DUF2428 domain-containing protein

Overview
NameDUF2428 domain-containing protein
Smed IDSMED30004455
Length (bp)4825
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF2428 domain-containing protein (SMED30004455) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF2428 domain-containing protein (SMED30004455) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF2428 domain-containing protein (SMED30004455) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF2428 domain-containing protein (SMED30004455) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004455

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004455SMESG000032327.1 dd_Smed_v4_12316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004455SMESG000032327.1 dd_Smed_v4_12316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004455SMESG000032327.1 dd_Smed_v4_12316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30004455SMESG000032327.1 SMED30004455smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF2428 domain-containing protein vs. Ensembl Human
Match: THADA (THADA armadillo repeat containing [Source:HGNC Symbol;Acc:HGNC:19217])

HSP 1 Score: 62.3882 bits (150), Expect = 9.183e-9
Identity = 74/304 (24.34%), Postives = 125/304 (41.12%), Query Frame = 1
Query: 2536 REIGGILLKILCQSRHRGTIE-CVAGYLQTYIRLGK-----MNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRV-----ASATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLT----SPVVVVRHLGAKCI-----INSLPNS 3387
            +EIG    + L QSRHRG  E    G+++    L +     +   P  WL +    + E        K   TRRSAG+P  + + L          +L     I + +L +     +D+      P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF A+++R+     A       +  T  E FS +PEL+  +L  L+      DS     N+   P++  L  +L         G S +  +  F P +     SPV   R + A+ +     I+ +PN+
Sbjct: 1090 KEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEVLNRCPNVSLQKLPEQWLWS---VLEEIKCSDPSSKLCATRRSAGIPFYIQALLASEPKKGRMDLLK----ITMKELISLAGPTDDIQSTV--PQVHALNILRALFRDTRLGENIIPYVADGAKAAILGFTSPVWAVRNSSTLLFSALITRIFGVKRAKDEHSKTNRMTGREFFSRFPELYPFLLKQLETVANTVDSDMGEPNRH--PSMFLLLLVLERLYASPMDGTSSALSMGPFVPFIMRCGHSPVYHSREMAARALVPFVMIDHIPNT 1382          
BLAST of DUF2428 domain-containing protein vs. Ensembl Human
Match: THADA (THADA armadillo repeat containing [Source:HGNC Symbol;Acc:HGNC:19217])

HSP 1 Score: 62.3882 bits (150), Expect = 9.183e-9
Identity = 74/304 (24.34%), Postives = 125/304 (41.12%), Query Frame = 1
Query: 2536 REIGGILLKILCQSRHRGTIE-CVAGYLQTYIRLGK-----MNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRV-----ASATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLT----SPVVVVRHLGAKCI-----INSLPNS 3387
            +EIG    + L QSRHRG  E    G+++    L +     +   P  WL +    + E        K   TRRSAG+P  + + L          +L     I + +L +     +D+      P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF A+++R+     A       +  T  E FS +PEL+  +L  L+      DS     N+   P++  L  +L         G S +  +  F P +     SPV   R + A+ +     I+ +PN+
Sbjct: 1090 KEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEVLNRCPNVSLQKLPEQWLWS---VLEEIKCSDPSSKLCATRRSAGIPFYIQALLASEPKKGRMDLLK----ITMKELISLAGPTDDIQSTV--PQVHALNILRALFRDTRLGENIIPYVADGAKAAILGFTSPVWAVRNSSTLLFSALITRIFGVKRAKDEHSKTNRMTGREFFSRFPELYPFLLKQLETVANTVDSDMGEPNRH--PSMFLLLLVLERLYASPMDGTSSALSMGPFVPFIMRCGHSPVYHSREMAARALVPFVMIDHIPNT 1382          
BLAST of DUF2428 domain-containing protein vs. Ensembl Human
Match: THADA (THADA armadillo repeat containing [Source:HGNC Symbol;Acc:HGNC:19217])

HSP 1 Score: 55.4546 bits (132), Expect = 9.663e-7
Identity = 46/184 (25.00%), Postives = 79/184 (42.93%), Query Frame = 1
Query: 2536 REIGGILLKILCQSRHRGTIE-CVAGYLQTYIRLGK-----MNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRV 3069
            +EIG    + L QSRHRG  E    G+++    L +     +   P  WL +    + E        K   TRRSAG+P  + + L          +L     I + +L +     +D+      P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF A+++R+
Sbjct:  404 KEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEVLNRCPNVSLQKLPEQWLWS---VLEEIKCSDPSSKLCATRRSAGIPFYIQALLASEPKKGRMDLLK----ITMKELISLAGPTDDIQSTV--PQVHALNILRALFRDTRLGENIIPYVADGAKAAILGFTSPVWAVRNSSTLLFSALITRI 578          
BLAST of DUF2428 domain-containing protein vs. Ensembl Celegans
Match: Y92H12A.5 (pep chromosome:WBcel235:I:1491340:1514411:-1 gene:WBGene00022361.1 transcript:Y92H12A.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y92H12A.5)

HSP 1 Score: 68.5514 bits (166), Expect = 4.135e-11
Identity = 160/715 (22.38%), Postives = 285/715 (39.86%), Query Frame = 1
Query: 1231 HSKDQIRIASYKFVCDNYSQQINQLPFMNLSNIIDVFVNNLTSDSPGFRNHMISATRRLYICIR---DATVSYLADSKALLESISILNEKLSHLFNDRVVHLESINWVEEMKNVGGSLN-HDIALLII-----FSRLVYGNQWMYTSLNYQRQRSIIDLITIIREVLID-SNFIIDKKCGFANKTIIALRDFYRITREAYFSDTKSFIQNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRKEIK--LNDLWNETQILCHSNQPIQLNAGALFCSFLSHCDYQTDN-SITIDDFLVDFLEHLASIDMSSVLIMSLKTPGYGYLMSIDLLLRQNLKKSILHSERIPLAALKVVKLMMQTMGCEDHGRIIDFTYCLADRDFLFSQDLASFHKMGITMNSVANKDDGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQVVVKEIRSPL-------FREIGGILLKILCQSRHRGTIECVA-GYLQ--TYIRLGKMNGYPN--NWLTADEVAINECIEGAARGKYSIT-----RRSAGLPLILMSAL-NGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKG--------VASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSA 3258
            H + ++R+A++K V +N  + I      ++  I     +N+T  +P  R  +I+A +  Y+C R    A +   A  K   +     +   S   +  +       W      +GG  N H I    I      ++L +G+  + T  NY R+  I+ L+ I  +VL    NFI+D KC F +K  +              SD  + +   I+ +  +   VQ++   +L     DF  ++ + K  LND      ++  +      +AG     +L+    Q D     +  FL D      + +   + I +L  P +  L  I+LLLR    K     E+      +++  ++Q   C    +I+             +  + S    G   + + +K  G  + RL    QH+L   W+  K+ + I   W    + E+ +PL          IG      L + +HRG  E    G+ Q  +++    + G P   +WL        E I  A RG+  +T     RRSAGLP +++S +     +N +G+++     +  MD            G      VH +N+MK +  +  L       F R + + ++    ++W  RNAA QLF A+ +++    +           +  +  E FS +P L+  + + L      +    F    +L+P L  LS+L   A
Sbjct:  328 HVESEVRLAAFKLVVENPRKTI-AFNENDIEYIKTFLASNMTLQAPSARQELIAAYK--YLCQRLGASAEIHLKAKPKTTDKDSDSCSPDSSSFDSRGLS-----KW-----RLGGDNNLHPIPESYICLAKWMAKLAFGS--LSTKGNYYRR--IMGLMQI--DVLFSRENFIVDGKCFFVDKLNL---------ESTLGSDRHNLV---IDCLDDSYDMVQSTALGLLKKL--DFGNIKLDEKKYLND---AVDLMTSTRSRNATSAGFRMQYYLTR---QPDRYKFCLMRFLDDVNNRAEAAEKDLLTITTL--PIHSILNMIELLLRNPTWKETTDQEKNQFYREEILDHLLQ--NCHKIIKIV-------------APVVQSMTPEGCIPDEILSKLCGVSADRLTEISQHLLICCWRAHKHVSGIF-AW----IIEMLAPLGIVTNAEIEAIGSFYWAQLTECKHRGAFESATDGFFQLCSFLWSTTIQGLPKPADWL--------EEILSAIRGETDLTNLCSTRRSAGLPSLVLSIVATEPKENENGALIKATGSLLNMD------------GKTSEYRVHSMNVMKTIVQSSTLHNKAVFCFERALRVAIEA-CRADWSERNAASQLFAALRTKIFGVMRSAQRSLVVDAKNRKSNYEFFSKFPTLYKFLYDQL----TSEQQSEF----SLLPPLVVLSHLYTPA 952          
BLAST of DUF2428 domain-containing protein vs. Ensembl Celegans
Match: Y92H12A.5 (pep chromosome:WBcel235:I:1490887:1514411:-1 gene:WBGene00022361.1 transcript:Y92H12A.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y92H12A.5)

HSP 1 Score: 68.5514 bits (166), Expect = 4.208e-11
Identity = 160/715 (22.38%), Postives = 285/715 (39.86%), Query Frame = 1
Query: 1231 HSKDQIRIASYKFVCDNYSQQINQLPFMNLSNIIDVFVNNLTSDSPGFRNHMISATRRLYICIR---DATVSYLADSKALLESISILNEKLSHLFNDRVVHLESINWVEEMKNVGGSLN-HDIALLII-----FSRLVYGNQWMYTSLNYQRQRSIIDLITIIREVLID-SNFIIDKKCGFANKTIIALRDFYRITREAYFSDTKSFIQNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRKEIK--LNDLWNETQILCHSNQPIQLNAGALFCSFLSHCDYQTDN-SITIDDFLVDFLEHLASIDMSSVLIMSLKTPGYGYLMSIDLLLRQNLKKSILHSERIPLAALKVVKLMMQTMGCEDHGRIIDFTYCLADRDFLFSQDLASFHKMGITMNSVANKDDGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQVVVKEIRSPL-------FREIGGILLKILCQSRHRGTIECVA-GYLQ--TYIRLGKMNGYPN--NWLTADEVAINECIEGAARGKYSIT-----RRSAGLPLILMSAL-NGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKG--------VASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSA 3258
            H + ++R+A++K V +N  + I      ++  I     +N+T  +P  R  +I+A +  Y+C R    A +   A  K   +     +   S   +  +       W      +GG  N H I    I      ++L +G+  + T  NY R+  I+ L+ I  +VL    NFI+D KC F +K  +              SD  + +   I+ +  +   VQ++   +L     DF  ++ + K  LND      ++  +      +AG     +L+    Q D     +  FL D      + +   + I +L  P +  L  I+LLLR    K     E+      +++  ++Q   C    +I+             +  + S    G   + + +K  G  + RL    QH+L   W+  K+ + I   W    + E+ +PL          IG      L + +HRG  E    G+ Q  +++    + G P   +WL        E I  A RG+  +T     RRSAGLP +++S +     +N +G+++     +  MD            G      VH +N+MK +  +  L       F R + + ++    ++W  RNAA QLF A+ +++    +           +  +  E FS +P L+  + + L      +    F    +L+P L  LS+L   A
Sbjct:  328 HVESEVRLAAFKLVVENPRKTI-AFNENDIEYIKTFLASNMTLQAPSARQELIAAYK--YLCQRLGASAEIHLKAKPKTTDKDSDSCSPDSSSFDSRGLS-----KW-----RLGGDNNLHPIPESYICLAKWMAKLAFGS--LSTKGNYYRR--IMGLMQI--DVLFSRENFIVDGKCFFVDKLNL---------ESTLGSDRHNLV---IDCLDDSYDMVQSTALGLLKKL--DFGNIKLDEKKYLND---AVDLMTSTRSRNATSAGFRMQYYLTR---QPDRYKFCLMRFLDDVNNRAEAAEKDLLTITTL--PIHSILNMIELLLRNPTWKETTDQEKNQFYREEILDHLLQ--NCHKIIKIV-------------APVVQSMTPEGCIPDEILSKLCGVSADRLTEISQHLLICCWRAHKHVSGIF-AW----IIEMLAPLGIVTNAEIEAIGSFYWAQLTECKHRGAFESATDGFFQLCSFLWSTTIQGLPKPADWL--------EEILSAIRGETDLTNLCSTRRSAGLPSLVLSIVATEPKENENGALIKATGSLLNMD------------GKTSEYRVHSMNVMKTIVQSSTLHNKAVFCFERALRVAIEA-CRADWSERNAASQLFAALRTKIFGVMRSAQRSLVVDAKNRKSNYEFFSKFPTLYKFLYDQL----TSEQQSEF----SLLPPLVVLSHLYTPA 952          
BLAST of DUF2428 domain-containing protein vs. Ensembl Fly
Match: CG3368 (gene:FBgn0039508 transcript:FBtr0085163)

HSP 1 Score: 67.3958 bits (163), Expect = 1.317e-10
Identity = 79/341 (23.17%), Postives = 148/341 (43.40%), Query Frame = 1
Query: 2434 QHVLSWTWQVIKN----TTSILVGWCQVVVKEIRSPLFREIGGILLKILCQSRHRGTIECVAGYLQTYIRLGKMNGYPNNWLTADEVA---INECIEG---AARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDV------NGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGV------ASNPT---FSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNL--LYSADKQLPQGMSLSDLLSCFWPLLTSPVVVVRHLGAKCIINS 3375
            +++L   W  +K      TSI     Q   K + +   R    I + +L   RH+G IE  AG     + +G++     + L + +     +++C+E        + S TRR AG  ++ +  L   NDN    +L +  + Q++   N+   A  V      + W +  ++HYL ++ +   +  L+  + +++  I+L+ ++H ++  W + NAALQLF A L ++    +        A  P+   + E+  L P+    +L      C + +  S     +++  L FLS +  L ++  + P  + L       W LL      VR L A C + S
Sbjct:  700 KYLLMSFWLTLKGCCDLATSIGCYQLQTSAKTVNTETLRRCLNINVSVLTLCRHKGAIE-AAG-----LSIGRLTRAITSSLDSCDSGFQMLHDCLERELLTESRQVSTTRRGAGFAIMFLHVLK--NDNPRQRLLLHRAVQQILKRLNENQTAETVCLDSNHDRW-EALVLHYLCVLVR---DTELRPAMSKYYNEILLVAMEHITNPEWTISNAALQLFGANLGKLVGQRQATEFDTRPAWEPSELDYDELGCLLPKACEHMLRC----CDRQEVTS-----SIILFLAFLSKVEHLRTSGGKEPNPL-LIRFRRLSWHLLRHKCDQVRQLAATCFVRS 1018          
BLAST of DUF2428 domain-containing protein vs. Ensembl Fly
Match: THADA (gene:FBgn0031077 transcript:FBtr0289978)

HSP 1 Score: 56.225 bits (134), Expect = 3.604e-7
Identity = 53/218 (24.31%), Postives = 91/218 (41.74%), Query Frame = 1
Query: 2542 IGGILLKILCQSRHRGTIE-CVAGYLQTYIRL-----GKMNGYPNNWLTADEVAINECIEGAARG-KYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCN-KLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKH-FSSSNWGVRNAALQLFMAMLSRVASATKG--------VASNPTFSEVFSLYPELWN 3144
            IG   L++L +++HRG  E    G+     R       ++N  P  W+      ++   E A +G +   TRRSAG+P +L  AL G+            C+ +L+++C  +   A  +         H LN+M+ +  +  L   +     R I   L     +  W  RN+A  L  A++ RV    +         V +  T    F+ YP+L++
Sbjct:  951 IGEHFLQLLAETKHRGAFEQAYVGFTMLCRRFWHSESVRLNQLPGQWVDEAMAMVSGQEEWAGKGARLCATRRSAGMPFML-QALVGTELKLGTHATLYRCMNRLLEVCERRTGGAAGITARS-----HALNIMRALFRSSELAELVTEFMARGIQCALDGLLLAEEWAERNSATLLLAALIVRVFGVERARLETGELHVRNRMTGRIFFTRYPQLFD 1162          
BLAST of DUF2428 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-225b11.4 (si:ch211-225b11.4 [Source:ZFIN;Acc:ZDB-GENE-060526-114])

HSP 1 Score: 91.2781 bits (225), Expect = 1.025e-17
Identity = 178/798 (22.31%), Postives = 338/798 (42.36%), Query Frame = 1
Query: 1240 DQIRIASYKFVCDNYSQQINQLPF-MNLSNIIDVFVNNLTSDSPGFRNHMISATRRLYICIRDATVSYLADSKALLESISILNEKLSHLFNDRVVHLESINWVEEMKNVGGSLNHDIALLIIFSRLVYGNQWMYTSLNYQRQRSIIDLITIIREVLIDSNFIIDKKCGFANKTIIALRDFYR-ITREAYFSDTKSFI-----QNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRKEIKLNDLWNETQILCHSNQPIQLNAGALFCSFLSH-----CDYQTDNSITIDDFLVDFLEHLASIDMSSVLIMSLKTPGYGY-------LMSIDLLLRQNLKKSILHSERIPLAALKVVKLMMQTMGCEDHGRIIDFTYCLADRDFLFSQDLASFHKMGITMNSVANKDDGNQSIRLGIEYQHVLSWTWQVIKN--------TTSILVGWCQ---VVVKEIR--SPLFREIGGILLKILCQSRHRGTIE-CVAGYLQTYIRLGKMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKG--VASNPTFSEV--FSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLTSPVVVVRHLGAKCIINSLPNSSYAFDIIQSNTYLVPQLTKPASNWSNISYNQQQGELFLLNLILEK 3522
            D +R+A+   +C   S + N+ P  +  S + D    NL  +S  FR H+ +A R+  + IRD+ ++ +   K       +  E+++ +       +E + W+ ++                   LVY    +    +YQR+++++ L+  + E   D+ +  D+K G     +  L ++ +   +  +FS +K  +     ++  N I+    ++    F    S  +D +CV        L++    L  S +  +   GAL    L        +     S+ +  FL+  LE       S +L+ +  TP +G        L+ +  +L +++  SI     + L  L +V L +     +   + +  ++C           ++S    G  ++ V   +DG +++ L  E+  VL+  W  +K            IL   C+   + V+E+R  S +F++I       + + RH G +E C  G+ + + R    +  P+       +         +    S+TRR+AGLP++++  L  + D+S    L    +  L+D    L   +D +   D P V  ++ ++ +    +L V + +    + +++L   SS+ W +RNAALQL+ ++ +R+    K    +SN   S    F LYP L   +   L+ +       + + +  L P LT LS L   A+K   Q  +LS+ L     L  SPV  VR + +K ++  +P S Y   ++Q    LV  L  P S      +N+  G+L     IL +
Sbjct:  609 DSVRLAALNLLC--CSPKTNEAPSQLEYSALRDFIPLNLNCESSPFRQHLQAALRKFLVRIRDSCMAII---KGRNSKKGLTEEEVAEIEQG----VEFVEWLFQLS------------------LVY----LSPDSSYQRKKTVLLLLCAVLETCTDT-WSPDRKKGQPPANMSTLINWAKDRGKWDFFSKSKLLVLIGCLEDSTNEIRELSAELLFRFFPS--SLPDDVTCV--------LFSRADQLLQSPRVQEAQMGALMVKLLLQKADGVFNQGEKQSVKLITFLLSKLEQHYLTARSDMLLAARTTPVHGIVSALQRGLLEVPGVLLESITHSIAGELVLLLEKLTLVLLGVLYGNQDTEEKDVPPSFCD------MGNAISSLIGQG-GVDGVGLDEDGEENVLLSEEHSLVLTCCWVSLKEIGIFLGSLVERILSLHCEELKLSVEELRTASKVFKDI-------ILKCRHWGAVEGCCVGFTK-FCRALLSSSDPDIRQIPSLMLQQGLSVLQSPSSTSVTRRAAGLPMLILGVL-AAEDSSKSRPLLAHTINTLLDTAKAL-LPSDWDQTLDLPQVCAVHTLQALVKGSSLGVAVLQFTPAMAVLSLTLLSSACWAMRNAALQLYSSLCTRMLGQQKAGEGSSNSGMSAASFFHLYPALQPFLQGALETAANDLHDATLLLHPALYPVLTLLSKLQPGAEK---QTRALSEFLPPLLLLSASPVYGVRVMSSKALVAMIPTSEYMATVLQ----LVKDL--PESPDVVSCHNRLHGKLLQTRAILTR 1338          
BLAST of DUF2428 domain-containing protein vs. Ensembl Zebrafish
Match: thada (THADA armadillo repeat containing [Source:ZFIN;Acc:ZDB-GENE-050320-49])

HSP 1 Score: 67.3958 bits (163), Expect = 1.652e-10
Identity = 91/358 (25.42%), Postives = 153/358 (42.74%), Query Frame = 1
Query: 2383 VANKDDGN-QSIRLGIEYQHVLSWTWQVIKNTTSILVGW--------CQVVVKEIRSPLFRE----IGGILLKILCQSRHRGTIECV-AGYL---QTYIRLG--KMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSV-LPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNP-----TFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLL----TSPVVVVRHLGAKCII 3369
            + N  DGN ++ R  +  Q VL   W+ +K   S+L+G         C +   + R  +  +    +G    K L QSRHRG  E    G++   +   R G  K+   P +W+   EV + E        K   TRRSAG+P  + + L+    +S G + +    L+ L   CN     N+ +     P VH LN+++ +  +  L   +       +   +  +SS  W VRN++  LF  +++R+    K    +      T  E F+ +P L+  +L+ L+ + I  +S S      L P+L  L  +L         G S    L+ F PL+     S V   R + A+ ++
Sbjct: 1030 ICNPGDGNGEAYR--VTSQMVLVCCWRTMKEV-SMLLGHLCHSMPLCCPLTHPDGRGVITEDQVEGVGMYFRKQLLQSRHRGAFELAYVGFVRLTEMLCRSGSAKLQQLPAHWM--KEV-LEEVKSSDPSSKLCATRRSAGIPFYIQALLSSEPKSSCGLLKMTMRSLMALAMPCN-----NETSDSSSVPQVHALNILRALFRDTRLGENIVPFVSEGMQAAILGYSSPVWAVRNSSTLLFSTLITRIFGVKKDKDEHSKKNRMTGREFFTRFPALYPFLLSQLQEATISVNSDS--GQVKLHPSLFLLLVVLGRLYPSPMDGSSSPLGLAPFIPLIISCGRSAVYRTREMSARALV 1374          
BLAST of DUF2428 domain-containing protein vs. Ensembl Zebrafish
Match: thada (THADA armadillo repeat containing [Source:ZFIN;Acc:ZDB-GENE-050320-49])

HSP 1 Score: 67.0106 bits (162), Expect = 1.730e-10
Identity = 91/358 (25.42%), Postives = 153/358 (42.74%), Query Frame = 1
Query: 2383 VANKDDGN-QSIRLGIEYQHVLSWTWQVIKNTTSILVGW--------CQVVVKEIRSPLFRE----IGGILLKILCQSRHRGTIE-CVAGYL---QTYIRLG--KMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSV-LPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNP-----TFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLL----TSPVVVVRHLGAKCII 3369
            + N  DGN ++ R  +  Q VL   W+ +K   S+L+G         C +   + R  +  +    +G    K L QSRHRG  E    G++   +   R G  K+   P +W+   EV + E        K   TRRSAG+P  + + L+    +S G + +    L+ L   CN     N+ +     P VH LN+++ +  +  L   +       +   +  +SS  W VRN++  LF  +++R+    K    +      T  E F+ +P L+  +L+ L+ + I  +S S      L P+L  L  +L         G S    L+ F PL+     S V   R + A+ ++
Sbjct:  145 ICNPGDGNGEAYR--VTSQMVLVCCWRTMKEV-SMLLGHLCHSMPLCCPLTHPDGRGVITEDQVEGVGMYFRKQLLQSRHRGAFELAYVGFVRLTEMLCRSGSAKLQQLPAHWM--KEV-LEEVKSSDPSSKLCATRRSAGIPFYIQALLSSEPKSSCGLLKMTMRSLMALAMPCN-----NETSDSSSVPQVHALNILRALFRDTRLGENIVPFVSEGMQAAILGYSSPVWAVRNSSTLLFSTLITRIFGVKKDKDEHSKKNRMTGREFFTRFPALYPFLLSQLQEATISVNSDS--GQVKLHPSLFLLLVVLGRLYPSPMDGSSSPLGLAPFIPLIISCGRSAVYRTREMSARALV 489          
BLAST of DUF2428 domain-containing protein vs. Ensembl Zebrafish
Match: thada (THADA armadillo repeat containing [Source:ZFIN;Acc:ZDB-GENE-050320-49])

HSP 1 Score: 67.0106 bits (162), Expect = 1.784e-10
Identity = 91/358 (25.42%), Postives = 153/358 (42.74%), Query Frame = 1
Query: 2383 VANKDDGN-QSIRLGIEYQHVLSWTWQVIKNTTSILVGW--------CQVVVKEIRSPLFRE----IGGILLKILCQSRHRGTIECV-AGYL---QTYIRLG--KMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSV-LPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNP-----TFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLL----TSPVVVVRHLGAKCII 3369
            + N  DGN ++ R  +  Q VL   W+ +K   S+L+G         C +   + R  +  +    +G    K L QSRHRG  E    G++   +   R G  K+   P +W+   EV + E        K   TRRSAG+P  + + L+    +S G + +    L+ L   CN     N+ +     P VH LN+++ +  +  L   +       +   +  +SS  W VRN++  LF  +++R+    K    +      T  E F+ +P L+  +L+ L+ + I  +S S      L P+L  L  +L         G S    L+ F PL+     S V   R + A+ ++
Sbjct:  137 ICNPGDGNGEAYR--VTSQMVLVCCWRTMKEV-SMLLGHLCHSMPLCCPLTHPDGRGVITEDQVEGVGMYFRKQLLQSRHRGAFELAYVGFVRLTEMLCRSGSAKLQQLPAHWM--KEV-LEEVKSSDPSSKLCATRRSAGIPFYIQALLSSEPKSSCGLLKMTMRSLMALAMPCN-----NETSDSSSVPQVHALNILRALFRDTRLGENIVPFVSEGMQAAILGYSSPVWAVRNSSTLLFSTLITRIFGVKKDKDEHSKKNRMTGREFFTRFPALYPFLLSQLQEATISVNSDS--GQVKLHPSLFLLLVVLGRLYPSPMDGSSSPLGLAPFIPLIISCGRSAVYRTREMSARALV 481          
BLAST of DUF2428 domain-containing protein vs. Ensembl Xenopus
Match: pxn (paxillin [Source:Xenbase;Acc:XB-GENE-941407])

HSP 1 Score: 73.1738 bits (178), Expect = 4.011e-12
Identity = 75/303 (24.75%), Postives = 124/303 (40.92%), Query Frame = 1
Query: 2377 NSVANKDDGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQ--VVVKEIRSPL-------FREIGGILLKILCQSRHRGTIE-CVAGYLQ-TYIRLG----KMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNP-----TFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPT 3225
            NS+  +  G++     +  Q VL   W+ +K  + +L   CQ   ++ E  SP         +E+G      L QSRHRG  E    G+ + T + +G     +   P  WL +    + E        K   TRRSAG+P  + + L     NS    L    + QL+ L     +A+        P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF  +++R+    +G          T  E FS +P L+  +L   +L  + D   S      L P+
Sbjct:  968 NSLCTEMKGSEGSSCSVTAQMVLVCCWRSMKEVSLLLGMLCQNLPLMTEPDSPRGLITVEQVKEMGEYFKHHLLQSRHRGAFELAYVGFAKLTEMLIGCKEESLRRLPGQWLCS---VLEEIKSSDPSSKLCATRRSAGIPFYIQALLASEPKNSKAGFL-KMTMKQLISLAMPESDASGDKSTI--PQVHALNILRALFRDTRLGENVIPYVAEGTQAAILGFTSPIWAVRNSSTLLFSTLITRIFGVKRGKDERSKKNRMTGREFFSRFPALYPFLLE--QLEVVADTVDSPTGESKLHPS 1262          
BLAST of DUF2428 domain-containing protein vs. Ensembl Xenopus
Match: pxn (paxillin [Source:Xenbase;Acc:XB-GENE-941407])

HSP 1 Score: 73.1738 bits (178), Expect = 4.196e-12
Identity = 75/303 (24.75%), Postives = 124/303 (40.92%), Query Frame = 1
Query: 2377 NSVANKDDGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQ--VVVKEIRSPL-------FREIGGILLKILCQSRHRGTIE-CVAGYLQ-TYIRLG----KMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNP-----TFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPT 3225
            NS+  +  G++     +  Q VL   W+ +K  + +L   CQ   ++ E  SP         +E+G      L QSRHRG  E    G+ + T + +G     +   P  WL +    + E        K   TRRSAG+P  + + L     NS    L    + QL+ L     +A+        P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF  +++R+    +G          T  E FS +P L+  +L   +L  + D   S      L P+
Sbjct:  922 NSLCTEMKGSEGSSCSVTAQMVLVCCWRSMKEVSLLLGMLCQNLPLMTEPDSPRGLITVEQVKEMGEYFKHHLLQSRHRGAFELAYVGFAKLTEMLIGCKEESLRRLPGQWLCS---VLEEIKSSDPSSKLCATRRSAGIPFYIQALLASEPKNSKAGFL-KMTMKQLISLAMPESDASGDKSTI--PQVHALNILRALFRDTRLGENVIPYVAEGTQAAILGFTSPIWAVRNSSTLLFSTLITRIFGVKRGKDERSKKNRMTGREFFSRFPALYPFLLE--QLEVVADTVDSPTGESKLHPS 1216          
BLAST of DUF2428 domain-containing protein vs. Ensembl Xenopus
Match: pxn (paxillin [Source:Xenbase;Acc:XB-GENE-941407])

HSP 1 Score: 73.1738 bits (178), Expect = 4.722e-12
Identity = 75/303 (24.75%), Postives = 124/303 (40.92%), Query Frame = 1
Query: 2377 NSVANKDDGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQ--VVVKEIRSPL-------FREIGGILLKILCQSRHRGTIECV-AGYLQ-TYIRLG----KMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNP-----TFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPT 3225
            NS+  +  G++     +  Q VL   W+ +K  + +L   CQ   ++ E  SP         +E+G      L QSRHRG  E    G+ + T + +G     +   P  WL +    + E        K   TRRSAG+P  + + L     NS    L    + QL+ L     +A+        P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF  +++R+    +G          T  E FS +P L+  +L   +L  + D   S      L P+
Sbjct: 1021 NSLCTEMKGSEGSSCSVTAQMVLVCCWRSMKEVSLLLGMLCQNLPLMTEPDSPRGLITVEQVKEMGEYFKHHLLQSRHRGAFELAYVGFAKLTEMLIGCKEESLRRLPGQWLCS---VLEEIKSSDPSSKLCATRRSAGIPFYIQALLASEPKNSKAGFL-KMTMKQLISLAMPESDASGDKSTI--PQVHALNILRALFRDTRLGENVIPYVAEGTQAAILGFTSPIWAVRNSSTLLFSTLITRIFGVKRGKDERSKKNRMTGREFFSRFPALYPFLLE--QLEVVADTVDSPTGESKLHPS 1315          
BLAST of DUF2428 domain-containing protein vs. Ensembl Xenopus
Match: pxn (paxillin [Source:Xenbase;Acc:XB-GENE-941407])

HSP 1 Score: 72.7886 bits (177), Expect = 4.986e-12
Identity = 75/303 (24.75%), Postives = 124/303 (40.92%), Query Frame = 1
Query: 2377 NSVANKDDGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQ--VVVKEIRSPL-------FREIGGILLKILCQSRHRGTIECV-AGYLQ-TYIRLG----KMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNP-----TFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPT 3225
            NS+  +  G++     +  Q VL   W+ +K  + +L   CQ   ++ E  SP         +E+G      L QSRHRG  E    G+ + T + +G     +   P  WL +    + E        K   TRRSAG+P  + + L     NS    L    + QL+ L     +A+        P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF  +++R+    +G          T  E FS +P L+  +L   +L  + D   S      L P+
Sbjct:  975 NSLCTEMKGSEGSSCSVTAQMVLVCCWRSMKEVSLLLGMLCQNLPLMTEPDSPRGLITVEQVKEMGEYFKHHLLQSRHRGAFELAYVGFAKLTEMLIGCKEESLRRLPGQWLCS---VLEEIKSSDPSSKLCATRRSAGIPFYIQALLASEPKNSKAGFL-KMTMKQLISLAMPESDASGDKSTI--PQVHALNILRALFRDTRLGENVIPYVAEGTQAAILGFTSPIWAVRNSSTLLFSTLITRIFGVKRGKDERSKKNRMTGREFFSRFPALYPFLLE--QLEVVADTVDSPTGESKLHPS 1269          
BLAST of DUF2428 domain-containing protein vs. Ensembl Xenopus
Match: pxn (paxillin [Source:Xenbase;Acc:XB-GENE-941407])

HSP 1 Score: 72.7886 bits (177), Expect = 5.369e-12
Identity = 75/303 (24.75%), Postives = 124/303 (40.92%), Query Frame = 1
Query: 2377 NSVANKDDGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQ--VVVKEIRSPL-------FREIGGILLKILCQSRHRGTIE-CVAGYLQ-TYIRLG----KMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNP-----TFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPT 3225
            NS+  +  G++     +  Q VL   W+ +K  + +L   CQ   ++ E  SP         +E+G      L QSRHRG  E    G+ + T + +G     +   P  WL +    + E        K   TRRSAG+P  + + L     NS    L    + QL+ L     +A+        P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF  +++R+    +G          T  E FS +P L+  +L   +L  + D   S      L P+
Sbjct:  983 NSLCTEMKGSEGSSCSVTAQMVLVCCWRSMKEVSLLLGMLCQNLPLMTEPDSPRGLITVEQVKEMGEYFKHHLLQSRHRGAFELAYVGFAKLTEMLIGCKEESLRRLPGQWLCS---VLEEIKSSDPSSKLCATRRSAGIPFYIQALLASEPKNSKAGFL-KMTMKQLISLAMPESDASGDKSTI--PQVHALNILRALFRDTRLGENVIPYVAEGTQAAILGFTSPIWAVRNSSTLLFSTLITRIFGVKRGKDERSKKNRMTGREFFSRFPALYPFLLE--QLEVVADTVDSPTGESKLHPS 1277          
BLAST of DUF2428 domain-containing protein vs. Ensembl Mouse
Match: Thada (thyroid adenoma associated [Source:MGI Symbol;Acc:MGI:3039623])

HSP 1 Score: 68.1662 bits (165), Expect = 1.162e-10
Identity = 81/317 (25.55%), Postives = 136/317 (42.90%), Query Frame = 1
Query: 2536 REIGGILLKILCQSRHRGTIECV-AGYLQTYIRLGK-----MNGYPNNWLTADEVAINECIEGA-ARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKG-----VASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLL----TSPVVVVRHLGAKCII----------------NSLPNSS 3390
            +EIG    + L QSRHRG  E    G+++    L +     +   P  WL +    + E I+G+    K   TRRSAG+P  + + L      S   +L     I + +L +   +A+D  G    P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF ++++RV    +G       +  T  E FS +PEL+  +L  L+      DS+    ++   P +  L  +L         G S +  L+ F P +     SP+   R + A+ ++                NSLPNS+
Sbjct: 1081 KEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEILNRCSNVSLQKLPEQWLRS----VLEEIKGSDPSSKLCATRRSAGIPFYIQALLASEPKKSRMDLLK----ITMRELISLALSADDSKGRV--PQVHALNILRALFRDTRLGENIIPYVAGGAKAAILGFTSPVWAVRNSSTLLFSSLITRVFGVKRGKDEVSKTNRMTGREFFSRFPELYPFLLKQLETVASTVDSELGEPDRH--PGMFLLLLVLERLYPSPMDGTSSALSLAPFVPFIIRCGRSPIYRSREMAARALVPFIMIDQIPSTLCALLNSLPNST 1385          
BLAST of DUF2428 domain-containing protein vs. UniProt/SwissProt
Match: sp|O60081|YQK7_SCHPO (Uncharacterized protein C1494.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1494.07 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.009e-13
Identity = 94/386 (24.35%), Postives = 165/386 (42.75%), Query Frame = 1
Query: 2434 QHVLSWTWQVIKNTTS---ILVGWCQVVVKEIRSPL-FREIGGILLKILCQSRHRGTI----ECVAGYLQTYIRLGK--MNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATK-----GVASNPTFSE--VFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLS-DLLSCFWPLL----TSPVVVVRHLGA---KCIINSLPNSSYAFDIIQSNTYLVPQLTKPASNWSNISYNQQQGELFLLNLIL 3516
            Q +LS++W+ +K T+S   +L+  C  +  E  +P      G +++  L + RHRG       C   Y        K  ++  P+ WL  +   I E      +  + ITRRS G+PL + + L    D      L  + +I L+ +  +     ++ G  D P VH +N +K + +   L      +    I ++++ FS   W +RN ++ LF A+++R   + K      + +N   S    FS +P L + +L  L++S +   S +   +  L P L   S L Y+     P G       LS F PL+     S +  VR + +    C++          D  +  T++V QL   A     +  N+  G+L  +  +L
Sbjct:  672 QLILSYSWRSLKETSSLLTVLLTKCLSLFDEEFTPFTLNYYGELMMTWLWEIRHRGAFTSVYPCFIEYCSFLFECNKHEISELPDPWLHKNLSVIQE------KSSF-ITRRSGGIPLSITAILVAGKDKREQ--LIEQTVISLISIAKQPVEQKNIAGQFDLPQVHAMNTLKTIFTEHRLSSVSVEYLEPAIALSIEGFSHELWPIRNCSVMLFTALINRAFGSKKPKDAVNLGNNKGLSTKMFFSKFPTLHDYLLRELEVS-VASLSSNDQPSTGLYPILNMFSRLQYAQ----PYGNENEWTGLSQFEPLIFKCTASRICKVREIASLSLTCLL----------DCSKMTTFIVSQLKGVA----GLQQNEIHGKLLTIRAVL 1029          
BLAST of DUF2428 domain-containing protein vs. UniProt/SwissProt
Match: sp|A8C756|THADA_MOUSE (Thyroid adenoma-associated protein homolog OS=Mus musculus OX=10090 GN=Thada PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.128e-10
Identity = 81/317 (25.55%), Postives = 136/317 (42.90%), Query Frame = 1
Query: 2536 REIGGILLKILCQSRHRGTIECV-AGYLQTYIRLGK-----MNGYPNNWLTADEVAINECIEGA-ARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKG-----VASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLL----TSPVVVVRHLGAKCII----------------NSLPNSS 3390
            +EIG    + L QSRHRG  E    G+++    L +     +   P  WL +    + E I+G+    K   TRRSAG+P  + + L      S   +L     I + +L +   +A+D  G    P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF ++++RV    +G       +  T  E FS +PEL+  +L  L+      DS+    ++   P +  L  +L         G S +  L+ F P +     SP+   R + A+ ++                NSLPNS+
Sbjct: 1081 KEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEILNRCSNVSLQKLPEQWLRS----VLEEIKGSDPSSKLCATRRSAGIPFYIQALLASEPKKSRMDLLK----ITMRELISLALSADDSKGRV--PQVHALNILRALFRDTRLGENIIPYVAGGAKAAILGFTSPVWAVRNSSTLLFSSLITRVFGVKRGKDEVSKTNRMTGREFFSRFPELYPFLLKQLETVASTVDSELGEPDRH--PGMFLLLLVLERLYPSPMDGTSSALSLAPFVPFIIRCGRSPIYRSREMAARALVPFIMIDQIPSTLCALLNSLPNST 1385          
BLAST of DUF2428 domain-containing protein vs. UniProt/SwissProt
Match: sp|A8C754|THADA_CHICK (Thyroid adenoma-associated protein homolog OS=Gallus gallus OX=9031 GN=THADA PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.515e-9
Identity = 61/222 (27.48%), Postives = 93/222 (41.89%), Query Frame = 1
Query: 2536 REIGGILLKILCQSRHRGTIECV-AGYLQTYIRLGKMNG-----YPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNP-----TFSEVFSLYPELWNPILNILKL 3168
            + IG      L QSRHRG  E   AG++Q    L + N       P  WL      I  C   +       TRRSAG+P  +  AL  S        L    + +LM L +              P VH LN+++ +  +  L   +  +    I   +  F+S  W VRN++  LF A+++R+    +G   N      T +E FS +P L+  +L  L++
Sbjct: 1082 KNIGDYFKHHLMQSRHRGAFELAYAGFVQLTETLSRCNSESLRKMPEQWLRCVLEEIKSCDPSST---LCATRRSAGIPFYI-QALLASEPKKGKMDLLKMTIKELMSLASPSSEPPSA-----IPQVHALNILRALFRDTRLGENIMPYVADGIQAAILGFTSPIWAVRNSSTLLFSALITRIFGVKRGKDENSKKNRMTGAEFFSRFPSLYPFLLKQLEV 1294          
BLAST of DUF2428 domain-containing protein vs. UniProt/SwissProt
Match: sp|A8C750|THADA_CANLF (Thyroid adenoma-associated protein homolog OS=Canis lupus familiaris OX=9615 GN=THADA PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.267e-8
Identity = 58/223 (26.01%), Postives = 97/223 (43.50%), Query Frame = 1
Query: 2536 REIGGILLKILCQSRHRGTIE-CVAGYLQTYIRLGK-----MNGYPNNWL--TADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKG-----VASNPTFSEVFSLYPELWNPILNILK 3165
            +EIG    + L QSRHRG  E    G+++    L +     +   P  WL    +E+  ++        K   TRRSAG+P  +  AL  S        L    + +L+ L    D++         P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF  +++R+    +G       +  T SE FS +PEL+  +L  L+
Sbjct: 1087 KEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEILNRCPNVSLQKLPEQWLWNVLEEIKCSD-----PSSKLCATRRSAGIPFYI-QALLASEPKKGKMDLLKITMKELISLAGPTDDSQSTV-----PQVHALNILRALFRDTRLGENIIPYVADGAKAAILGFTSPVWAVRNSSTLLFSTLITRIFGVKRGKDELSKKNRMTGSEFFSRFPELYPFLLQQLE 1298          
BLAST of DUF2428 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6YHU6|THADA_HUMAN (Thyroid adenoma-associated protein OS=Homo sapiens OX=9606 GN=THADA PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.410e-8
Identity = 74/304 (24.34%), Postives = 125/304 (41.12%), Query Frame = 1
Query: 2536 REIGGILLKILCQSRHRGTIE-CVAGYLQTYIRLGK-----MNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRV-----ASATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLT----SPVVVVRHLGAKCI-----INSLPNS 3387
            +EIG    + L QSRHRG  E    G+++    L +     +   P  WL +    + E        K   TRRSAG+P  + + L          +L     I + +L +     +D+      P VH LN+++ +  +  L   +  +        +  F+S  W VRN++  LF A+++R+     A       +  T  E FS +PEL+  +L  L+      DS     N+   P++  L  +L         G S +  +  F P +     SPV   R + A+ +     I+ +PN+
Sbjct: 1090 KEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEVLNRCPNVSLQKLPEQWLWS---VLEEIKCSDPSSKLCATRRSAGIPFYIQALLASEPKKGRMDLLK----ITMKELISLAGPTDDIQSTV--PQVHALNILRALFRDTRLGENIIPYVADGAKAAILGFTSPVWAVRNSSTLLFSALITRIFGVKRAKDEHSKTNRMTGREFFSRFPELYPFLLKQLETVANTVDSDMGEPNRH--PSMFLLLLVLERLYASPMDGTSSALSMGPFVPFIMRCGHSPVYHSREMAARALVPFVMIDHIPNT 1382          
BLAST of DUF2428 domain-containing protein vs. TrEMBL
Match: A0A267H6E1 (DUF2428 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012852g3 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.564e-32
Identity = 191/806 (23.70%), Postives = 326/806 (40.45%), Query Frame = 1
Query: 1225 LWHSKDQIRIASYKFVCDNYSQQINQLPFMNLSNIIDVFVNNLTSDSPGFRNHMISATRRLYICIRDATVSYLAD---SKALLESISILNEKLSHLFND-----RVVH--LESIN-----------------------------WVEEM--------KNVGGSLNHDIALLIIFSRLVYGNQWMYTSLNYQRQRSIIDLITIIREVLIDSNFIIDKKCGFANKTIIALRDFYRITREAYFSD------TKSFIQNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRK-EIKLNDLWNETQILCHSNQPIQLN-AGALFCSFLSHCDYQTDNSITIDDFLVDFLEHLASIDMSSVLIMSLKTPGYGYLMSIDLLL--------RQNLKKSILHSERIPLAALKVVKLMMQTMGCEDHGRIIDFTYCLADRDFLFSQDLA-SFHKMGITMNSVANKD-----DGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQVVVKEIRSPL----FREIGGILLKILCQSRHRGTIECVAGYLQTYIRL----GKMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDL-----CNKLDNANDVNGW--CDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLT---SPVVVVRHLGAKCIINSLP 3381
            L H  +Q R A+ + +C +     +  P  +L  I++ F  N+ SD P FR  +++  R +   ++D  +  L +     A      +   K++  + D     R+VH  L  I+                               EE         K    +L  ++ LL  F R +  +   +    YQRQR+ I+ + I       S+  + K+ G+ ++ +  + +F R     + +        +  +  ++ +      D+Q+S+  +L   Y      +     L+ L       CHS    Q + AG +    L++       +  +  + +D +    +   +     + +  G+GYL++  L L        R    +  L +E   L    ++  +M  MG        +    +AD    +S D A SF ++G  +   A  D     D     RL   YQ +L+W W+ +     +LV  C   ++   + +     R +G  L  ++  SRHRGTIE VA  L+ + +L     ++   P   + A  VA+           YS+TRRSAGLPL+L S L+          L +  + +L+        +K    ++  G    D P VH LNL++ +    AL     RH   I   TL +FS  +W VRNA +QL  A+  R+    +    + T +E FS YP L    L +L +      S  F+ +Q  VP L+FLS L  S D   P    L ++     PL+T   SPV  +R + AK +++  P
Sbjct:  381 LIHCDEQTRAAALEVLCLSNKPTCHITP-QSLKMILEFFCLNMNSDQPPFRQRLLACFRSVCQQVKDGCIQALPELSTRLAAEPPAELAASKVAEEYGDGGGASRLVHCLLPDISVATRIAQFDAIVSSAAVIGANSGDKTDSASAEEFLVFEDDPSKTSPDALLSNVKLLAQFVRQLLDSDVWFPGACYQRQRTCIEYLQIACTHYFGSSSGMKKR-GYPSEVLDKVTEFLREAFRRFGAPMDGPEAAERVVGRLLRSALHCSRDIQDSMLGLLTEHYPMARLPQAGPASLDRLLPLLLRRCHSPDAEQFHGAGRVLAYLLANSAVHVGGAEPLR-YCLDAVAAALAKAKAEPAAAASECTGHGYLLAAGLYLSRGGGEVNRGPDVQRQLFNEATALC-FDLIASLMSVMGFRGG--GGEGGGEVAD----WSADAAPSFEELGRAIEKAAGVDADLDEDLLSGARLSPHYQRILAWAWRNLAMAADLLVQLCAAHLRAADADIDLDGVRRVGRRLAAVVTGSRHRGTIEAVANSLREFCQLIRWRQELADLPGELVNAPLVAMET-------ASYSVTRRSAGLPLLLTSVLSAVCAGQWSEPLLDRTVARLLRCVESATADKATAEDEAGGSDKVDSPKVHALNLLRAVVREAALYNATTRHHEAITRATLTNFSDRSWAVRNACVQLLGALSQRMLGVGR---PHITPTEFFSAYPRLQRCFLEVL-VRGANPSSAKFIAHQATVPVLSFLSQL--SPD---PPTALLDNVEPFRQPLVTLLSSPVYAIRLMAAKSLVSFAP 1160          
BLAST of DUF2428 domain-containing protein vs. TrEMBL
Match: A0A267DK84 (DUF2428 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019077g3 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 4.199e-32
Identity = 192/805 (23.85%), Postives = 323/805 (40.12%), Query Frame = 1
Query: 1225 LWHSKDQIRIASYKFVCDNYSQQINQLPFMNLSNIIDVFVNNLTSDSPGFRNHMISATRRLYICIRDATVSYLADSKALLESISILN----------------EKLSH-LFND-----RVVHLESI---------------NWVEEM--------KNVGGSLNHDIALLIIFSRLVYGNQWMYTSLNYQRQRSIIDLITIIREVLIDSNFIIDKKCGFANKTIIALRDFYRITREAYFSD------TKSFIQNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRK-EIKLNDLWNETQILCHSNQPIQLN-AGALFCSFLSHCDYQTDNSITIDDFLVDFLEHLASIDMSSVLIMSLKTPGYGYLMSIDLLL--------RQNLKKSILHSERIPLAALKVVKLMMQTMGCEDHGRIIDFTYCLADRDFLFSQDLA-SFHKMGITMNSVANKD-----DGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWC----QVVVKEIRSPLFREIGGILLKILCQSRHRGTIECVAGYLQTYIRL----GKMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLM--------DLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLT---SPVVVVRHLGAKCIINSLP 3381
            L H  +Q R A+ + +C +     +  P  +L  I++ F  N+ SD P FR  +++  R +   ++D  +  L +    L +                      +L H L  D     R+   ++I               +  EE         K    +L  ++ LL  F   +  +   +    YQRQR+ I+ + I       S+  + K+ G+ ++ +  + +F R     + +        +  +  ++ +      D+Q+S+  +L   Y      +     L+ L       CHS    Q + AG +    L++       +  +  + +D +    +   +     + +  G+GYL++  L L        R    +  L +E   L    ++  +M  MG        +    +AD    +S D A SF ++G  +   A  D     D     RL   YQ +L+W W+ +     +LV  C    +V   +I     R +G  L  ++  SRHRGTIE VA  L+ + +L     ++   P   + A  VA+           YS+TRRSAGLPL+L S L+          L +  + +L+        D     D A   +   D P VH LNL++ +    AL     RH   I   TL +FS  +W VRNA +QL  A+  R+    +    + T +E FS YP L    L +L +      S  F+ +Q  VP L+FLS L  S D   P    L ++     PL+T   SPV  +R + AK +++  P
Sbjct:  382 LIHCDEQTRAAALEVLCLSNKPTCHITP-QSLKMILEFFCLNMNSDQPPFRQRLLACFRSVCQQVKDGCIQALPELSTRLAAEPPAELAAAEGAEEYDDGGGASRLVHCLLPDISVATRIAQFDAIVSSAAVIGANSGDKTDSAEEFLVFEDDPSKTSPDALLSNVKLLAQFVHQLLDSDVWFPGACYQRQRTCIEYLQIACTHYFGSSSGMKKR-GYPSEVLDKVTEFLREAFRRFGAPMDGPEAAERVVGRLLRSALHCSRDIQDSMLGLLTEHYPMARLPQTGPASLDRLLPLLLRRCHSPDAEQFHGAGRVLAYLLANSAVDVGGAEPLR-YCLDAVAAALAKAKAEPAAAASECTGHGYLLAAGLYLSRGGGEVNRGPAVQRQLFNEATALC-FDLITSLMSVMGFR---GGGEGGGEVAD----WSADAAPSFEELGRAIEKAAGVDADLDEDLLSGARLSPHYQRILAWAWRNLAMAADLLVQLCAAHLRVADADIDLDGVRRVGRRLAAVVTGSRHRGTIEAVANSLREFCQLIRWRQELADLPGELVNAPLVAMET-------ASYSVTRRSAGLPLLLTSVLSAVCAGQWSEPLLDRTVARLLRCVESTTADKATAEDEAEGGSDKVDSPKVHALNLLRAVVREAALYNATTRHHEAITRATLTNFSDRSWAVRNACVQLLGALSQRMLGVGR---PHITPTEFFSAYPRLQRCFLEVL-VRGANPSSAKFIAHQATVPVLSFLSQL--SPD---PPTALLDNVEPFRQPLVTLLSSPVYAIRLMAAKSLVSFAP 1159          
BLAST of DUF2428 domain-containing protein vs. TrEMBL
Match: A0A267DFB9 (DUF2428 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021906g5 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 5.425e-32
Identity = 188/804 (23.38%), Postives = 325/804 (40.42%), Query Frame = 1
Query: 1225 LWHSKDQIRIASYKFVCDNYSQQINQLPFMNLSNIIDVFVNNLTSDSPGFRNHMISATRRLYICIRDATVSY---LADSKALLESISILNEKLSHLFND-----RVVHL-----------------------------ESINWVEEM--------KNVGGSLNHDIALLIIFSRLVYGNQWMYTSLNYQRQRSIIDLITIIREVLIDSNFIIDKKCGFANKTIIALRDFYRITREAYFSD------TKSFIQNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRK-EIKLNDLWNETQILCHSNQPIQLN-AGALFCSFLSHCDYQTDNSITIDDFLVDFLEHLASIDMSSVLIMSLKTPGYGYLMSIDLLL--------RQNLKKSILHSERIPLAALKVVKLMMQTMGCEDHGRIIDFTYCLADRDFLFSQDLA-SFHKMGITMNSVANKD-----DGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQVVVKEIRSPL----FREIGGILLKILCQSRHRGTIECVAGYLQTYIRL----GKMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDL-----CNKLDNANDVNGW--CDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLT---SPVVVVRHLGAKCIINSLP 3381
            L H  +Q R A+ + +C +     +  P  +L  I++ F  N+ SD P FR  +++  R +   ++D  +     L+   A      +   + +  ++D     R+VH                              +  +  EE         K    +L  ++ LL  F R +  +   +    YQRQR+ I+ + I       S+  + K+ G+ ++ +  + +F R     + +        +  +  ++ +      D+Q+S+  +L   Y      +     L+ L       CHS    Q + AG +    L++       +  +  + +D +    +   +     + +  G+GYL++  L L        R    +  L +E   L    ++  +M  MG        +    +AD    +S D A SF ++G  +   A  D     D     RL   YQ +L+W W+ +     +LV  C   ++   + +     R +G  L  ++  SRHRGTIE VA  L+ + +L     ++   P   + A  VA+           YS+TRRSAGLPL+L S L+          L +  + +L+        +K    ++  G    D P VH LNL++ +    AL     RH   I   TL +FS  +W VRNA +QL  A+  R+    +    + T +E FS YP L    L +L +      S  F+ +Q  VP L+FLS L  S D   P    L ++     PL+T   SPV  +R + AK +++  P
Sbjct:  382 LIHCDEQTRAAALEVLCLSNKPTCHITP-QSLKMILEFFCLNMNSDQPPFRQRLLACFRSVCQQVKDGCIQALPELSTRLAAEPPAELAAAEGAEEYDDGGGASRLVHCLLPDISVATRIAQFDAIVSSAAVIGANSGDKTDSAEEFLVFEDDPSKTSPDALLSNVKLLAQFVRQLLDSDVWFPGACYQRQRTCIEYLQIACTHYFGSSSGMKKR-GYPSEVLDKVTEFLREAFRRFGAPMDGPEAAERVVGRLLRSALHCSRDIQDSMLGLLTEHYPMARLPQAGPASLDRLLPLLLRRCHSPDAEQFHGAGRVLAYLLANSAVHVGGAEPLR-YCLDAVAAALAKAKAEPAAAASECTGHGYLLAAGLYLSRGGGEVNRGPDVQRQLFNEATALC-FDLIASLMSVMGFRGG--GGEGGGEVAD----WSADAAPSFEELGRAIEKAAGVDADLDEDLLSGARLSPHYQRILAWAWRNLAMAADLLVQLCAAHLRAADADIDLDGVRRVGRRLAAVVTGSRHRGTIEAVANSLREFCQLIRWRQELADLPGELVNAPLVAMET-------ASYSVTRRSAGLPLLLTSVLSAVCAGQWSEPLLDRTVARLLRCVESATADKATAEDEAKGSDKVDSPKVHALNLLRAVVREAALYNATTRHHEAITRATLTNFSDRSWAVRNACVQLLGALSQRMLGVGR---PHITPTEFFSAYPRLQRCFLEVL-VRGANPSSAKFIAHQATVPVLSFLSQL--SPD---PPTALLDNVEPFRQPLVTLLSSPVYAIRLMAAKSLVSFAP 1159          
BLAST of DUF2428 domain-containing protein vs. TrEMBL
Match: A0A267DWS4 (DUF2428 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021906g3 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 5.012e-29
Identity = 114/374 (30.48%), Postives = 171/374 (45.72%), Query Frame = 1
Query: 2332 FSQDLA-SFHKMGITMNSVANKD-----DGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQVVVKEIRSPL----FREIGGILLKILCQSRHRGTIECVAGYLQTYIRL----GKMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMD-----LCNKLDNANDVNG--WCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLT---SPVVVVRHLGAKCIINSLP 3381
            +S D A SF ++G  +   A  D     D     RL   YQ +L+W W+ +     +LV  C   ++   + +     R +G  L  ++  SRHRGTIE VA  L+ + +L     ++   P   + A  VA+           YS+TRRSAGLPL+L S L+          L +  + +L+        +K    ++  G    D P VH LNL++ +    AL     RH   I   TL +FS  +W VRNA +QL  A+  R+    +    + T +E FS YP L    L +L +      S  F+ +Q  VP L+FLS L  S D   P    L ++     PL+T   SPV  +R + AK +++  P
Sbjct:  211 WSADAAPSFEELGRAIEKAAGVDADLDEDLLSGARLSPHYQRILAWAWRNLAMAADLLVQLCAAHLRAADADIDLDGVRRVGRRLAAVVTGSRHRGTIEAVANSLREFCQLIRWRQELADLPGELVNAPLVAMET-------ASYSVTRRSAGLPLLLTSVLSAVCAGQWSEPLLDRTVARLLRCVESATADKATAEDEAKGSDKVDSPKVHALNLLRAVVREAALYNATTRHHEAITRATLTNFSDRSWAVRNACVQLLGALSQRMLGVGR---PHITPTEFFSAYPRLQRCFLEVL-VRGANPSSAKFIAHQATVPVLSFLSQL--SPD---PPTALLDNVEPFRQPLVTLLSSPVYAIRLMAAKSLVSFAP 568          
BLAST of DUF2428 domain-containing protein vs. TrEMBL
Match: A0A3R7GZT1 (DUF2428 domain-containing protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=CSKR_8987s PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 6.345e-26
Identity = 185/766 (24.15%), Postives = 327/766 (42.69%), Query Frame = 1
Query: 1123 LRDHRLFMWLTSFAIIYSENKII--NEEQAGIINHCLWHSKDQIRIASY-------KFVCDNYSQ-QINQLPFMNLSNIIDVF-------VNNLTSDSPGFRNHMISATRRLYICIRDATVSYLADS-KALLESIS------ILNEKLSHLFNDRVVHLESI-NWVEEMKNVGGSLNHDIALLIIFSRL----------------VYGNQWMYTSLNYQRQRSIIDLITIIREVL----IDSNFIIDKKCGFANKTIIALRDFYRITREAYFSDTKS--FIQNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRKEIKLNDLWNETQILCHSNQPIQLNAGA-LFCSFLSH-CDYQTDNSITIDDFLVDFLEHLASIDM-SSVLIMSLKTPGYGYLMSIDLLLRQNL------KKSILHSERIPLAALKVVKLMMQTMGCEDHGRIIDFTYCLADRDFLFSQDLASFHKMGITMNSVA-------------------NKDDGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQVVVKEIRSPLFR----EIGGILLKILCQSRHRGTIECVAGYLQTYIRLGKMNGYPNN--WLTADEVAINECIEGAARGKYSITRRSAGLPLILMSAL--NGSNDNSSGSVLPNECLIQLMDLC----NKLDNANDVNGWCDPPIVHYLNLMKQM-CSN---PALQ-VPLQRHFGRII----LITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNPTFSEVFSLYP 3132
            LR HR F+WL  F +   +  ++   E+   ++N  L+H+ D +R  ++       + V  N +Q  ++    +   +   +F       +N   S  P  R +++++  +L   IR+A VS   +S  +    +S      +L   L+ LF      L  I   V  ++    S+N    L+  FS L                ++     +  + YQR +  ++L+  I  +L     +S+     + G+ + +++ +R         +  D KS   + ++++++++ K D+Q+ L  ++  T++D S V  + +   L       C S   ++ +AG  L   + +H C    +     ++     L  L+  ++   +L ++   PG GYL+++D L    L      K S+++S  +    L++  L + TMGC+        T    D      +  +SF ++G ++  VA                   + ++G   IRL  EYQH+LSW+W  ++ + SIL  W  V+      P  R    +IG  L+ IL   RHRGT+E V   LQ Y+   +     NN   L + E  ++ C        YS+TRR+AGL   + +AL    +  +    V     L QL+DL     ++           D P    L+L++ + C +   P LQ VP   +   +I       L  FS S+W V NA LQL  A++ R+     G A  PT  E+F  YP
Sbjct:  385 LRYHRHFLWLHFFNLHGDKLSLLASKEDLTPLVNG-LFHADDYLRAVAFSGLVNLARAVLTNPNQLHVDSARVLTHPDSCTMFFLLGIILLNG--STHPVARKYLVTSFNQLLRVIRNACVSVDVESVTSFPRRLSWAPNSVLLETSLTDLFQCIQSGLSDILPSVPALQRKTISVNWLCCLVQFFSPLWGKLPSFEFSDEVPSPLHHQNAFWPGMTYQRMKVNVELMYTIIGLLNLNESESDVYGQWRTGYTSASLLNIRRLVEKLACDFCWDYKSPAMLHSLLDSLRLLKPDLQSQLLDLVSMTWHDISSVLTDDQCATLLASALRWCDSFNVVEYSAGGNLLLYWYTHGCAKTVELQEAFNEAFHRKLVSLSGAELHGQLLTIAKDEPGLGYLVALDQLFATLLPNHTLAKNSLINSVELVELCLRLSNLCLTTMGCDPWSPSARET----DVASKPQKGASSFRELGESILRVALGEQAGKVRPAGGQQGVGSDSENGMDLIRLLPEYQHILSWSWNSLRYSASILSRWA-VLHANDAEPHVRNLCTQIGYQLVHILLHCRHRGTVEAVCVSLQHYLSTAQRLQETNNSISLVSCEQVLDLCWTVLCHYGYSVTRRAAGLWPAVKAALLAEQARKDQRVPVFLIRWLTQLIDLARHNPSESHTGTTTEEMTDSPRALALHLLRGIFCDSRLRPHLQPVPEMIYSNFLIQALEFAVLPTFSDSDWTVSNAGLQLHSALVLRLTGTNSGRAP-PTSIEIFGKYP 1141          
BLAST of DUF2428 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000012404.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000027.1:248023:283669:1 gene:ENSAMXG00000012066.2 transcript:ENSAMXT00000012404.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 2.986e-15
Identity = 99/423 (23.40%), Postives = 187/423 (44.21%), Query Frame = 1
Query: 2350 SFHKMGITMNSVANK---------DDGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQVV--VKEIRSPLF--REIGG---ILLKILCQSRHRGTIE-CVAGYLQTYIRLGKMNGYPNNWLTADEVAINECIEG----AARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNAN-----DVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVAS--------ATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLTSPVVVVRHLGAKCIINSLPNSSYAFDIIQSNTYLVPQLTKPASNWSNISYNQQQGELFLLNLIL 3516
            SF  MG  ++S+  +         ++G++++ L  E+  VL+  W  +K     L    + +  V    +PL   +++ G   +   I+ + RH G +E C  G+ +       + G P+  L   E+      +G     +    S+TRR+AGLP++++  L    ++SS  +L        + +   L+ A      D +   D P V  ++ ++ +    +L + + ++   + +++L   SS  W +RNAALQL+ ++ SR+          + +   S P F   FS YP L   +   L+ +           + +L P LT L+ L   A +Q     +LS  L     L  SPV  VR + ++ ++  +P + Y   +++    +V  L  P S  S   +N+  G+L  +N +L
Sbjct:  920 SFCDMGNAISSLIGQSGAGEAGLDEEGDENVLLSEEHSLVLTCCWVTLKEIGIFLGSLVERILSVSCKNTPLLTVKDLHGASRVFKDIILKCRHWGAVEGCCIGFTKF---CAALLGSPDPELR--EIPSRMLQQGLTVLQSPRATSVTRRAAGLPMLILGVLAAEENSSSRPLLA-------LSVNTLLETARTPLPPDWDQTLDLPQVCAVHTLQTLVKGSSLGLSILQYAPAVAMLSLTLLSSPCWAMRNAALQLYSSLCSRMLGQRPAGEDVSAQYAMSPPAF---FSHYPALQPFLQEALERAAADLHESRLSLHPSLYPVLTLLAKLQPGAQEQT---RALSAFLHPLLQLAASPVYAVRVMSSRALVAMIPPAEYLASVVR----MVGDL--PESPESPCRHNRVHGQLLQINTVL 1318          
BLAST of DUF2428 domain-containing protein vs. Ensembl Nematostella
Match: EDO39110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB36])

HSP 1 Score: 57.3806 bits (137), Expect = 4.983e-8
Identity = 67/291 (23.02%), Postives = 119/291 (40.89%), Query Frame = 1
Query: 2434 QHVLSWTWQVIKNTTSILVGWCQVVVKE---IRSPLFREIGGILLKILCQSRHRGTIE-CVAGYLQT-----YIRLGKMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNP-----TFSEVFSLYPELWNPIL--NILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSA 3258
            Q +L   W+ +K    +L    Q +  +   + +   + IG     +L  S+HRG  E    G+++        R   + G P  WL      I+  +        S TRRSAG+P  +      S  +     L +      + +   L   + +      P VH  N+++ +  +  L   +       ++ ++  F+SS+W VRN++  LF A+++RV    K    +      T  E FS YP + +P L  ++ K +   +  +S   +  L P L  LS L  S+
Sbjct:  624 QALLVCCWRTMKEVALLLGDLVQNISDDSGLLTADQVKRIGDFFTAVLLTSKHRGAFELAYTGFMKLCEVLWRCRDADLRGLPLAWLDGLMSDISTTVPS---DFLSGTRRSAGVPFFVQVVKQSSPASLCSLCLLDLLHAASLPVEPSLPQDSSL------PQVHSRNIIRALYRDTRLGEDVSPFVADGLIASISGFTSSSWAVRNSSTLLFSALVTRVFGVAKAKDDHSRRNCMTGREFFSRYPSM-HPFLLKHLEKATEFLNREESVTLHPCLYPVLVLLSRLYPSS 904          
BLAST of DUF2428 domain-containing protein vs. Ensembl Nematostella
Match: EDO32266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVK6])

HSP 1 Score: 50.447 bits (119), Expect = 6.963e-6
Identity = 99/548 (18.07%), Postives = 232/548 (42.34%), Query Frame = 1
Query:  244 ELYTSNQNFLIIILNGIIDYQTCFDNESLFKNSEFLNLTNSKLGLFYYLLPKVLDNDFKQYYHLILLIKKAWQITEKASSANLYSVNFHMIEKIVRVFVPLLDSSITGLTVLISELFHAVIKWAVINRDNSHTAAEICELFSNEILN--EFFPFSVEHSKASYPLCKINLRFLKIIIQTFGIDFTLDKLPFLFDYLFQTIAINHTATISGDIFSASLKQVGFFLKKEN---QDNIMKKVENFIIHGCNEFWFECSSKELQCLNFATFVIPSCVKNCFDPMIKINEKIRKVLLESQSNELRDHRLFMWL----TSFAIIYSENKIINEEQAGI----------INHCLWHSKDQIRIASYKFVCDNYSQQINQLPFMNLSNII--DVFVNNLTSDSPGFRNHMISATRRLYICIRDATVSYLADSKALLESISILNEKLSHLFNDRV------VHLESINWVEEMKNVGGSLNHDIALLIIFSRLVYGNQWMYTSLNYQRQRSIIDLITIIREVLIDSNFIIDKKCGFA---NKTIIAL---RDFYRIT 1788
            +L   ++ FL+ +L  I+ Y+ C               TN K+ + +YL  +VL + F         IK+  +      +  L+S++  +  +++ +    L+  + G++V   ++F  +++   +   +++T     E + + +    E  P+   H K  Y L       L  ++   G+   ++  P + D + Q ++ N  +  S ++   +L  +   L+KE+   +    +K +N ++          S + +   +   + +P  +++C D +  I +++      ++ + +   RL  +L    T+ ++  ++ +++     GI          +   L H +D+IR  +   +C  +       P   L + +     ++NL   +P FR  +    R++   +RD+             S+S+L +    LFN +       V ++  + V++   + G ++      +    LV G+        YQRQ++ ++LI ++ +   D+ +  DKK G     +KT+++L   ++F+ +T
Sbjct:  281 DLKAVSETFLVGVLFDIV-YKLC---------------TNEKVPVVHYLAFEVLKDWFS-------YIKRHAKSLFNEDAPVLFSIDSSITSQVLTLVWGSLEDPVEGVSVSSRQVFKLLLEVHYMEH-HANTPRPRKEFYQSLVTRVVEGVPW---HVKTKYGL-------LCDLLPYIGLQKFMEDQPRVLDEMVQCLSTNQLSAASTELLK-TLLLMSRVLQKESDLFKVAFERKWQNLLLQSLT------SDQRMSEQHARVYWLPCALRSCPDSLTNILQQLSC----NEDSTMNTPRLLAYLCVLKTARSLGIAQTQVMTVRSLGIAQMQVMDESMLRSALSHGQDEIRSEALGVICSTHK---TAEPLSTLEDRLLRGFLLHNLNIANPAFRQDVSVGLRKILTRVRDS-------------SLSLLRKSCPKLFNKKTPSGCAHVPIDVPSDVQQALQLVGWISG-----LSVRSLVPGS-------GYQRQKTCLELIAVLLQTF-DAEWDPDKKKGRPPEISKTLVSLAKTKNFFNLT 754          
BLAST of DUF2428 domain-containing protein vs. Ensembl Medaka
Match: si:ch211-225b11.4 (thyroid adenoma-associated protein homolog [Source:NCBI gene;Acc:105354731])

HSP 1 Score: 70.0922 bits (170), Expect = 2.207e-11
Identity = 106/424 (25.00%), Postives = 177/424 (41.75%), Query Frame = 1
Query: 2350 SFHKMGITMNSVANKDDGNQS------IRLGIEYQHVLSWTWQVIKNTTSILVGWCQVVVKEIRS--------PLFREIGGILLKILCQSRHRGTIE-CVAGYLQTYIRL-----GKMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNK--LDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRV---------ASATKGVASNPTF-SEVFSLYPELWNPILNILK-LSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLTSPVVVVRHLGAKCIINSLPNSSYAFDIIQSNTYLVPQLTKPASNWSNISYNQQQGELFLLNLILEK 3522
            SF+ M   ++S+ ++  G++       I L  E++ VL+  W  +K     L    +    E +         P    +  +   IL   RH G IE C  G+ +    L      ++   P   LT   + + +C   A     S+TRR+AGLP++++S L  + D S    L    +  LMD      LDN +      D P V  ++ ++ +     L   +++    I +++L   SS+ W +RNAALQL+ ++  R+         + A +   + P F      L P L   +    K L     ++K  ++  +L P LT L+ L  +       G+ L D       L  SP+  VR + +K ++   P S +   ++Q    L  QL  P       S+NQ  G L  +  ILEK
Sbjct:  948 SFYDMSDAISSLISQQCGSEQTDEEDCILLSEEHRLVLTCCWVSLKEIGIFLGTLVEKGFTESKQSGEHNLLKPHLSRVSKVFKNILLNCRHWGAIEGCCVGFTKFCSCLLSCSDPELKEIPAQMLTQG-LQVVQCPRSA-----SVTRRAAGLPMLILSIL-AAEDASKARPLLALSVQTLMDTARTPVLDNWDQT---LDLPQVCAVHTLQALVRAAPLAAAVRQFASGITVLSLTLLSSTCWAMRNAALQLYSSLCFRMLGQKSGNEESGAVQHGMTPPAFLFHYRQLQPFLLGELTRAAKGLRGPSAEAKLHLQP-SLFPILTLLAQLQPAVTDT--SGVFL-DFSHPLLQLSASPIYSVRVMASKALVAMTPTSEHMNILLQ----LTAQLPGPQ---DICSHNQLHGRLLQIKAILEK 1350          
BLAST of DUF2428 domain-containing protein vs. Planmine SMEST
Match: SMESG000032327.1 (SMESG000032327.1)

HSP 1 Score: 3127.42 bits (8107), Expect = 0.000e+0
Identity = 1568/1594 (98.37%), Postives = 1569/1594 (98.43%), Query Frame = 1
Query:   13 MENILKDWQNISDKEMQNKLQILNDKIIKYRLLDVQVDIDAMLELINTNDISFNNKLRFGVSLFLSVAVFNYPYTISELYTSNQNFLIIILNGIIDYQTCFDNESLFKNSEFLNLTNSKLGLFYYLLPKVLDNDFKQYYHLILLIKKAWQITEKASSANLYSVNFHMIEKIVRVFVPLLDSSITGLTVLISELFHAVIKWAVINRDNSHTAAEICELFSNEILNEFFPFSVEHSKASYPLCKINLRFLKIIIQTFGIDFTLDKLPFLFDYLFQTIAINHTATISGDIFSASLKQVGFFLKKENQDNIMKKVENFIIHGCNEFWFECSSKELQCLNFATFVIPSCVKNCFDPMIKINEKIRKVLLESQSNELRDHRLFMWLTSFAIIYSENKIINEEQAGIINHCLWHSKDQIRIASYKFVCDNYSQQINQLPFMNLSNIIDVFVNNLTSDSPGFRNHMISATRRLYICIRDATVSYLADSKALLESISILNEKLSHLFNDRVVHLESINWVEEMKNVGGSLNHDIALLIIFSRLVYGNQWMYTSLNYQRQRSIIDLITIIREVLIDSNFIIDKKCGFANKTIIALRDFYRITREAYFSDTKSFIQNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRKEIKLNDLWNETQILCHSNQPIQLNAGALFCSFLSHCDYQTDNSITIDDFLVDFLEHLASIDMSSVLIMSLKTPGYGYLMSIDLLLRQNLKKSILHSERIPLAALKVVKLMMQTMGCEDHGRIIDFTYCLADRDFLFSQDLASFHKMGITMNSVANKDDGNQSIRLGIEYQHVLSWTWQVIKNTTSILVGWCQVVVKEIRSPLFREIGGILLKILCQSRHRGTIECVAGYLQTYIRLGKMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLTSPVVVVRHLGAKCIINSLPNSSYAFDIIQSNTYLVPQLTKPASNWSNISYNQQQGELFLLNLILEKIHFRFFLSIETLIEYAKILKQKRCWILLDSVVLIFIKIDIPQSYRLAIGXXXXXXXXXILNSSSIGIGRLNALISIIKLIATISTDTKIIGRILSNVNHADVLQRIIFDFNTHTKINIIISKIFAQDNIKLLLESLYNSLTDYQSHYTPYVIQIFCNVLNNQSNLTIPKNYPIKTLIDLLHXXXXXXXXXXXXEAVLVSCQQILNWLFSKIDIDLEEIYHDQWINQIEQNIDCQSLESTRMSTAKNIDSILNSLFFDKLISKFSNRFAVVITFGCFDECKSIRDIFRAILYKMISQHNDGCCNLLRQSDLIGFYQVLSEKSLFSKKSILINILSVVIRNEKEFFYYVRQNKIKDVLYEPVPGNIFVELSMILEIIYRELRNEVLIEHEVSGLLELLPKDLSDDEIIVNSTGSFLYWADNFIKNL 4794
            MENILKDWQNISDKEMQNKLQILNDKIIKYRLLDVQVDIDAMLELINTNDISFNNKLRFGVSLFLSVAVFNYPYTISELYTSNQNFLIIILNGIIDYQTCFDNESLFKNSEFLNLTNSKL LFYYLLPKVLDNDFKQYYHLILLIKKAWQITEKASSANLYSVNFHMIEKIVRVFVPLLDSSITGLTVLISELFHAVIKWAVINRDNSHTAAEICELFSNEILNEFFPFSVEHSKASYPLCKINLRFLKIIIQTFGIDFTLDKLPFLFDYLFQTIAINHTATISGDIFSASLKQVGFFLKKENQDNIMKKVENFIIHGCNEFWFECSSKELQCLNFATFVIPSCVKNCFDPMIKINEKIRKVLLESQSNELRDHRLFMWLTSFAIIY ENKIINEEQAGIINHCLWHSKDQIRIASYKFVCDNYSQQINQLPFMNLSNIIDVFVNNLTSDSPGFRNHMISATRRLYICIRDATVSYLADSKALLESISILNEKLSHLFNDRVVHLESINWVEEMKNVGGSLNHDIALLIIFSRLVYGNQWMYTSLNYQRQRSIIDLITIIREVLIDSNFIIDKKCGFANKTIIALRDFYRITREAYFSDTKSFIQNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRKEIKLNDLWNETQILCHSNQPIQLNAGALFCSFLSHCDYQTDNSITIDDFLVDFLEHLASIDMSSVLIMSLKTPGYGYLMSIDLLLRQNLKKSILHSERIPLAALKVVKLMMQTMGCEDH                   DLASFHKMGITMNSVANKDDGNQSIRLGIEYQHVLSWTWQVIKN TSILVGWCQVVVKEIRSPLFREIGGILLKILCQSRHRGTIECVAGYLQTYIRLGKMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNL+KQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLTSPVVVVRHLGAKCIINSLPNSSYAFDIIQSNTYLVPQLTKPASNWSNISYNQQQGELFLLNLILEKIHFRFFLSIETLIEYAKILKQKRCWILLDSVVLIFIKIDIPQSYRLAIGEFFEETFEEILNSSSIGIGRLNALISIIKLIATISTDTKIIGRILSNVNHADVLQRIIFDFNTHTKINIIISKIFAQDNIKLLLESLYNSL DYQSHYTPYVIQIFCNVLNNQSNLTIPKNYPIKTLIDLLHKITSKSTSIAISEAVLVSCQQILNWLFSKIDIDLEE YHDQWINQIEQNIDCQSLESTRMSTAKNIDSILNSLFFDKLISKFSNRFAVVITFGCFDECKSIRDIFRAILYKMISQHNDGCCNLLRQSDLIGFYQVLSEKSLFSKKSILINILSVVIRNEKEFFYYVRQ KIKDVLYEPVPGNIFVELSMILEIIYRELRNEVLIEHEVSGLLELLPKDLSDDEIIVNSTGSFLYWADNFIKNL
Sbjct:    1 MENILKDWQNISDKEMQNKLQILNDKIIKYRLLDVQVDIDAMLELINTNDISFNNKLRFGVSLFLSVAVFNYPYTISELYTSNQNFLIIILNGIIDYQTCFDNESLFKNSEFLNLTNSKLDLFYYLLPKVLDNDFKQYYHLILLIKKAWQITEKASSANLYSVNFHMIEKIVRVFVPLLDSSITGLTVLISELFHAVIKWAVINRDNSHTAAEICELFSNEILNEFFPFSVEHSKASYPLCKINLRFLKIIIQTFGIDFTLDKLPFLFDYLFQTIAINHTATISGDIFSASLKQVGFFLKKENQDNIMKKVENFIIHGCNEFWFECSSKELQCLNFATFVIPSCVKNCFDPMIKINEKIRKVLLESQSNELRDHRLFMWLTSFAIIYPENKIINEEQAGIINHCLWHSKDQIRIASYKFVCDNYSQQINQLPFMNLSNIIDVFVNNLTSDSPGFRNHMISATRRLYICIRDATVSYLADSKALLESISILNEKLSHLFNDRVVHLESINWVEEMKNVGGSLNHDIALLIIFSRLVYGNQWMYTSLNYQRQRSIIDLITIIREVLIDSNFIIDKKCGFANKTIIALRDFYRITREAYFSDTKSFIQNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRKEIKLNDLWNETQILCHSNQPIQLNAGALFCSFLSHCDYQTDNSITIDDFLVDFLEHLASIDMSSVLIMSLKTPGYGYLMSIDLLLRQNLKKSILHSERIPLAALKVVKLMMQTMGCEDH-------------------DLASFHKMGITMNSVANKDDGNQSIRLGIEYQHVLSWTWQVIKNATSILVGWCQVVVKEIRSPLFREIGGILLKILCQSRHRGTIECVAGYLQTYIRLGKMNGYPNNWLTADEVAINECIEGAARGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDNANDVNGWCDPPIVHYLNLVKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNPTFSEVFSLYPELWNPILNILKLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLTSPVVVVRHLGAKCIINSLPNSSYAFDIIQSNTYLVPQLTKPASNWSNISYNQQQGELFLLNLILEKIHFRFFLSIETLIEYAKILKQKRCWILLDSVVLIFIKIDIPQSYRLAIGEFFEETFEEILNSSSIGIGRLNALISIIKLIATISTDTKIIGRILSNVNHADVLQRIIFDFNTHTKINIIISKIFAQDNIKLLLESLYNSLIDYQSHYTPYVIQIFCNVLNNQSNLTIPKNYPIKTLIDLLHKITSKSTSIAISEAVLVSCQQILNWLFSKIDIDLEEFYHDQWINQIEQNIDCQSLESTRMSTAKNIDSILNSLFFDKLISKFSNRFAVVITFGCFDECKSIRDIFRAILYKMISQHNDGCCNLLRQSDLIGFYQVLSEKSLFSKKSILINILSVVIRNEKEFFYYVRQKKIKDVLYEPVPGNIFVELSMILEIIYRELRNEVLIEHEVSGLLELLPKDLSDDEIIVNSTGSFLYWADNFIKNL 1575          
BLAST of DUF2428 domain-containing protein vs. Planmine SMEST
Match: SMESG000023235.1 (SMESG000023235.1)

HSP 1 Score: 51.6026 bits (122), Expect = 6.092e-6
Identity = 58/215 (26.98%), Postives = 96/215 (44.65%), Query Frame = 1
Query: 2731 TRRSAGLP---LILMSALNGSNDNSSGSVLPNECLIQLMDLCNK-LDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNPTFSEV-----FSLYPELWNPILNILKLSCIKDDSKSFVKNQTLV-PTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLTSPVVVVR 3345
            TRRSAGLP   L+L+++    N   S        L   MD  N  L  AN  N      I+H  N+ + +    +L   L  H    +  +++ FSS+ W +RN+A  L+ A++ R+   +K +  +  F+ +     F+ Y  ++  I+N +K  C  D S   + + T + P L  L  L+   D        L+ +       L+S V V+R
Sbjct:  828 TRRSAGLPHLFLVLITSEPLVNKQRSS-------LNFAMDQLNSILVKANSQNSADQKRIIHIFNISRLLFKESSLLTQLINHTFSAVKYSVQFFSSNIWPLRNSATLLYCALIERIFGPSKTIKFHNKFNRLNSKVFFNRYQNMYEFIVNTIK-EC--DKSPLNLNSSTRIYPILVILGRLVPELDHFNSSSYDLTFVKHKIQRYLSSSVWVIR 1032          
BLAST of DUF2428 domain-containing protein vs. Planmine SMEST
Match: SMESG000023235.1 (SMESG000023235.1)

HSP 1 Score: 51.2174 bits (121), Expect = 8.861e-6
Identity = 58/215 (26.98%), Postives = 96/215 (44.65%), Query Frame = 1
Query: 2731 TRRSAGLP---LILMSALNGSNDNSSGSVLPNECLIQLMDLCNK-LDNANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSSNWGVRNAALQLFMAMLSRVASATKGVASNPTFSEV-----FSLYPELWNPILNILKLSCIKDDSKSFVKNQTLV-PTLTFLSNLLYSADKQLPQGMSLSDLLSCFWPLLTSPVVVVR 3345
            TRRSAGLP   L+L+++    N   S        L   MD  N  L  AN  N      I+H  N+ + +    +L   L  H    +  +++ FSS+ W +RN+A  L+ A++ R+   +K +  +  F+ +     F+ Y  ++  I+N +K  C  D S   + + T + P L  L  L+   D        L+ +       L+S V V+R
Sbjct:  402 TRRSAGLPHLFLVLITSEPLVNKQRSS-------LNFAMDQLNSILVKANSQNSADQKRIIHIFNISRLLFKESSLLTQLINHTFSAVKYSVQFFSSNIWPLRNSATLLYCALIERIFGPSKTIKFHNKFNRLNSKVFFNRYQNMYEFIVNTIK-EC--DKSPLNLNSSTRIYPILVILGRLVPELDHFNSSSYDLTFVKHKIQRYLSSSVWVIR 606          
The following BLAST results are available for this feature:
BLAST of DUF2428 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
THADA9.183e-924.34THADA armadillo repeat containing [Source:HGNC Sym... [more]
THADA9.183e-924.34THADA armadillo repeat containing [Source:HGNC Sym... [more]
THADA9.663e-725.00THADA armadillo repeat containing [Source:HGNC Sym... [more]
back to top
BLAST of DUF2428 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y92H12A.54.135e-1122.38pep chromosome:WBcel235:I:1491340:1514411:-1 gene:... [more]
Y92H12A.54.208e-1122.38pep chromosome:WBcel235:I:1490887:1514411:-1 gene:... [more]
back to top
BLAST of DUF2428 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG33681.317e-1023.17gene:FBgn0039508 transcript:FBtr0085163[more]
THADA3.604e-724.31gene:FBgn0031077 transcript:FBtr0289978[more]
back to top
BLAST of DUF2428 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch211-225b11.41.025e-1722.31si:ch211-225b11.4 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
thada1.652e-1025.42THADA armadillo repeat containing [Source:ZFIN;Acc... [more]
thada1.730e-1025.42THADA armadillo repeat containing [Source:ZFIN;Acc... [more]
thada1.784e-1025.42THADA armadillo repeat containing [Source:ZFIN;Acc... [more]
back to top
BLAST of DUF2428 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxn4.011e-1224.75paxillin [Source:Xenbase;Acc:XB-GENE-941407][more]
pxn4.196e-1224.75paxillin [Source:Xenbase;Acc:XB-GENE-941407][more]
pxn4.722e-1224.75paxillin [Source:Xenbase;Acc:XB-GENE-941407][more]
pxn4.986e-1224.75paxillin [Source:Xenbase;Acc:XB-GENE-941407][more]
pxn5.369e-1224.75paxillin [Source:Xenbase;Acc:XB-GENE-941407][more]
back to top
BLAST of DUF2428 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Thada1.162e-1025.55thyroid adenoma associated [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of DUF2428 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60081|YQK7_SCHPO5.009e-1324.35Uncharacterized protein C1494.07 OS=Schizosaccharo... [more]
sp|A8C756|THADA_MOUSE8.128e-1025.55Thyroid adenoma-associated protein homolog OS=Mus ... [more]
sp|A8C754|THADA_CHICK1.515e-927.48Thyroid adenoma-associated protein homolog OS=Gall... [more]
sp|A8C750|THADA_CANLF1.267e-826.01Thyroid adenoma-associated protein homolog OS=Cani... [more]
sp|Q6YHU6|THADA_HUMAN4.410e-824.34Thyroid adenoma-associated protein OS=Homo sapiens... [more]
back to top
BLAST of DUF2428 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H6E11.564e-3223.70DUF2428 domain-containing protein OS=Macrostomum l... [more]
A0A267DK844.199e-3223.85DUF2428 domain-containing protein OS=Macrostomum l... [more]
A0A267DFB95.425e-3223.38DUF2428 domain-containing protein OS=Macrostomum l... [more]
A0A267DWS45.012e-2930.48DUF2428 domain-containing protein OS=Macrostomum l... [more]
A0A3R7GZT16.345e-2624.15DUF2428 domain-containing protein (Fragment) OS=Cl... [more]
back to top
BLAST of DUF2428 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000012404.22.986e-1523.40pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of DUF2428 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF2428 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF2428 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO391104.983e-823.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322666.963e-618.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DUF2428 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-225b11.42.207e-1125.00thyroid adenoma-associated protein homolog [Source... [more]
back to top
BLAST of DUF2428 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000032327.10.000e+098.37SMESG000032327.1[more]
SMESG000023235.16.092e-626.98SMESG000023235.1[more]
SMESG000023235.18.861e-626.98SMESG000023235.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004455 ID=SMED30004455|Name=DUF2428 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4825bp
GTAATATCTTAAATGGAAAACATATTAAAGGATTGGCAAAATATCTCTGA
TAAAGAAATGCAAAATAAACTTCAAATATTAAATGATAAAATTATTAAAT
ATAGATTGTTAGATGTTCAAGTAGATATTGATGCAATGCTAGAACTTATT
AATACAAATGACATTTCGTTTAACAATAAACTTCGATTTGGTGTTTCATT
ATTCCTATCTGTTGCAGTTTTTAATTACCCCTATACCATATCAGAATTGT
ATACATCAAATCAAAACTTTTTAATCATCATACTTAACGGCATTATTGAT
TATCAGACGTGTTTCGATAATGAGTCTTTATTCAAGAATTCTGAATTTCT
TAATTTGACAAATTCCAAATTGGGTTTATTTTATTATCTTTTACCAAAAG
TTTTGGATAATGATTTTAAACAATATTATCATTTAATTTTGTTGATTAAA
AAAGCATGGCAGATAACAGAAAAGGCTTCAAGTGCTAATCTATATTCAGT
TAACTTTCATATGATAGAGAAAATTGTGCGAGTATTTGTGCCACTCCTTG
ATAGTAGCATTACGGGCTTAACCGTTCTTATAAGTGAACTATTTCACGCT
GTGATTAAATGGGCAGTAATTAATAGAGATAACTCTCATACAGCAGCAGA
AATTTGTGAATTATTTTCAAACGAAATTCTCAATGAATTCTTTCCGTTTT
CAGTTGAGCACTCGAAAGCGTCATATCCGTTGTGTAAAATTAATTTACGA
TTCCTGAAAATCATTATTCAAACTTTTGGAATTGACTTCACTCTCGACAA
GTTGCCATTTCTGTTTGACTATTTATTCCAAACGATTGCCATTAACCATA
CCGCTACAATATCTGGAGATATTTTCTCTGCTTCATTGAAGCAAGTCGGA
TTCTTTTTAAAGAAAGAAAATCAAGATAATATCATGAAAAAGGTTGAAAA
TTTCATTATCCATGGATGCAATGAGTTCTGGTTTGAATGCAGTTCAAAAG
AATTGCAATGTTTGAATTTTGCAACTTTTGTAATTCCAAGCTGTGTGAAA
AATTGCTTTGATCCTATGATAAAAATTAATGAAAAAATCCGGAAGGTATT
GTTGGAATCGCAATCGAATGAACTTAGAGATCACCGTTTATTCATGTGGC
TTACTTCTTTCGCGATTATCTACTCAGAAAATAAAATCATTAATGAAGAA
CAAGCTGGCATCATCAATCACTGCCTGTGGCATTCAAAAGATCAAATACG
CATCGCTTCGTATAAATTTGTTTGCGATAATTATTCACAACAAATAAATC
AGTTGCCGTTTATGAATTTATCAAATATTATCGATGTTTTTGTCAACAAT
TTGACGAGTGACAGCCCAGGCTTTCGTAACCACATGATATCAGCCACCAG
GCGATTATACATTTGCATAAGAGATGCTACAGTTTCCTATTTAGCAGATA
GTAAAGCTTTATTAGAAAGCATTTCCATATTGAATGAAAAATTAAGTCAC
TTGTTTAATGATCGTGTTGTTCACCTGGAATCTATTAACTGGGTTGAAGA
AATGAAGAACGTTGGAGGTTCTCTAAATCACGATATAGCTCTCTTGATAA
TTTTCAGTCGACTTGTGTATGGGAATCAATGGATGTACACATCCCTGAAT
TATCAACGACAAAGATCGATAATCGATCTTATCACAATTATTCGGGAAGT
GCTTATTGATTCTAATTTCATTATTGACAAAAAATGTGGATTCGCAAATA
AAACGATAATAGCGCTTAGGGATTTCTATCGTATTACAAGGGAGGCTTAT
TTTAGTGATACTAAGAGCTTCATTCAGAACATGATTAATGCTATTAAAGT
TGCTAAAGTTGATGTTCAAAATAGTCTTTTCAGTGTGCTGATATCGACAT
ATAACGATTTTTCCTGTGTTAGAAAGGAAATCAAATTGAACGATTTATGG
AATGAAACTCAAATTCTTTGTCATAGTAATCAACCGATTCAATTAAACGC
TGGAGCTTTGTTTTGTTCTTTTCTTTCCCATTGTGACTACCAAACAGACA
ATTCTATCACTATTGACGACTTTCTCGTAGATTTTCTGGAGCATTTGGCG
TCAATTGACATGAGTTCCGTGTTAATAATGAGTCTGAAAACTCCTGGCTA
TGGTTATCTAATGTCAATCGATTTACTTCTCAGGCAGAACTTAAAGAAAT
CTATTTTACACAGTGAAAGAATTCCCTTGGCTGCTTTGAAAGTGGTGAAA
TTAATGATGCAAACCATGGGCTGTGAAGATCATGGTAGGATTATTGATTT
TACTTATTGTCTCGCTGATAGGGATTTTTTATTTTCTCAAGATCTTGCTT
CATTCCACAAAATGGGAATTACTATGAATTCGGTCGCTAATAAAGACGAT
GGGAATCAGTCGATAAGGCTAGGCATCGAATATCAACATGTGCTCTCGTG
GACATGGCAGGTCATTAAAAACACAACGAGCATTCTCGTTGGATGGTGTC
AAGTTGTGGTTAAAGAAATCCGTTCTCCATTATTCAGAGAAATTGGAGGG
ATTTTATTGAAAATTCTGTGCCAGAGCCGACATAGAGGAACGATTGAGTG
TGTTGCCGGGTATTTGCAAACCTACATTAGGTTAGGGAAAATGAATGGAT
ATCCGAATAATTGGCTGACTGCCGATGAAGTTGCGATCAATGAATGCATT
GAAGGAGCAGCAAGAGGCAAATACTCGATCACTCGTCGCAGTGCTGGGCT
TCCGTTAATTTTAATGTCAGCTCTTAATGGATCCAATGATAATTCTAGCG
GATCCGTTTTGCCCAATGAGTGCTTGATTCAGTTAATGGACCTGTGCAAC
AAATTAGACAACGCCAATGATGTCAATGGTTGGTGTGATCCTCCGATTGT
CCACTATCTTAATCTCATGAAGCAAATGTGCAGTAATCCAGCACTTCAAG
TGCCCTTGCAACGCCATTTCGGGAGAATTATTCTCATAACTCTCAAACAT
TTCTCATCGTCGAATTGGGGTGTCAGAAATGCAGCTTTACAATTGTTTAT
GGCGATGCTTTCTCGTGTCGCATCTGCCACGAAAGGCGTTGCATCGAATC
CAACATTCTCCGAAGTCTTTTCTCTTTATCCCGAATTATGGAATCCAATT
TTAAACATACTCAAATTGAGTTGTATAAAGGATGATAGTAAATCTTTCGT
GAAAAATCAAACACTCGTTCCGACATTAACTTTCTTATCAAATCTCCTCT
ATTCTGCTGACAAACAATTACCTCAAGGAATGAGTCTCAGTGATCTTTTA
TCTTGCTTTTGGCCTCTTTTAACCAGTCCAGTTGTTGTCGTTAGACATTT
AGGAGCTAAATGCATAATTAATTCACTTCCTAATTCATCGTACGCATTTG
ACATCATCCAATCAAACACTTACCTTGTACCTCAATTAACCAAGCCGGCT
TCTAATTGGTCAAATATCTCTTATAACCAACAACAAGGAGAATTGTTTCT
TTTGAATTTGATTTTAGAAAAAATACACTTTCGCTTCTTTTTATCGATCG
AAACTTTAATCGAATATGCAAAAATTTTGAAACAGAAACGTTGTTGGATT
CTACTTGATTCGGTGGTTTTAATATTTATAAAAATCGATATTCCACAATC
ATATCGACTTGCAATTGGAGAATTTTTCGAAGAGACTTTCGAGGAAATTC
TTAACTCATCTTCAATCGGCATCGGTAGACTGAACGCGTTGATATCCATC
ATTAAATTGATAGCTACTATTTCTACTGACACAAAAATAATTGGACGGAT
TTTATCCAATGTCAATCACGCTGACGTCCTTCAACGTATTATTTTCGATT
TTAATACCCACACAAAAATCAATATTATTATTTCGAAAATATTTGCACAA
GATAATATTAAACTGTTATTGGAATCATTATATAATAGTTTAACCGATTA
TCAATCACATTATACACCGTATGTAATTCAAATATTCTGTAATGTGTTAA
ACAACCAATCAAACCTTACTATTCCTAAAAACTATCCAATCAAAACATTG
ATCGATCTGTTACATAAAATAACGTCTAAATCTACATCGATTGCAATATC
AGAAGCAGTGCTTGTATCTTGCCAACAAATTCTCAACTGGCTGTTCAGCA
AAATCGATATCGATCTTGAGGAAATCTATCATGACCAGTGGATAAATCAA
ATCGAACAAAATATCGATTGCCAATCACTTGAATCCACAAGAATGTCAAC
CGCAAAAAACATCGATTCGATATTGAATAGCTTGTTTTTCGATAAATTAA
TATCCAAATTTTCTAATCGATTTGCTGTTGTTATTACTTTTGGATGCTTC
GACGAATGTAAATCGATTCGAGATATTTTCAGAGCAATTCTCTATAAAAT
GATTTCCCAGCACAATGATGGTTGCTGTAATCTGTTACGGCAAAGCGATC
TGATCGGTTTCTATCAAGTTCTCAGTGAAAAATCGTTATTCTCCAAAAAG
TCGATATTGATCAATATATTGAGTGTTGTGATTAGAAATGAGAAGGAATT
TTTTTACTACGTTAGACAAAACAAAATCAAAGATGTTCTCTATGAACCAG
TTCCAGGAAATATCTTCGTGGAATTGTCGATGATTTTGGAGATTATTTAT
CGAGAGTTGAGGAATGAAGTTTTAATTGAGCACGAAGTTTCAGGCCTTCT
CGAATTGCTACCGAAAGATTTGTCTGATGACGAAATTATCGTGAATTCTA
CTGGATCTTTCTTGTATTGGGCGGATAATTTTATTAAAAATCTTTAATGT
ATTCCTATTGATATTAGAGAAATAA
back to top

protein sequence of SMED30004455-orf-1

>SMED30004455-orf-1 ID=SMED30004455-orf-1|Name=SMED30004455-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1595bp
MENILKDWQNISDKEMQNKLQILNDKIIKYRLLDVQVDIDAMLELINTND
ISFNNKLRFGVSLFLSVAVFNYPYTISELYTSNQNFLIIILNGIIDYQTC
FDNESLFKNSEFLNLTNSKLGLFYYLLPKVLDNDFKQYYHLILLIKKAWQ
ITEKASSANLYSVNFHMIEKIVRVFVPLLDSSITGLTVLISELFHAVIKW
AVINRDNSHTAAEICELFSNEILNEFFPFSVEHSKASYPLCKINLRFLKI
IIQTFGIDFTLDKLPFLFDYLFQTIAINHTATISGDIFSASLKQVGFFLK
KENQDNIMKKVENFIIHGCNEFWFECSSKELQCLNFATFVIPSCVKNCFD
PMIKINEKIRKVLLESQSNELRDHRLFMWLTSFAIIYSENKIINEEQAGI
INHCLWHSKDQIRIASYKFVCDNYSQQINQLPFMNLSNIIDVFVNNLTSD
SPGFRNHMISATRRLYICIRDATVSYLADSKALLESISILNEKLSHLFND
RVVHLESINWVEEMKNVGGSLNHDIALLIIFSRLVYGNQWMYTSLNYQRQ
RSIIDLITIIREVLIDSNFIIDKKCGFANKTIIALRDFYRITREAYFSDT
KSFIQNMINAIKVAKVDVQNSLFSVLISTYNDFSCVRKEIKLNDLWNETQ
ILCHSNQPIQLNAGALFCSFLSHCDYQTDNSITIDDFLVDFLEHLASIDM
SSVLIMSLKTPGYGYLMSIDLLLRQNLKKSILHSERIPLAALKVVKLMMQ
TMGCEDHGRIIDFTYCLADRDFLFSQDLASFHKMGITMNSVANKDDGNQS
IRLGIEYQHVLSWTWQVIKNTTSILVGWCQVVVKEIRSPLFREIGGILLK
ILCQSRHRGTIECVAGYLQTYIRLGKMNGYPNNWLTADEVAINECIEGAA
RGKYSITRRSAGLPLILMSALNGSNDNSSGSVLPNECLIQLMDLCNKLDN
ANDVNGWCDPPIVHYLNLMKQMCSNPALQVPLQRHFGRIILITLKHFSSS
NWGVRNAALQLFMAMLSRVASATKGVASNPTFSEVFSLYPELWNPILNIL
KLSCIKDDSKSFVKNQTLVPTLTFLSNLLYSADKQLPQGMSLSDLLSCFW
PLLTSPVVVVRHLGAKCIINSLPNSSYAFDIIQSNTYLVPQLTKPASNWS
NISYNQQQGELFLLNLILEKIHFRFFLSIETLIEYAKILKQKRCWILLDS
VVLIFIKIDIPQSYRLAIGEFFEETFEEILNSSSIGIGRLNALISIIKLI
ATISTDTKIIGRILSNVNHADVLQRIIFDFNTHTKINIIISKIFAQDNIK
LLLESLYNSLTDYQSHYTPYVIQIFCNVLNNQSNLTIPKNYPIKTLIDLL
HKITSKSTSIAISEAVLVSCQQILNWLFSKIDIDLEEIYHDQWINQIEQN
IDCQSLESTRMSTAKNIDSILNSLFFDKLISKFSNRFAVVITFGCFDECK
SIRDIFRAILYKMISQHNDGCCNLLRQSDLIGFYQVLSEKSLFSKKSILI
NILSVVIRNEKEFFYYVRQNKIKDVLYEPVPGNIFVELSMILEIIYRELR
NEVLIEHEVSGLLELLPKDLSDDEIIVNSTGSFLYWADNFIKNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR019442DUF2428_death-receptor-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019442Domain of unknown function DUF2428, death-receptor-likePFAMPF10350DUF2428coord: 792..1002
e-value: 2.5E-22
score: 79.4
NoneNo IPR availablePANTHERPTHR14387THADA/DEATH RECEPTOR INTERACTING PROTEINcoord: 215..1550
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 819..1503