDLSQLWYREFFLEMTNGSCIQFPIEMSLPWIFTDHVLQTENPGFIEYMLYPLDLYNDAADCALNRFHRRFLYEEIEAEASLVLDQLVYKLSDQVFKHYKRYAASILLDKRFRAEAQRSGWREA-YPPPKRYAAALLRQRHVQLLGRTVDLNRLVTQRMNTAIHKSLEIAIARFQGSDLTGIVELEAAIDCTRLCHRMLSEHLELDDFDALLREANNFVTSPFGKIAVHVFWELTYDVVKNYCYNDATNRFVRTKFTL-SEVLEREKPPAVDAQYLWGSQSLTTCFESIFGLYRGFVGAPHFAAVCRLLGYRGLYIVTTEVMKVAQSLLNQTLRSYVRRLIRLMPRSLSLPPSAQGSDAAFSALYDQLRQVYQYPDLRTNVCQNFRELGNIIICCLQLEKQLSIEDACDLRHAGPFIGQMPKPFFPPLQDVANKGKVTAEQRRERDIQLRELQKKQESMNMVNVVAKIGTPDQLSLAKENEILTKERLCSGLVLFEYVLNRIRE------FLSEEDSGGSTWHGFLNPTKESSNGPTSSDILGLENCTYFHRIWSAIQLVFCTPFGQNEYTVEEMFGEGLNWAGCAIIVLLGQQRRFEILDVGGLLLRLQRADKKETTQEGVSLDKMAARLSRFAVLNRQIFATLNIYL 1304          
BLAST of Cytoplasmic FMR1-interacting protein vs. TrEMBL
Match: A0A0B6ZWY0 (Cytoplasmic FMR1-interacting protein OS=Arion vulgaris OX=1028688 GN=ORF85248 PE=3 SV=1)

HSP 1 Score: 921.768 bits (2381), Expect = 0.000e+0
Identity = 494/1244 (39.71%), Postives = 749/1244 (60.21%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNI---NRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSN--ANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPM-----LESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQP-----SSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDD-SAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++A +L+V Y  NF+TN ED N F    A YK++A V  +L+ LLEKG+ + +MLYTWR CSRA+P   +  N  E    I +KT+E+L+P+++KL +F  FQ +A+  FCEE+  LC + KR++F+SEA ++ +  ++ MF  +DE+KNMKA ++ND++ Y+RAAQ LK++       D+ + SM LA Q+ +R  LKS L +I G+++   +++N+CV+MY +  YL   EKH LV V+AF LF+MD    PNI   N  +++ L+KID+I K+ ++V ++GDM I P+ +IK +PN+D SKWP   ++++S Q  ++  + Q R  +    ++LA+++N     + +   S   NK   DLAL+ L L+SKWT Q+++ +SWKL +  D H N + P   E YEKATRYNY   EKFALIEVIAMIK +Q  ++RME  FM+ I  +IY E+Q F+  SL E   + +KK +  +  I+ S+      W  G +P           D  + L KK          E    ++  R + P STQLY++R ++ESL   ++  K  +R+E D+Q + ++EEFH+KSFFW+YLLNF  +L   CDLSQLW+REFFLE+T GKRIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL +FK+QFLY+E+EAEVN    Q V +LSDQIF +YK  A S++L+KRF+    +S +  I+ P   RY TL+KQRH+QLLGRS +L +LIS  +N +L +SL+  I +F+   +T I+E + LI ++RL ++ + +YL L+DFD +L E   + ++ +G ++  +  E+   + PN+ +N+ TNRFV        E+ R +P   +VH     +WG+K LN  F  I  LY+G++G  H   IC+ +GY GI  ++ +L    E+ L      Y++ LM+ MP           +  ++  +  +L  +I+ P+L TEV  +    GN ++F L +E  L   E  D+K A PF NI P+P            E   +  +L KK++  K+ +V++ +G   Q  ++     LT+ERLC   SIF+  L  ++  L               W    +  +  + + D  + F+ +WS I + +  P  + +  I+E+FGEGL WAGC ++ LLGQQR FE  D C  + + NR   K+  I+  +L  +  RIR    +NN+IF  LN+YL T D
Sbjct:   28 PCIEALSLSVHYRANFDTNFEDKNAFVTSVAKYKEQATVQADLNLLLEKGETYAVMLYTWRCCSRAIP--QVKSNEQENRTEIYQKTVEVLEPHVNKLMQFMFFQKKAIDLFCEEVKRLCHKEKRQDFVSEAYLVTLGKLINMFAELDELKNMKASVRNDYSAYRRAAQFLKVMADQQAMQDSQNLSMNLATQNKIRDTLKSRLGEIQGYDELLADVVNICVMMYEKDMYLEPSEKHMLVKVMAFGLFMMDVEKGPNIYRMNDKKRINLAKIDKIFKQLQMVPLYGDMIIAPYNYIKNSPNFDPSKWPACESSQLSPQSNLLGSLEQIRDRHMQYISQLARHNNEATTTMRETPRSDLENKELTDLALRGLMLVSKWTQQVMELYSWKLMNPTDHHANKDCPDTDEAYEKATRYNYSRDEKFALIEVIAMIKGLQLLMARMETVFMDAIRRHIYAELQEFVQHSLREPLRRATKKKSEIIRVIIMSVRDTCVDWLRGTEPT----------DDPALLGKKDPT-------EGFHIRVPRRNVGPSSTQLYMVRTMLESLVDERSGGKKSMRKEMDEQHVTVIEEFHRKSFFWNYLLNFNASLFNCCDLSQLWFREFFLELTMGKRIQFPIEMSMPWILTDHILETKEPSLMEYILYPLDLYNDSAQYALMRFKKQFLYDEVEAEVNLCFDQFVYKLSDQIFAYYKHLAGSIMLDKRFRAECMSSGEK-ISYPVANRYQTLLKQRHVQLLGRSIDLNRLISQLVNAALQKSLDVAISRFEGGDITGIIELEGLIEVNRLAHKLMGEYLLLNDFDAMLKEANHNVSAPYGRITLHVFWELNIDLLPNYCYNAATNRFVKTKLPFDKETKREKPPNPSVH----YVWGTKRLNHSFSTIYSLYSGFIGAPHFRAICRLLGYQGIAVVIEELLKTVENFLTGTTAEYVATLMKVMPEQCKLLRFDYGSPGVMGYYQAQLVDLIQYPDLRTEVFQSFREIGNAVLFCLLVEQALTQEEVYDLKHAAPFQNIIPKPYIPPKEGKDREAEAKAVMKQLEKKYAALKVVHVIEKLGNKYQAVIANDGDLLTRERLCCGLSIFEIVLKRIESFLTN-----------PLW--HGDPPSNGVMNVDKCNEFHRLWSAIQFVYCVPIGENEFTIEELFGEGLNWAGCVLITLLGQQRRFEVLDFCYHLHKVNRVDMKDENIKGIQLKKMVDRIRKFQILNNQIFSVLNKYLRTND 1234          
BLAST of Cytoplasmic FMR1-interacting protein vs. TrEMBL
Match: A0A4Z2D8G2 (Cytoplasmic FMR1-interacting protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_003486 PE=4 SV=1)

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 522/1305 (40.00%), Postives = 786/1305 (60.23%), Query Frame = 3
Query:  138 DVPCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPN-------INR-NRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKK----ITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKG-----------------------------AAELLQFIENMKSQLKT--------RKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERY-VTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVP---MLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQ---PSSTSNSE--------EMDKLR----NKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKEN----------NTNYAIFDY----DDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEI-KIESELDLISKRIRCLLQINNRIFDTLNRYLFTVDDYY 3797
            DVP +Q AN  + ++ N +TN  D   F+   A   ++A+V+  L++LLE+G+++ IMLYTWRS SRALP    S     +   I EKT EIL+P+  KLK F  FQ+ A+++F EE+  L  + ++  F+++A ++ +  M++MF L+DEMKNMKA MKND++ YKRAAQ L+I D  DA D S++LA+Q V+R  LK  LI + G+ED  VE+I+    MY  K Y+  EEKHT V+VIAFSL+L+D++   +       +N+  ++L +SK+D+I+KECEVVN+FGDMS+ PF ++  T ++D SKWPE  + K+S+QG I+ H+ +F+ EYTSLT++LA ++N   I  NE S + N+  YDLAL+ LQ LS W+ Q++DTF+WKL H A S  N E PK+AE+YEKATRYNY+S+E+FA+IE+I+MIK++QTQL R+E  + E I   +Y E+Q  +   L    +K  KK    +  +L   +Q+  A  L      ++  +     +T SK  G                             AA L    ++    + T        R++ P S+QLYL+R ++E + +  T +K  +++E D  +L  ++   K SF+W YLL+F++TL   CDLSQLWYREFFLEMTNG  +QFPIE S+P I T+HIL+++ P YIEYLLY LDLYND+A CAL +F+R+FLY EIEAE N +  QLV +LSD++F  YK++ASS+LL+KRF+     +       PPP RY   L++Q+++QLLGRS +L +LI  R+N ++Y+S+E  I +F  + +T I+E ++ I  +RLC++ LS++LELDDF+ +L E     TS  G ++  +  E+T  +  N+ +N  TNRFVP    L     R    TV  +   +WGS++LN+C+E I KLY G++G  H   IC+ +GY G+Y +++++  + +SLL   L+ Y+  L+  MP +L   ++   +  +      +L ++ +  +L T V      FGN +I  LQ+E NL+I ++ D+  A PFI   P+   P   ++ E        E+ + R     +L KK     I  V+  +GT +Q+ L+K++  LTKERLC+  ++F+F LN ++  L+      E++ + N W R  N           T+Y   D      ++ F+ +WSVI   F  P  + +  I+E+FGEGL WAGCAI+ LLGQQR FE  D    I+R  R   K++  +   L+ ++ R+     +N +IF TLN YL  VD  Y
Sbjct:   29 DVPSIQGANFPILFQSNTDTNFSDITAFKSAFARSAEDARVYSHLNSLLEQGQEYAIMLYTWRSISRALPFIRSSDQPNRI--KIYEKTKEILEPHCLKLKHFMFFQDAAIRRFVEEVKRLAHKDQKNFFVNQAYLVTLGKMIRMFALLDEMKNMKASMKNDYSNYKRAAQFLQIHDP-DAQDVSLFLAKQKVIRDTLKESLIAVDGYEDLLVEIIHNSAKMYENKVYVLPEEKHTHVIVIAFSLYLLDSARIVDGKQVGVCLNKIAKRLNISKLDRILKECEVVNLFGDMSVEPFSYVCQTASFDPSKWPECHSTKVSSQGAILMHMARFQEEYTSLTSDLAWHTNITSIRLNERSAKENQELYDLALRGLQYLSGWSVQVLDTFTWKLVHCASSFTNHECPKDAENYEKATRYNYNSEERFAMIEIISMIKSVQTQLLRLEACYSEAIGRSVYRELQAVVVGQLSSPLHKAQKKKERIMLARLIHAIQATCADQLSDTTDLDMMHTSSGGNTTGSKSWGKATSSKLSNSNNSNNNSMTTGSNSTMAAVAASLANNNDSPTGSISTSSIFDSNKRRVGPSSSQLYLVRTMLELMVEQVTSSKQMMKKELDAATLASIDTLLKHSFYWPYLLDFSETLIKCCDLSQLWYREFFLEMTNGACLQFPIEMSLPWIFTDHILESEHPGYIEYLLYMLDLYNDAADCALNRFRRRFLYEEIEAEANLVFDQLVYKLSDKVFRHYKRYASSILLDKRFRAEAQRNASWREPYPPPNRYTAALLRQKNVQLLGRSIDLNRLICQRMNSAIYKSIEVAISRFHSSDITGIIELEAAIECNRLCHRMLSEHLELDDFNALLHEADNLVTSRLGKITVHVFWELTYDLVKNYCYNDATNRFVPTNFTLTEVLEREKPPTVEAQY--VWGSRSLNTCYETIFKLYRGFVGAPHFSAICRLLGYRGLYVVIAEVLKVAQSLLNQTLRDYVCRLVRLMPQSLTLPSEKAESDAVFSALYTQLHQIYKYTDLRTNVFQNFREFGNILICCLQLEKNLSIEDSCDLHHAGPFIGQMPRQFFPPLPTHEEGLKGKSINEVRREREIQYKELQKKQESMNIVLVVSRIGTEDQLSLAKENEILTKERLCSGLTLFEFVLNKIKTFLH------EEDTDGNTWHRLANIKRSSICNGGTTHYNSSDILGLESNAHFHRLWSVIQLVFCTPFGQNEYTIEEMFGEGLNWAGCAIILLLGQQRRFEALDFGSLILRLQRIDKKDVTPMGVSLERMAARLSRFSVLNRQIFSTLNIYLHPVDRNY 1322          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Cavefish
Match: cyfip1 (cytoplasmic FMR1 interacting protein 1 [Source:NCBI gene;Acc:336613])

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 456/1245 (36.63%), Postives = 725/1245 (58.23%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXA-----YDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFV----PMLESY-RSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSST---SNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NFNTN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL  F  FQ  A+ +FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L+ +L  I+G+++   +++NLCV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ L+KID+  K+ +VV +FGDM I    +IK + +++   S+W   T+   S Q  I   ++Q R ++    +ELA+YSN+ V+  +         +      +LAL+ LQLLS+W+ Q+++ +SWKL H  D + N E P  AE+YE+ATRYNY S+EKFAL+EV+AMIK +Q  + RME  F   I   IY  +Q F  ++L +   +  KK  N +  +LQ+I      W  G +P     L              KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   +  ++  +E+FH++SFF+++LLNF++TL   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++ + +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KR +    N   +NI+ PP  RY TL+KQRH+QLLGRS +L +LI+ R++ +LY+SLE  I +F+   LTSI+E + L+ I+R+ ++ LSK+L LD  D +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV    P  + + R +P  +    +   L+GSK LN  +  I   Y  ++G  H+  +C+ +GY GI  ++ +L  + +SLL+  +  Y+  LME MP           +  +++ F+ +L+ ++E   L T     L   GN ++F L  E +L           Y  +++  Q SS+   +  E +D    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    +N  +   +   F+ +WS + + +  P    +  +++ FG+GL WAGC I+ LLGQQR F+  D    +++  +   K+  I+S  L  +  RIR    +N+ IF  LN+YL + D
Sbjct:   27 PCIEPLPSSIIYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNVMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRTAIDRFCGEVRRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMSEPSSIQESQNLSMFLANHNKITQSLQQQLEVINGYDELLADIVNLCVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGTNSNIYKLDAKKRINLTKIDKFFKQLQVVPLFGDMQIELSRYIKTSAHFEENKSRW-SCTSAGSSPQYNICEQMIQIRDDHMRFISELARYSNSEVVTGSGRQDAQKTDSEYRKLSELALQGLQLLSQWSAQVMEVYSWKLVHPTDKYSNKECPDNAEEYERATRYNYTSEEKFALVEVMAMIKGLQVLMGRMESVFNHAIRHTIYSALQDFAQLTLRDPLRQAIKKKKNVVQSVLQAIRKTICDWETGREPHNDPALRGE--------KDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLVADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLLNFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYPLDLYNDSAHYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVLAGSLLLDKRLRAECKNQ-GANISWPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAALYKSLELAINRFESEDLTSIVELEGLLDINRMTHKLLSKFLTLDSMDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKPPNA----QPQYLYGSKALNLAYSSIYGFYRNFVGPPHIKAMCRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAVLFCLLSEQSLVF---------YCEMSVLKQSSSSCLHAEGERLDAKMKRLEAKYTALHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRGFL-------DDPI----W-RGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGAHEFTVEQCFGDGLNWAGCMIITLLGQQRRFDIMDFSYHLLKVQKHDGKDEIIKSVPLKKMVDRIRKYQVLNDEIFAILNKYLKSGD 1225          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Cavefish
Match: cyfip2 (cytoplasmic FMR1 interacting protein 2 [Source:ZFIN;Acc:ZDB-GENE-080724-2])

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 375/1004 (37.35%), Postives = 577/1004 (57.47%), Query Frame = 3
Query:  819 YLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            Y+ Q   H+  +V+ F L+LMD + S    ++  +++ L KID+  K  +VV +FGDM I    +I+ + +Y+   SKW   T + IS Q  +   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+T +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFAL+EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I     D + S E     P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDS   AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++ +             LTSI+E + L+ I+RL ++ LSK++ LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D++    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+  V+
Sbjct:   59 YIEQATVHS-SMVMGFGLYLMDGNVSNIYKLDAKKRINLGKIDKFFK-LQVVPLFGDMQIELSRYIETSAHYEENKSKW-TCTQSSISPQYNLCEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYKELFDLALRGLQLLSKWSTHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGSRE----PPNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEDFHKQSFFYTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSGYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAIED-------------LTSIVELEWLLEINRLTHRLLSKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFL-------QDSV----W-RGPPPTNGVMHVDECMEFHRLWSAMQFVYCIPVGTHEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAILNKYMKAVE 1019          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006845.1 (pep scaffold:Pmarinus_7.0:GL477909:4128:49849:1 gene:ENSPMAG00000006136.1 transcript:ENSPMAT00000006845.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 468/1235 (37.89%), Postives = 725/1235 (58.70%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDA----TDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESY-----RSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWR  SRA+P   +  N       I EKT+E+L+P + KL  F  FQ +A++KFCEE+  LC   +R++F+SEA +L +   + MF ++DE+KNMK+ +KND++ YKRAAQ L+ +    A     + SM+LA  + +   L+  L  I G+E+   +++NLCV  Y +K YL   EKH L+ V+ F LFLMD   S    ++  R++ L+KID+  K+ +VV +FGDM I    +I+ + +Y+   SKW   T+   S Q  I   + Q R ++   T+ELA++SN+ V+  + +        +    DLAL+ LQLLSKW+  +++ +SWKL H  D   N E P  AE+YE+ATRYNY+S+EKFAL+EVIAM+K +Q  + RME  F + I   +Y ++Q F  ++L E   +  KK  N +  +LQ+I     D +A        P     L  +K      +       ++  R + P STQLY++R ++ESL  +K+  K  LR   +   +  +EEFH+ SFF+ +LLNF + L   CDLSQLW+REFFLE+T GKRIQFPIE S+P ILT+HIL+T++ + +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +LSDQIF +YK  A S+LL+KR +  + N   S I +PP  RY TL+KQRH+QLLGRS +L +LI+ RI+  +Y SLE  I +F    LTS++E + L+ +++L ++ LSK+L LD FD +L E   + ++ +G ++  +  E+     PN+ +N  T+RFV    ++     R +P  +    +   L+G+K LN+ +  +   Y  +LG  H+ +IC+ +GY GI  ++ +L  + +SLL+  +  Y+  LME MP           +  +++ F+ +L+ ++E   L T+V  +L   GN I+F L IE +L+  E  D+  A PF NI P+       E+++    +L  K+    +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L+ ++  L       +D +    W R    TN  +   D    + +WS + + +  P    +   ++ FG+GL WAGC+I+ LLGQQR F+  D C  +++  R   K+  I++  L  + +RIR    +NN IF TL +YL   D
Sbjct:   27 PCIEPPPSSILYQANFDTNFEDRNAFVTGIARYIEQATVHSGMNEMLEEGHEYAVMLYTWRCISRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMHFQRKAIEKFCEEMKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKSSVKNDYSAYKRAAQFLRKMADPQAIQESQNLSMFLASHNKITQTLQQHLEVIPGYEELLADIVNLCVEFYDDKLYLTPSEKHMLLKVMGFGLFLMDGEKSNIYKLDAKRRISLNKIDKFFKQLQVVPLFGDMQIELARYIQTSAHYEENKSKW-TCTSQSSSPQYNICEQMGQIRDDHIRFTSELARHSNSEVVKASGQDSHKTDEQHRELCDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFSNKECPDNAEEYERATRYNYNSEEKFALVEVIAMVKGLQDLMGRMESVFNQAIRHTVYAKIQNFAKLTLREPLRQAIKKKKNVVISVLQAIRKTCCDWEAE-------PANDPCLKGEKDPKSGFEI------KVAHRAVGPSSTQLYMVRTMLESLVADKSGAKKTLRSTLEGPFILAIEEFHRSSFFYPHLLNFGEALQQCCDLSQLWFREFFLELTMGKRIQFPIEMSMPWILTDHILETKEQSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLSDQIFTYYKAQAGSLLLDKRLQTELKNLGVS-IPHPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAGVYRSLELAINRFDSEDLTSVVELEGLLDVNQLTHKLLSKHLTLDGFDAMLREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTHRFVRTQYTFAQKLERDKPPNA----QPQYLFGTKALNTAYTSLYGSYRYFLGTPHLRSICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRYEYGSPGILEFFHHQLKDIVEYAELKTDVFQSLREVGNAILFCLLIEQSLSQEEVCDLLHAAPFQNILPR-VHVKEGEKLEAKMKRLESKYQPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILSRVRAYL-------DDPV----W-RGPPPTNGVMHVDDCCQLHRLWSAMQFVYCIPVGTNEFTTEQCFGDGLHWAGCSIIMLLGQQRQFDMLDFCYHLLKVQRHDGKDDVIKNVPLKRMVERIRKYQSLNNEIFATLGKYLKAAD 1227          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006842.1 (pep scaffold:Pmarinus_7.0:GL477909:4128:49849:1 gene:ENSPMAG00000006136.1 transcript:ENSPMAT00000006842.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 470/1251 (37.57%), Postives = 729/1251 (58.27%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDA----TDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGL----------DPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESY-----RSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWR  SRA+P   +  N       I EKT+E+L+P + KL  F  FQ +A++KFCEE+  LC   +R++F+SEA +L +   + MF ++DE+KNMK+ +KND++ YKRAAQ L+ +    A     + SM+LA  + +   L+  L  I G+E+   +++NLCV  Y +K YL   EKH L+ V+ F LFLMD   S    ++  R++ L+KID+  K+ +VV +FGDM I    +I+ + +Y+   SKW   T+   S Q  I   + Q R ++   T+ELA++SN+ V+  + +        +    DLAL+ LQLLSKW+  +++ +SWKL H  D   N E P  AE+YE+ATRYNY+S+EKFAL+EVIAM+K +Q  + RME  F + I   +Y ++Q F  ++L E   +  KK  N +  +LQ+I      W              DPK+    EI +  +A   S  +  AE +Q+    +   + R        LY++R ++ESL  +K+  K  LR   +   +  +EEFH+ SFF+ +LLNF + L   CDLSQLW+REFFLE+T GKRIQFPIE S+P ILT+HIL+T++ + +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +LSDQIF +YK  A S+LL+KR +  + N   S I +PP  RY TL+KQRH+QLLGRS +L +LI+ RI+  +Y SLE  I +F    LTS++E + L+ +++L ++ LSK+L LD FD +L E   + ++ +G ++  +  E+     PN+ +N  T+RFV    ++     R +P  +    +   L+G+K LN+ +  +   Y  +LG  H+ +IC+ +GY GI  ++ +L  + +SLL+  +  Y+  LME MP           +  +++ F+ +L+ ++E   L T+V  +L   GN I+F L IE +L+  E  D+  A PF NI P+       E+++    +L  K+    +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L+ ++  L       +D +    W R    TN  +   D    + +WS + + +  P    +   ++ FG+GL WAGC+I+ LLGQQR F+  D C  +++  R   K+  I++  L  + +RIR    +NN IF TL +YL   D
Sbjct:   27 PCIEPPPSSILYQANFDTNFEDRNAFVTGIARYIEQATVHSGMNEMLEEGHEYAVMLYTWRCISRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMHFQRKAIEKFCEEMKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKSSVKNDYSAYKRAAQFLRKMADPQAIQESQNLSMFLASHNKITQTLQQHLEVIPGYEELLADIVNLCVEFYDDKLYLTPSEKHMLLKVMGFGLFLMDGEKSNIYKLDAKRRISLNKIDKFFKQLQVVPLFGDMQIELARYIQTSAHYEENKSKW-TCTSQSSSPQYNICEQMGQIRDDHIRFTSELARHSNSEVVKASGQDSHKTDEQHRELCDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFSNKECPDNAEEYERATRYNYNSEEKFALVEVIAMVKGLQDLMGRMESVFNQAIRHTVYAKIQNFAKLTLREPLRQAIKKKKNVVISVLQAIRKTCCDWEAEPANDPCLKGEKDPKSG--FEIKVAHRAVGPSSTQSWAEGVQWWGTGRRWGRRRI----GVMLYMVRTMLESLVADKSGAKKTLRSTLEGPFILAIEEFHRSSFFYPHLLNFGEALQQCCDLSQLWFREFFLELTMGKRIQFPIEMSMPWILTDHILETKEQSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLSDQIFTYYKAQAGSLLLDKRLQTELKNLGVS-IPHPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAGVYRSLELAINRFDSEDLTSVVELEGLLDVNQLTHKLLSKHLTLDGFDAMLREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTHRFVRTQYTFAQKLERDKPPNA----QPQYLFGTKALNTAYTSLYGSYRYFLGTPHLRSICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRYEYGSPGILEFFHHQLKDIVEYAELKTDVFQSLREVGNAILFCLLIEQSLSQEEVCDLLHAAPFQNILPR-VHVKEGEKLEAKMKRLESKYQPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILSRVRAYL-------DDPV----W-RGPPPTNGVMHVDDCCQLHRLWSAMQFVYCIPVGTNEFTTEQCFGDGLHWAGCSIIMLLGQQRQFDMLDFCYHLLKVQRHDGKDDVIKNVPLKRMVERIRKYQSLNNEIFATLGKYLKAAD 1250          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009553.1 (pep scaffold:Pmarinus_7.0:GL480583:10952:25466:1 gene:ENSPMAG00000008623.1 transcript:ENSPMAT00000009553.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 297/713 (41.65%), Postives = 444/713 (62.27%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNINR---NRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKT--RNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFAS 2219
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL +F  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KND++ YKRAAQ L+ +       ++ + SM+LA  + +   L+ +L  I G+E+   +++NLC+  Y  + YL   EKHTL+ V+ F LFLMD S S NI R    +++ L +ID+  ++ +VV +FGDM I    +I+ + +Y+   SKW   T + +S Q  I   ++Q R ++   T+EL+++SN+ V+  + +    +   +    DLAL+ LQLLS+W+  +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EK AL+EVIAMIK +Q  + RME  F + I   +Y  +Q F  I+L E   +  K+  N +  ILQ+I      W  G +P +   L              KG  EL          +  R + P STQLY++R ++ESL  +K+  R  LR   +  ++  +EE H+ SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +LSDQIF +YK  A 
Sbjct:   28 PCIEPPPSSILYQANFDTNFEDRNAFVTGIARYIEQATVHSGMNEMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMRFMYFQRKAIERFCGEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDYSAYKRAAQFLRKMSDPQSIQESQNLSMFLANHNRITQSLQQQLEVIPGYEELLADIVNLCMDYYEGRMYLTPGEKHTLLKVMGFGLFLMDGSVS-NIYRLDAKKRINLGRIDRYFRQLQVVPLFGDMQIELARYIETSAHYEDNRSKWT-CTCSTLSPQ-YICEQMVQIRDDHIRFTSELSRHSNSEVVTGSGQDGHKSDEQHKELCDLALRGLQLLSRWSAHVMEVYSWKLVHPTDKFSNKDCPDNAEEYERATRYNYSSEEKCALVEVIAMIKGLQVLMGRMESVFNQAIRHTVYAALQDFAQITLREPLRQAVKRKKNLIISILQAIRKTCGDWEGGAEPASDPCLRGE--------KDPKGGFEL---------HVPRRTVGPSSTQLYMVRTMLESLIADKSGSRKTLRSCLEGPTITAIEEIHRSSFFYTHLLNFSEALQACCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAHYALTKFKKQFLYDEIEAEVNLCFDQFVYKLSDQIFAYYKALAG 718          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Nematostella
Match: EDO41734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3J0])

HSP 1 Score: 446.817 bits (1148), Expect = 9.415e-135
Identity = 275/831 (33.09%), Postives = 433/831 (52.11%), Query Frame = 3
Query: 1269 FSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRF-----KNHINNSCKSNINNPPPERYVTLMKQRHLQ------------------------------LLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSR-PLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDD-SAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKI 3650
            +SWKL H  D + N + P +AE+YE+ATRYNY S+EKF L+EVIAMIK +   +SR+E  F E I   ++ ++Q F+ ++L E   +  KK       +L+SI   G D  A +    + P        K G          ++ ++  R + P STQLY++R ++ES+   K   K+R++ D++ +  +E F K SFF+S LL F + L   CDLSQLW+REF+LE+              P +L              Y+LYPLDLYNDSA  AL +FK+QFLY+E+EAEVN    Q V +LSDQ+F +YK  A +M LNKRF     KN IN +    +      RY +L++QRH+Q                              LLGRS +L KL++ R+N  +  SL+  I +F+   L  I++ ++L+++++L +Q LSK+L L  ++ ++ E   S ++ +G ++  +  E+     PN+ +NS TNRFVP   SY  + P E+         +G+KT NS F  I  LY+ + G  H   + + +GY GI  ++ +L  + +SL +  ++ Y++ L+E MP           +  +++ ++  L  +++ P L   V       GN ++F L +E  L+  E +D+  A PF  I P+P              K+  +++  ++ ++++ +GT EQV  +K+   LTKERLC   SIF+  L  ++  L             + W  KE      +   D+   F+ +WS I ++  +P    +  ++E FGEGL WAGC ++ALL QQR FE  D C  I
Sbjct:  566 YSWKLLHPVDKYANPQCPDDAEEYERATRYNYSSEEKFNLVEVIAMIKGLYGLMSRLEPVFAEAIRHSVHTDLQNFIQVTLREPMRRAVKKKATVTKTVLKSIRETGGD-WADSFFGNNDPALKGDKDPKNG----------IQIKIPERDVGPSSTQLYMVRTMLESIVSEKGAKKMRKDLDKEHIDAIETFLKNSFFFSDLLRFGEVLRECCDLSQLWFREFYLEL--------------PWVLE-----------YRYVLYPLDLYNDSAHYALTEFKKQFLYDEVEAEVNLCFDQFVYKLSDQVFSYYKYQACNMFLNKRFKAECAKNGINLTTGREMR---ANRYESLLQQRHVQLLGRSIGLNKLVTQRLNGFNSLSYTFFGLKLLGRSIDLNKLVTQRLNGFMTRSLDYAISRFESGDLCGIVDLENLLAVNKLTHQLLSKHLALVPYETMVREANHSVSAPYGRITLHVFWELNFDFLPNYCYNSSTNRFVPTTLSYVDKVPREAAPKGAHHFFYGTKTQNSVFNSINSLYSNFFGDIHFGCLARLLGYQGIAVVIEELLKIVKSLFQGQIQQYVAQLIEGMPKKCGLPRYEYGSTGVLEYYHANLEPIMQYPELRVNVYQGFREIGNAVLFALLVEMQLSQEEVIDLLHAAPFQGIIPRPYL------------KVETQYNSLQVVSIVNRLGTKEQVMNAKEGDLLTKERLCCGLSIFEVVLRRIKSFLTS-----------DLW--KEPVPVNGVMSIDECREFHRLWSAIQFNVCQPLRPGELTVEECFGEGLNWAGCVVIALLNQQRRFEALDFCYHI 1332          

HSP 2 Score: 197.978 bits (502), Expect = 3.197e-51
Identity = 110/315 (34.92%), Postives = 184/315 (58.41%), Query Frame = 3
Query:  453 FQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDAT------DFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNI---NRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYD--SSKW---PENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY-DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKAT 1352
            F    V +FC+E+  L    +R++F+SE  +L +   + MFV++D +KNMKA + ND+  +KRA   L+   +GD +      + S++LA Q+ +   LK  L KI G+ED   +++NLC  +Y    Y+   EKH L+ V+ F++FLMD+    NI   ++ +++ +SKID++ K+  VV +FGDM I    ++K  P++D    KW    +N + KI+ Q  +   +   R E+   T+ELA+Y+N  + + +    +N      +LAL+ LQLLS WT Q+++ +SWKL H  D + N + P +AE+YE+ +
Sbjct:    3 FAMTVVTRFCQEVKTLSHPERRKDFISERYLLTLGKFINMFVVLDALKNMKACLNNDYAFFKRADTFLR-RGTGDVSMIQESQNLSLFLANQNKITYLLKEGLEKIPGYEDVLADIVNLCCKLYETNTYIVPSEKHLLLKVMGFTIFLMDSKEQGNILKMDQKKRISISKIDKMFKQLPVVPLFGDMQIALASYLKMCPHFDVMRDKWTCTADNADEKITPQYNLTTKMDTIRDEHVRFTSELARYNNEMITSSSNPRDDNQYKELTNLALRGLQLLSNWTAQVMELYSWKLLHPVDKYANPQCPDDAEEYERVS 316          

HSP 3 Score: 159.844 bits (403), Expect = 2.015e-39
Identity = 92/247 (37.25%), Postives = 142/247 (57.49%), Query Frame = 3
Query:  144 PCMQAANLAVKYE-----VNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDAT------DFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLV 851
            P    +N A +YE     V   +N  +S  F    + Y +EA VH  L  LLE+G+ + ++LYTWRSCSRA+P  S+  ++      I EKT+E+L+P I+KLK F  F    V +FC+E+  L    +R++F+SE  +L +   + MFV++D +KNMKA + ND+  +KRA   L+   +GD +      + S++LA Q+ +   LK  L KI G+ED   +++NLC  +Y    Y+   EKH L+
Sbjct:  321 PISNVSNDAEEYERVSITVRPISNVSNSKAFITCVSKYLEEADVHKGLIELLEEGEKYAVVLYTWRSCSRAVP--SVKSDDQPNRVEIYEKTVEVLEPEINKLKGFMHFAMTVVTRFCQEVKTLSHPERRKDFISERYLLTLGKFINMFVVLDALKNMKACLNNDYAFFKRADTFLR-RGTGDVSMIQESQNLSLFLANQNKITYLLKEGLEKIPGYEDVLADIVNLCCKLYETNTYIVPSEKHLLL 564          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Medaka
Match: cyfip2 (cytoplasmic FMR1-interacting protein 2 [Source:NCBI gene;Acc:101164818])

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 474/1233 (38.44%), Postives = 729/1233 (59.12%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAY----DLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKK--KGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRP-LESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINK-EIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    ++ Y+ NF+TN ED N F    A Y ++A VH  ++ +LE+G ++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL KF  FQ +A+++FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L  +L  I G+E+   +++N+CV  Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ LSKID+  K  +VV +FGDM I    +I+ + +Y+   SKW   T + IS Q  +   ++Q R ++    +ELA+YSN+ V+  +    + +   Y    DLAL+ LQLLSKW+T +++ +SWKL H  D   N + P  AE+YE+ATRYNY S+EKFAL+EVIAMIK +Q  + RME  F + I   IY  +Q F  ++L E   +  +K  N L  +LQ+I     D + + E     P+      +K  KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  LR   D   +  +E+FHK+SFF+++LLNF++ L   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HIL+T++P+ +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KRF+    N     I  PP  RY TL+KQRH+QLLGRS +L +LI+ RI+ ++Y+SL+  I +F+   LTSI+E + L+ I+RL ++ L K+L LD FD +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV     +   P  +   + +   L+GSK LN  +  I   Y  ++G  H  TIC+ +GY GI  ++ +L  + +SLL+  +  Y+  L+E MP           +  +++ F+ +L+ +IE   L T+V  +L   GN I+F L IE  L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   +   F+ +WS + + +  P    +   ++ FG+GL WAGCAI+ LLGQQR F+  D C  +++  R   K EI     L  ++ RIR    +NN IF  LN+Y+  V+
Sbjct:   27 PCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK-LQVVPLFGDMQIELSRYIETSAHYEENKSKW-TCTQSSISPQYNLCEQMVQIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSTHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQMTLREPLRQAVRKKKNVLISVLQAIRKTVCDWEGARE----PPNDPCLRGEKDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVQAIEDFHKQSFFFTHLLNFSEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNY-GVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDHAISRFESEDLTSIVELEWLLEINRLTHRLLCKHLTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPR-VYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFL-------QDGV----W-RGPPPTNGVMHVDECMEFHRLWSAMQFVYCIPVGTHEFTAEQCFGDGLNWAGCAIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEIFAILNKYMKAVE 1228          
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Medaka
Match: cyfip1 (cytoplasmic FMR1-interacting protein 1 homolog [Source:NCBI gene;Acc:101169438])

HSP 1 Score: 824.698 bits (2129), Expect = 0.000e+0
Identity = 462/1242 (37.20%), Postives = 724/1242 (58.29%), Query Frame = 3
Query:  144 PCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG----DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSP--NINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDS--SKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVIN-----QXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSI------WAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNK--LRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPM-----LESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYLFTVD 3788
            PC++    +V Y+ NFNTN ED N F    A Y ++A VH  ++ +LE+G+++ +MLYTWRSCSRA+P   +  N       I EKT+E+L+P + KL  F  FQ  A+ +FC E+  LC   +R++F+SEA +L +   + MF ++DE+KNMK  +KNDH+ YKRAAQ L+ +       ++ + SM+LA  + +   L+ +L  I G+E+   +++NLC   Y  K YL   EKH L+ V+ F L+LMD + S    ++  +++ L+KID+  K+ +VV +FGDM I    +IK + +++   S+W   T+   S Q  I   ++Q R ++    +ELA+YSN+ V+      + +++    +  +DLAL+ +QLLS+W+  +++ +SWKL H  D + N E P  AE+YE+ATRYNY S+EKFAL+EV+AMIK +Q  + RME  F   I   IY  +Q F  I+L +   +  KK  N +  +LQ+I      W  G +P     L              KG  ++         ++  R + P STQLY++R ++ESL  +K+ +K  +R   +  ++  +E FH++SFF+++LLNF++TL   CDLSQLW+REFFLE+T G+RIQFPIE S+P ILT+HILDT++ + +EY+LYPLDLYNDSA  AL KFK+QFLY+EIEAEVN    Q V +L+DQIF +YK  A S+LL+KR +    N   +NI  PP  RY TL+KQRH+QLLGRS +L +LI+ R++ +LY+SLE  I +F+   L+SI+E + L+ ++R+ ++ LSK+L LD ++ +  E   + ++ +G ++  +  E+     PN+ +N  TNRFV        E  R +P  +    +   L+GSKTLN  +  I   Y  +LG  H+  +C+ +GY GI  ++ +L  + +SLL+  +  Y+  LME MP           +  +++ F+ +L+ +IE   L T     L   GN I+F L  E +L+  E  D+  A PF NI P+       E ++    +L  K++   +  +++ +GT +Q+ ++++   LTKERLC   S+F+  L  ++  L       +D +    W R    TN  +   D   F+ +WS + + +  P    +  ++  FG+GL WAGC I+ LL QQR F+  D    +++  +   K+  I+S  L  +  RIR    INN IF  L++Y+ + D
Sbjct:   27 PCIEPLPSSVVYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNDMLEEGQEYAVMLYTWRSCSRAIP--QVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRTAIDRFCGEVRRLCHAERRKDFVSEAYLLTLGRFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMAEPASIQESQNLSMFLANHNKITQSLQQQLEVIHGYEELLADIVNLCADYYENKLYLTPSEKHMLLKVMGFGLYLMDGNSSNIYKLDAKKRINLTKIDKFFKQLQVVPLFGDMQIELSRYIKTSAHFEENKSRW-TCTSVSSSPQYNICEQMIQIRDDHMRFISELARYSNSEVVTGSGRQEAQKTDTEYRKLFDLALQGMQLLSQWSAHVMEVYSWKLVHPTDRYSNKEFPDSAEEYERATRYNYTSEEKFALVEVMAMIKGLQVLMGRMESVFNHAIRHTIYTALQDFAQITLRDPLRQAIKKKKNVIQSVLQAIRKTVCDWETGREPHNDPALRGE--------KDPKGGFDI---------KVPRRAVGPSSTQLYMVRTMLESLVADKSGSKKTMRSSLEGPTILDIERFHRESFFYTHLLNFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILDTKEASMMEYVLYPLDLYNDSAHYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKILAGSLLLDKRLRTDCKNQ-GTNIPWPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSSALYKSLELAINRFESEDLSSIVELEGLLEVNRMTHKLLSKFLTLDSYNAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTELTFSQEIQREKPSNA----QPQYLYGSKTLNMAYSSIFSSYRNFLGPPHIKVMCRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTVCFQNLREVGNAILFCLLCEQSLSQEEVCDLLHAAPFQNILPR-VHVKEGERLEAKMKRLETKYTALHMVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRVRGFL-------DDPI----W-RGPLPTNGVMHVDDCVEFHRLWSAMQFVYCIPVGANEFTVERCFGDGLHWAGCMIITLLSQQRRFDILDFSYHLLKVQKHDGKDEIIKSVPLKKMVDRIRKFQVINNEIFGILSKYMKSGD 1230          
BLAST of Cytoplasmic FMR1-interacting protein vs. Planmine SMEST
Match: SMESG000062092.1 (SMESG000062092.1)

HSP 1 Score: 2527.67 bits (6550), Expect = 0.000e+0
Identity = 1253/1254 (99.92%), Postives = 1253/1254 (99.92%), Query Frame = 3
Query:   66 MFHSEQIFXXXXXXXXXXXXXXHGDVPCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVDDYYMKPMITHLNP 3827
            MFHSEQIFNALSNVSLLKSNLLHGDVPCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANV NQNEESKENNKSAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVDDYYMKPMITHLNP
Sbjct:    1 MFHSEQIFNALSNVSLLKSNLLHGDVPCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVRNQNEESKENNKSAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVDDYYMKPMITHLNP 1254          
BLAST of Cytoplasmic FMR1-interacting protein vs. Planmine SMEST
Match: SMESG000062092.1 (SMESG000062092.1)

HSP 1 Score: 2497.23 bits (6471), Expect = 0.000e+0
Identity = 1225/1226 (99.92%), Postives = 1225/1226 (99.92%), Query Frame = 3
Query:  150 MQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVDDYYMKPMITHLNP 3827
            MQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANV NQNEESKENNKSAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVDDYYMKPMITHLNP
Sbjct:    1 MQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSGDATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPSPNINRNRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVRNQNEESKENNKSAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQNKTRNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVDDYYMKPMITHLNP 1226          
BLAST of Cytoplasmic FMR1-interacting protein vs. Planmine SMEST
Match: SMESG000037092.1 (SMESG000037092.1)

HSP 1 Score: 1070.07 bits (2766), Expect = 0.000e+0
Identity = 553/1263 (43.78%), Postives = 814/1263 (64.45%), Query Frame = 3
Query:  138 DVPCMQAANLAVKYEVNFNTNNEDSNGFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISGNNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRKREEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKILDSG---DATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEKFYLYQEEKHTLVLVIAFSLFLMDTSPS-------PNINR-NRKLPLSKIDQIIKECEVVNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSEYTSLTAELAKYSNANVINQXXXXXXXXXXAYDLALKSLQLLSKWTTQIIDTFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKTIQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFILQSIWAIGLDPKASNEL------EISIPDKASTLSKKKGAAELLQFIENMKSQLKTRKIPPGSTQLYLIRCIVESLFQ----NKTRNKLRREFDQQSLFIMEEFHKKSFFWSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNHILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQLVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLMKQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDSLISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEIICPNFSFNSGTNRFVPMLESYRSR------PLESTVHDRIDQLWGSKTLNSCFEVIMKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISLLMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFGNCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKLNK-------------KFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSLQEILYQMKILDEDNLEI---NFWTRKENNTNYAIFDYDDSAFYMIWSVILYSFSKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANRAINKEIKIES-ELDLISKRIRCLLQINNRIFDTLNRYLFTVDDY 3794
            DVPC+QA N A+KY+VNF+TN ED   FR+  A Y +EAQV  +LHTLLE+G+++ IMLYTWRSCSRALP   I  N       I EKT+E+L+PY+ KL+ F+ FQ  ++ +FCEE+  LC  +KRE+F+S A +L++  +L MF  +DEMKNMKA MKNDH+ YKRA Q L+ LD     ++   S++LA+Q+V+R  L+ +L KISGFE+   +++N  V MY    Y+  EEKHTLV++IAF + L+D++ S        N+N+ N+KL LSKID+IIKECEVVN+FGDMS+ PF +IK TPNYDSSKWPE  ++++S+QG++++H+ +FR EYTSLTAELA ++N      +  SK+ NK  Y+L L+++QLLS WT Q++DT++WKL H  DSH N   PKEAEDYEKATRYNY +QE+FALIEVI M+K++Q+QL R++  + E I   IY ++QTF+  +L+E + K  K     + +++ SI A   D   S  L        ++     T  K     E     E+++ Q++ R + PGSTQLYL+R  VES+      +  +N LR++ D  SL  ME+FH++SF+W YLLN +DT+   CD+SQ W+REFFLE+TNG+R+QFPIE SIP ILT+H+L+TQDPA+ E LLYPLDLYNDSA CAL  F+R+FLY+EIEAE N    QLV +L+ QIF+ YKQ+A+S+LL+K+F++        +++ PPP RY TLM+QR + LLGR  ++ +L++ RINK+++ SL+  I +F+ + +T ++E D+LI  +RLC++ LS YLELDDF  +L E   S  S  G +S+ +  E+   +  N+ +N  TNRFV     +  +      P+  T     + +WGSK+LN+C+E I +LY G++G  H   IC+ +GY GIY ++++L  + ES++K NL   +  ++  MP  L     G+++ ++   + ++L  V ++  L+T++  A   FGN +IFVL +E NL + E+ D+K A  F  + P+P    +  +M   R  +N+             K+++  +  ++   GT EQ  L+++H  LT+ERLC    +F+  L SLQ+ +       E   E    N W +    +N  +  ++ + F+ IWS + + F  P  + + NI+E+FGEGL WAGC ++ALLGQQ+ FE  DI G +MR  ++  K    E+  L+ ++ RIR    +N++IF TLNRYL   D Y
Sbjct:   27 DVPCIQAVNCAIKYQVNFDTNFEDRGSFRIASARYPEEAQVQSQLHTLLEQGREYAIMLYTWRSCSRALP--PIKSNEQPYRIQIYEKTVELLEPYVAKLRAFKTFQQMSIDRFCEEVQRLCHEKKREDFVSGAYLLSLGKLLCMFAQLDEMKNMKASMKNDHSHYKRATQFLRHLDRDSMHESQVLSLFLAEQNVIRDKLREQLTKISGFEELLADIVNNSVQMYENHMYILPEEKHTLVMIIAFGINLIDSTKSLNGKEVGVNVNKMNKKLILSKIDKIIKECEVVNLFGDMSLCPFNYIKTTPNYDSSKWPECNSSRLSSQGVLLDHMARFREEYTSLTAELAWHTNLATTRDSSRSKKENKDLYNLMLRAIQLLSGWTVQVLDTYTWKLAHCTDSHQNPFCPKEAEDYEKATRYNYSNQEQFALIEVIGMVKSVQSQLIRLDASYSEGIRNAIYTDLQTFVQCTLNEPYRKAQKNKKAIIAWLIDSIRAACQDKVTSEGLLAKSTSSSTLGSGGGTTKKVLTGTEQQAATESLRLQIRPRDVGPGSTQLYLVRTTVESMVALRPGSSQKNSLRKDLDAASLLCMEQFHRQSFYWPYLLNLSDTVFKCCDMSQFWFREFFLELTNGQRVQFPIEMSIPWILTDHVLETQDPAFTELLLYPLDLYNDSARCALLSFRRKFLYDEIEAEANLAFDQLVFKLAGQIFVHYKQYAASLLLDKQFRSEAAK-IGFHVHYPPPNRYATLMRQRQVHLLGRCIDINRLLTQRINKAIFTSLDTAISRFRSSDITGVVELDALIECNRLCHRMLSDYLELDDFGNLLREANHSVKSHLGCISQHVFWEVNYDLSHNYCYNDSTNRFVLTAVPFGEKLLRDNPPVVGT-----EYIWGSKSLNTCYENIFRLYKGFVGNAHFRVICRLLGYQGIYIVVAELMKICESMIKMNLSQIVRKILRVMPKELHPPKSGQTSDQVFSEYYKQLEGVYQMSALSTDMCQAFREFGNIVIFVLMLEQNLTVQESCDLKHAAAFTGVIPRPFIGPDVSKMGD-RKDINRDAILKEATKNLELKYAVLNVGKIVSKFGTLEQATLAREHEILTRERLCCGLVMFEQVLKSLQQYILTPDPELEGFTEYIGSNIW-QGMRPSNEVMEVHECTEFHRIWSAVQFVFCTPRGENEFNIEELFGEGLNWAGCTLIALLGQQKRFEALDIGGHLMRVQKSDQKVDTSENISLERLANRIRRFNILNSQIFATLNRYLNPTDRY 1279          
The following BLAST results are available for this feature:
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYFIP20.000e+038.01cytoplasmic FMR1 interacting protein 2 [Source:HGN... [more]
CYFIP20.000e+038.01cytoplasmic FMR1 interacting protein 2 [Source:HGN... [more]
CYFIP20.000e+037.55cytoplasmic FMR1 interacting protein 2 [Source:HGN... [more]
AC270230.10.000e+037.17pep chromosome:GRCh38:CHR_HG2365_PATCH:23539361:23... [more]
AC270230.10.000e+037.17pep chromosome:GRCh38:CHR_HG2365_PATCH:23539361:23... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gex-20.000e+035.70Cytoplasmic FMR1-interacting protein homolog [Sou... [more]
gex-20.000e+035.70Cytoplasmic FMR1-interacting protein homolog [Sou... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sra-10.000e+039.56gene:FBgn0038320 transcript:FBtr0083085[more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyfip20.000e+038.36cytoplasmic FMR1 interacting protein 2 [Source:ZFI... [more]
cyfip20.000e+038.36cytoplasmic FMR1 interacting protein 2 [Source:ZFI... [more]
cyfip20.000e+038.33cytoplasmic FMR1 interacting protein 2 [Source:ZFI... [more]
cyfip20.000e+038.33cytoplasmic FMR1 interacting protein 2 [Source:ZFI... [more]
cyfip20.000e+038.33cytoplasmic FMR1 interacting protein 2 [Source:ZFI... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyfip20.000e+038.42cytoplasmic FMR1 interacting protein 2 [Source:NCB... [more]
cyfip20.000e+038.02cytoplasmic FMR1 interacting protein 2 [Source:NCB... [more]
CYFIP10.000e+036.90cytoplasmic FMR1 interacting protein 1 [Source:NCB... [more]
cyfip20.000e+037.48cytoplasmic FMR1 interacting protein 2 [Source:NCB... [more]
cyfip20.000e+037.21cytoplasmic FMR1 interacting protein 2 [Source:NCB... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyfip20.000e+038.10cytoplasmic FMR1 interacting protein 2 [Source:MGI... [more]
Cyfip20.000e+038.10cytoplasmic FMR1 interacting protein 2 [Source:MGI... [more]
Cyfip20.000e+038.10cytoplasmic FMR1 interacting protein 2 [Source:MGI... [more]
Cyfip10.000e+036.92cytoplasmic FMR1 interacting protein 1 [Source:MGI... [more]
Cyfip10.000e+036.92cytoplasmic FMR1 interacting protein 1 [Source:MGI... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VF87|CYFIP_DROME0.000e+039.56Cytoplasmic FMR1-interacting protein OS=Drosophila... [more]
sp|Q299G2|CYFIP_DROPS0.000e+039.48Cytoplasmic FMR1-interacting protein OS=Drosophila... [more]
sp|Q5SQX6|CYFP2_MOUSE0.000e+038.10Cytoplasmic FMR1-interacting protein 2 OS=Mus musc... [more]
sp|Q6GQD1|CYFP2_XENLA0.000e+038.52Cytoplasmic FMR1-interacting protein 2 OS=Xenopus ... [more]
sp|Q5R414|CYFP2_PONAB0.000e+038.01Cytoplasmic FMR1-interacting protein 2 OS=Pongo ab... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RRZ50.000e+039.97Cytoplasmic FMR1-interacting protein 2 OS=Fasciola... [more]
A0A4S2M2F50.000e+039.95Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3R7F6F50.000e+039.50Cytoplasmic FMR1-interacting protein OS=Clonorchis... [more]
A0A0B6ZWY00.000e+039.71Cytoplasmic FMR1-interacting protein OS=Arion vulg... [more]
A0A4Z2D8G20.000e+040.00Cytoplasmic FMR1-interacting protein isoform 1 OS=... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cyfip10.000e+036.63cytoplasmic FMR1 interacting protein 1 [Source:NCB... [more]
cyfip20.000e+037.35cytoplasmic FMR1 interacting protein 2 [Source:ZFI... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000006845.10.000e+037.89pep scaffold:Pmarinus_7.0:GL477909:4128:49849:1 ge... [more]
ENSPMAT00000006842.10.000e+037.57pep scaffold:Pmarinus_7.0:GL477909:4128:49849:1 ge... [more]
ENSPMAT00000009553.10.000e+041.65pep scaffold:Pmarinus_7.0:GL480583:10952:25466:1 g... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO417349.415e-13533.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cyfip20.000e+038.44cytoplasmic FMR1-interacting protein 2 [Source:NCB... [more]
cyfip10.000e+037.20cytoplasmic FMR1-interacting protein 1 homolog [So... [more]
back to top
BLAST of Cytoplasmic FMR1-interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000062092.10.000e+099.92SMESG000062092.1[more]
SMESG000062092.10.000e+099.92SMESG000062092.1[more]
SMESG000037092.10.000e+043.78SMESG000037092.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004459 ID=SMED30004459|Name=Cytoplasmic FMR1-interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4019bp
AATAAATAACGCAAAATTTCAAATTATTTTTTCCGTTTTCTTGAGATTGA
TTTATTCAGATAATTATGTTTCATTCTGAACAAATTTTTAACGCTCTAAG
TAATGTTAGTTTACTGAAAAGTAATTTGCTTCATGGTGATGTTCCTTGTA
TGCAAGCAGCTAATTTGGCTGTTAAATATGAAGTTAATTTCAATACAAAT
AATGAAGATAGTAACGGCTTTAGAGTTGTTCAAGCCGTTTATAAACAAGA
AGCTCAAGTTCATGGTGAATTACACACTTTGTTAGAAAAGGGAAAAGATT
TCGTCATTATGTTATATACTTGGAGATCCTGTTCACGTGCTCTACCAACT
GGCAGTATCTCTGGTAATAATGGCGAATTAACTAATTCAATTCAAGAAAA
AACGATTGAGATATTGAAGCCTTATATTGATAAATTGAAAAAATTTAGGG
AATTTCAAAATGAAGCGGTTAAAAAGTTTTGCGAAGAAATCAATAATTTG
TGTAAAAGACGTAAAAGAGAAGAGTTTTTATCTGAAGCAAATATGCTAGC
CATGTGTGATATGTTAAAAATGTTTGTTTTGATTGATGAAATGAAAAATA
TGAAAGCTGGAATGAAAAATGACCATACACAATATAAAAGGGCTGCACAA
CATCTAAAAATTCTTGATTCGGGCGATGCTACCGATTTTTCAATGTACTT
AGCTCAACAACATGTTCTACGGTGTGATTTGAAAAGTGAATTAATAAAAA
TTTCGGGATTTGAAGATTTTTTTGTTGAATTGATTAATCTTTGTGTTTTG
ATGTACATCGAAAAGTTTTACCTTTATCAAGAAGAAAAACATACTCTAGT
CCTGGTTATTGCATTTTCACTTTTTTTAATGGATACATCCCCTAGTCCAA
ATATAAATAGAAATAGGAAACTTCCTTTGTCAAAAATAGATCAAATTATT
AAGGAATGCGAAGTTGTCAATGTATTTGGTGATATGAGTATTTATCCATT
TTGTTTTATTAAAGCTACCCCTAATTACGATTCAAGTAAATGGCCAGAGA
ACACAAATAATAAAATTTCTACTCAAGGTTTAATCATGAATCATATTTTG
CAATTTCGATCTGAATATACTAGTTTGACTGCAGAATTAGCGAAATATTC
AAATGCTAATGTAATAAATCAAAACGAAGAATCCAAAGAAAATAATAAAT
CTGCTTATGATTTAGCATTGAAATCTCTGCAATTGCTTTCTAAGTGGACA
ACACAAATAATAGATACATTTAGTTGGAAATTGGGACATTTGGCTGATTC
CCATTTAAATACAGAAATTCCTAAGGAGGCTGAAGATTATGAAAAAGCAA
CAAGATATAATTATGATTCTCAAGAAAAGTTTGCACTTATAGAAGTTATT
GCAATGATTAAAACTATTCAAACTCAATTGAGTCGAATGGAATGTCATTT
TATGGAAACAATCATTCCTTATATTTATTTTGAAATGCAAACTTTCTTAC
ATATTTCTCTGCATGAAATTTTTAATAAAATTTCTAAGAAGATTACTAAT
CAGTTACCGTTTATTCTTCAATCTATATGGGCCATTGGATTAGATCCAAA
AGCTTCTAACGAATTGGAGATTAGTATTCCCGATAAGGCAAGTACATTAT
CCAAGAAAAAAGGTGCTGCCGAACTGTTACAATTTATTGAAAATATGAAG
AGCCAACTAAAAACTCGTAAAATACCTCCTGGATCAACCCAGCTTTATCT
TATAAGATGCATAGTGGAAAGTTTATTCCAAAATAAAACAAGAAATAAAT
TAAGAAGAGAATTTGATCAACAGAGTCTTTTTATTATGGAAGAATTTCAT
AAGAAAAGCTTTTTCTGGTCTTATTTGCTTAATTTTGCAGATACACTTTC
AATCTCTTGTGACTTATCGCAGTTATGGTATCGAGAATTTTTCTTAGAAA
TGACTAATGGTAAAAGAATTCAATTTCCTATTGAAACTTCAATACCATGT
ATTCTAACAAATCACATATTAGACACTCAAGATCCGGCATATATAGAGTA
TTTATTATATCCTCTTGATTTATACAATGATTCCGCTGTTTGTGCTCTTA
AAAAGTTTAAGCGACAATTTCTTTACAATGAAATAGAAGCAGAAGTTAAC
TTTATGATGATACAATTAGTAGTGAGGCTCAGTGATCAAATTTTTATATT
TTACAAGCAATTTGCTTCATCAATGTTACTTAATAAGCGTTTTAAAAACC
ACATTAATAATTCATGTAAAAGCAATATCAATAATCCACCACCAGAGCGC
TACGTAACTTTAATGAAACAACGCCATTTGCAGTTGCTAGGAAGGTCATT
TAATCTTTGCAAATTGATATCATATCGAATTAATAAATCTCTTTACGAAT
CTCTGGAAGCAATTATCAGAAAATTTAAAAGAAATGGATTAACAAGTATT
TTGGAATTCGATTCGTTAATTTCTATACACCGTTTGTGTTATCAAAATTT
ATCTAAATATTTGGAATTAGATGATTTTGACTGTGTATTAGCTGAGATAA
CTCAAAGTACAACATCTACATTCGGAAATGTATCTGAGTTCATTATTAAA
GAGATAACAGAAATTATTTGCCCAAATTTCTCTTTTAATAGTGGAACTAA
TAGATTTGTACCGATGCTAGAGTCGTATAGATCTCGACCTTTGGAGTCAA
CAGTTCATGATCGTATCGATCAATTATGGGGAAGCAAAACTTTGAACTCT
TGTTTTGAAGTTATAATGAAATTGTATAATGGTTATTTAGGAAAAGAACA
TATGATAACCATTTGCAAATATATTGGTTATGATGGTATTTATTGGCTTC
TATCAAAATTAAAATATCTTAACGAGTCTCTTTTAAAAAATAATTTAAAA
CACTATATTTCTCTTTTAATGGAGCATATGCCATCAAATTTATTTGCGTG
TACTAAAGGAAAATCAGCTCAGGAATTAGTCAAAATATTTAATGAGGAAT
TAAGGAAAGTTATTGAAATTCCAAATTTGACGACAGAAGTATCTACTGCT
TTAAACACCTTTGGAAATTGTATTATCTTTGTACTTCAAATAGAAAATAA
TTTGAACATAAGTGAAGCACTTGATATCAAACAAGCTTATCCCTTCATTA
ATATTTTTCCGCAGCCATCTTCTACGTCCAACAGCGAGGAAATGGATAAA
TTAAGAAATAAGTTAAATAAAAAATTTTCGATTTACAAAATAAACAATGT
TTTGGATAACGTTGGAACAGCAGAGCAAGTTGAACTGTCTAAGCAACATT
GGGAATTGACAAAAGAGCGGTTATGCACTGAAAATTCAATTTTTAAATTC
TTTTTAAATAGCTTACAAGAAATACTTTATCAGATGAAGATATTAGATGA
AGATAATTTAGAAATTAACTTCTGGACTAGAAAAGAAAATAATACAAATT
ATGCTATTTTTGATTATGATGATTCTGCTTTTTATATGATTTGGTCAGTA
ATTTTATATTCATTTTCTAAGCCAGATGACAAAGTTAAAAAGAATATAGA
TGAAGTATTTGGTGAAGGTCTTCAATGGGCTGGTTGTGCCATATTGGCTC
TTTTAGGTCAACAAAGAATTTTTGAATGTAATGACATATGCGGTAAGATT
ATGAGAGCTAACAGAGCTATTAACAAAGAAATAAAAATTGAATCGGAGTT
AGATTTGATTTCAAAACGTATAAGATGTTTACTGCAAATTAATAATCGTA
TATTTGATACACTAAATCGCTACTTGTTTACTGTTGATGATTATTATATG
AAACCTATGATTACTCATTTAAATCCGAATGAAAATCAACAGGCAAATTT
CGAAAATGCAGAAGAGTTTGATGATTAAGCACTATGATTTTATACAATAA
ATTTTATATTGTCAAAATAAAACGATTAAAAAACATTGTTTTTATTGAAA
TGAGTATAAATTTTCAATATTCTATTAAAGCAAAATTTATTTATTCAGTG
CCTTATTTTGATTTGTCAG
back to top

protein sequence of SMED30004459-orf-1

>SMED30004459-orf-1 ID=SMED30004459-orf-1|Name=SMED30004459-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1271bp
MFHSEQIFNALSNVSLLKSNLLHGDVPCMQAANLAVKYEVNFNTNNEDSN
GFRVVQAVYKQEAQVHGELHTLLEKGKDFVIMLYTWRSCSRALPTGSISG
NNGELTNSIQEKTIEILKPYIDKLKKFREFQNEAVKKFCEEINNLCKRRK
REEFLSEANMLAMCDMLKMFVLIDEMKNMKAGMKNDHTQYKRAAQHLKIL
DSGDATDFSMYLAQQHVLRCDLKSELIKISGFEDFFVELINLCVLMYIEK
FYLYQEEKHTLVLVIAFSLFLMDTSPSPNINRNRKLPLSKIDQIIKECEV
VNVFGDMSIYPFCFIKATPNYDSSKWPENTNNKISTQGLIMNHILQFRSE
YTSLTAELAKYSNANVINQNEESKENNKSAYDLALKSLQLLSKWTTQIID
TFSWKLGHLADSHLNTEIPKEAEDYEKATRYNYDSQEKFALIEVIAMIKT
IQTQLSRMECHFMETIIPYIYFEMQTFLHISLHEIFNKISKKITNQLPFI
LQSIWAIGLDPKASNELEISIPDKASTLSKKKGAAELLQFIENMKSQLKT
RKIPPGSTQLYLIRCIVESLFQNKTRNKLRREFDQQSLFIMEEFHKKSFF
WSYLLNFADTLSISCDLSQLWYREFFLEMTNGKRIQFPIETSIPCILTNH
ILDTQDPAYIEYLLYPLDLYNDSAVCALKKFKRQFLYNEIEAEVNFMMIQ
LVVRLSDQIFIFYKQFASSMLLNKRFKNHINNSCKSNINNPPPERYVTLM
KQRHLQLLGRSFNLCKLISYRINKSLYESLEAIIRKFKRNGLTSILEFDS
LISIHRLCYQNLSKYLELDDFDCVLAEITQSTTSTFGNVSEFIIKEITEI
ICPNFSFNSGTNRFVPMLESYRSRPLESTVHDRIDQLWGSKTLNSCFEVI
MKLYNGYLGKEHMITICKYIGYDGIYWLLSKLKYLNESLLKNNLKHYISL
LMEHMPSNLFACTKGKSAQELVKIFNEELRKVIEIPNLTTEVSTALNTFG
NCIIFVLQIENNLNISEALDIKQAYPFINIFPQPSSTSNSEEMDKLRNKL
NKKFSIYKINNVLDNVGTAEQVELSKQHWELTKERLCTENSIFKFFLNSL
QEILYQMKILDEDNLEINFWTRKENNTNYAIFDYDDSAFYMIWSVILYSF
SKPDDKVKKNIDEVFGEGLQWAGCAILALLGQQRIFECNDICGKIMRANR
AINKEIKIESELDLISKRIRCLLQINNRIFDTLNRYLFTVDDYYMKPMIT
HLNPNENQQANFENAEEFDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001507ZP_dom
IPR008081Cytoplasmic_FMR1-int
Vocabulary: biological process
TermDefinition
GO:0000902cell morphogenesis
GO:0001745compound eye morphogenesis
GO:0006909phagocytosis
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0007411axon guidance
GO:0008360regulation of cell shape
GO:0022416chaeta development
GO:0030031cell projection assembly
GO:0030154cell differentiation
GO:0030866cortical actin cytoskeleton organization
GO:0033627cell adhesion mediated by integrin
GO:0050807regulation of synapse organization
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0031209SCAR complex
GO:0045177apical part of cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008081Cytoplasmic FMR1-interactingPRINTSPR01698CYTOFMRPINTPcoord: 44..61
score: 44.44
coord: 1080..1104
score: 44.0
coord: 614..632
score: 78.07
coord: 101..117
score: 39.22
coord: 422..440
score: 76.32
coord: 744..774
score: 59.14
coord: 553..576
score: 46.53
coord: 258..273
score: 62.5
coord: 141..170
score: 36.67
coord: 683..705
score: 59.42
IPR008081Cytoplasmic FMR1-interactingPIRSFPIRSF008153CYFIPcoord: 1..1268
e-value: 0.0
score: 1038.2
IPR008081Cytoplasmic FMR1-interactingPFAMPF05994FragX_IPcoord: 380..1233
e-value: 1.1E-242
score: 807.8
IPR008081Cytoplasmic FMR1-interactingPANTHERPTHR12195P53 INDUCIBLE PROTEIN-RELATEDcoord: 9..1242