Thioredoxin domain-containing protein 3-like

Overview
NameThioredoxin domain-containing protein 3-like
Smed IDSMED30004448
Uniprot Best hitThioredoxin domain-containing protein 3 homolog OS=Ciona intestinalis OX=7719 GN=CiIC3 PE=2 SV=1 (E=0)
Length (bp)2832
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thioredoxin domain-containing protein 3-like (SMED30004448) t-SNE clustered cells

Violin plots show distribution of expression levels for Thioredoxin domain-containing protein 3-like (SMED30004448) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thioredoxin domain-containing protein 3-like (SMED30004448) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thioredoxin domain-containing protein 3-like (SMED30004448) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004448

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004448SMESG000043677.1 SmedASXL_002659SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30004448SMESG000043677.1 SmedASXL_007848SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30004448SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004448SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004448SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004448SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30004448SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30004448SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004448SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004448SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004448SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004448SMESG000043677.1 dd_Smed_v6_8026_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30004448SMESG000043677.1 dd_Smed_v6_8401_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30004448SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30004448SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004448SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30004448SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30004448SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Match: NME8 (NME/NM23 family member 8 [Source:HGNC Symbol;Acc:HGNC:16473])

HSP 1 Score: 357.066 bits (915), Expect = 1.797e-111
Identity = 206/599 (34.39%), Postives = 340/599 (56.76%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIH-----------------------EFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            MA KK+E+ LQ  IN Q  WDE+++ +GL V+DVYQ WCGPC+A+   FR++KNE+ +D  L+FAVA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K+  GEM R +  +  L D  +D +V E +   E ++   ++A+IKPD V + KV EI  K+ + G  I A+    LT E+   FY  +AD   FE+ + F+ SG S ILV+++G     H                       E    + P  +    +N   S++       +       +D     + +  FFPDF        K ++  +++TLAL+RP  + E ++ +L  I +  FK+  Q++V L+++EA     +++++ +F +LI+ M+ G  LAL L + N +Q W+ +LGP+ VE+A E  P SL AQF+ + + VN ++GSDS ETAE E+++FFP++ T+  IKP    E  E+I   + +A F + ++K++ +     E+ Y   + ++++ DL+  +  GP+  M+L++ +A+  WR L+GP DP+ A+   PDSIRA +G    KN V+G+ N  E + V+N +F
Sbjct:    1 MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVD--SDSEVSE-ESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSK---HNPPSEETEPQTDTEPNERSEDQPEVEAQVTPGMM----KNKQDSLQEYLERQHLAQLCDIEEDAANVAKFMDAFFPDFK-------KMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLF 582          

HSP 2 Score: 78.1814 bits (191), Expect = 3.918e-14
Identity = 48/151 (31.79%), Postives = 84/151 (55.63%), Query Frame = 2
Query:  512 LEEIEREV--------TLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD 940
            LE  ERE+        TL LIKP      + ++I+  + E G ++   +   LT E+ ++ Y  +   + ++DL++ ++ GPS +++L K +A  + E+R L+GP   +EAK  SP SIRA +G + ++N +HGA +   A+  +   F D
Sbjct:  437 LETAEREIQHFFPLQSTLGLIKPHATSEQR-EQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNA--VAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFED 584          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Match: NME8 (NME/NM23 family member 8 [Source:HGNC Symbol;Acc:HGNC:16473])

HSP 1 Score: 357.066 bits (915), Expect = 1.797e-111
Identity = 206/599 (34.39%), Postives = 340/599 (56.76%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIH-----------------------EFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            MA KK+E+ LQ  IN Q  WDE+++ +GL V+DVYQ WCGPC+A+   FR++KNE+ +D  L+FAVA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K+  GEM R +  +  L D  +D +V E +   E ++   ++A+IKPD V + KV EI  K+ + G  I A+    LT E+   FY  +AD   FE+ + F+ SG S ILV+++G     H                       E    + P  +    +N   S++       +       +D     + +  FFPDF        K ++  +++TLAL+RP  + E ++ +L  I +  FK+  Q++V L+++EA     +++++ +F +LI+ M+ G  LAL L + N +Q W+ +LGP+ VE+A E  P SL AQF+ + + VN ++GSDS ETAE E+++FFP++ T+  IKP    E  E+I   + +A F + ++K++ +     E+ Y   + ++++ DL+  +  GP+  M+L++ +A+  WR L+GP DP+ A+   PDSIRA +G    KN V+G+ N  E + V+N +F
Sbjct:    1 MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVD--SDSEVSE-ESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSK---HNPPSEETEPQTDTEPNERSEDQPEVEAQVTPGMM----KNKQDSLQEYLERQHLAQLCDIEEDAANVAKFMDAFFPDFK-------KMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLF 582          

HSP 2 Score: 78.1814 bits (191), Expect = 3.918e-14
Identity = 48/151 (31.79%), Postives = 84/151 (55.63%), Query Frame = 2
Query:  512 LEEIEREV--------TLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD 940
            LE  ERE+        TL LIKP      + ++I+  + E G ++   +   LT E+ ++ Y  +   + ++DL++ ++ GPS +++L K +A  + E+R L+GP   +EAK  SP SIRA +G + ++N +HGA +   A+  +   F D
Sbjct:  437 LETAEREIQHFFPLQSTLGLIKPHATSEQR-EQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNA--VAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFED 584          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Match: NME9 (NME/NM23 family member 9 [Source:HGNC Symbol;Acc:HGNC:21343])

HSP 1 Score: 272.322 bits (695), Expect = 6.656e-83
Identity = 143/300 (47.67%), Postives = 194/300 (64.67%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEV-----DKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 943
            M  +K+EIALQ  I+TQE W+E++  +GL VVDVYQ WCGPCK V++ F++++ E+G D L+FA+A+AD +D LEKYRG+CEP FL Y G  LV V+RGAN P+L+ TI  +LE E KV+    ER   KD  L+D   DE V        D+D+   ER  TLA+IKPD V  GK DEII K+ E G EIL  ++R +T  E + FY H A  E FE L+  + SGPS +L+L +  G   ++  +R ++GP+  + A+   P+S+RA YGT    NA+HG+ DR+ A RELA  FP  
Sbjct:    1 MGSRKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVLAEGRERKVIKDEALSD--EDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSL 298          

HSP 2 Score: 105.916 bits (263), Expect = 4.549e-24
Identity = 53/149 (35.57%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 1400 TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSR----EDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPE 1828
            T+A IKPD + +   +EI  KI +A F+I+  +  TM ++    FY  ++ +E F  L+ HM SGP++ ++L+R    ED +  WR+++GP+DP  A    P+S+RA YG ++  NAV+GS +  +  R + L+F  L+F++  +  P+
Sbjct:  161 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDKDTEAPQ 309          

HSP 3 Score: 83.1889 bits (204), Expect = 1.832e-16
Identity = 48/137 (35.04%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  995 TLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEK----QNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1390
            TLA+++P A    + + I+ KI  AGF++   +E  +T+ E  LFY     +  FE+L+  M  G    L L +    ++ V  WR ++GP+D   A+   P SLRAQ+  E +  N +HGS   E A+ EL   FP
Sbjct:  161 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTE-MPFNAVHGSRDREDADRELALLFP 296          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Match: NME9 (NME/NM23 family member 9 [Source:HGNC Symbol;Acc:HGNC:21343])

HSP 1 Score: 206.838 bits (525), Expect = 6.877e-60
Identity = 111/278 (39.93%), Postives = 153/278 (55.04%), Query Frame = 2
Query:  131 LIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEV-----DKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 943
            ++  +GL VVDVYQ WCGPCK V++ F++++ E+G D L+FA+A+AD +D LEKYRG+CEP FL Y                                         KD  L+D   DE V        D+D+   ER  TLA+IKPD V  GK DEII K+ E G EIL  ++R +T  E + FY H A  E FE L+  + SGPS +L+L +  G   ++  +R ++GP+  + A+   P+S+RA YGT    NA+HG+ DR+ A RELA  FP  
Sbjct:    1 MLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYA---------------------------------------IKDEALSD--EDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSL 237          

HSP 2 Score: 106.301 bits (264), Expect = 1.015e-24
Identity = 54/151 (35.76%), Postives = 92/151 (60.93%), Query Frame = 2
Query: 1400 TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSR----EDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYE 1834
            T+A IKPD + +   +EI  KI +A F+I+  +  TM ++    FY  ++ +E F  L+ HM SGP++ ++L+R    ED +  WR+++GP+DP  A    P+S+RA YG ++  NAV+GS +  +  R + L+F  L+F++  +  P+ E
Sbjct:  100 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDKDTEAPQGE 250          

HSP 3 Score: 83.9593 bits (206), Expect = 4.385e-17
Identity = 48/137 (35.04%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  995 TLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEK----QNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1390
            TLA+++P A    + + I+ KI  AGF++   +E  +T+ E  LFY     +  FE+L+  M  G    L L +    ++ V  WR ++GP+D   A+   P SLRAQ+  E +  N +HGS   E A+ EL   FP
Sbjct:  100 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTE-MPFNAVHGSRDREDADRELALLFP 235          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Match: NME9 (NME/NM23 family member 9 [Source:HGNC Symbol;Acc:HGNC:21343])

HSP 1 Score: 206.838 bits (525), Expect = 6.877e-60
Identity = 111/278 (39.93%), Postives = 153/278 (55.04%), Query Frame = 2
Query:  131 LIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEV-----DKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 943
            ++  +GL VVDVYQ WCGPCK V++ F++++ E+G D L+FA+A+AD +D LEKYRG+CEP FL Y                                         KD  L+D   DE V        D+D+   ER  TLA+IKPD V  GK DEII K+ E G EIL  ++R +T  E + FY H A  E FE L+  + SGPS +L+L +  G   ++  +R ++GP+  + A+   P+S+RA YGT    NA+HG+ DR+ A RELA  FP  
Sbjct:    1 MLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYA---------------------------------------IKDEALSD--EDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSL 237          

HSP 2 Score: 106.301 bits (264), Expect = 1.015e-24
Identity = 54/151 (35.76%), Postives = 92/151 (60.93%), Query Frame = 2
Query: 1400 TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSR----EDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYE 1834
            T+A IKPD + +   +EI  KI +A F+I+  +  TM ++    FY  ++ +E F  L+ HM SGP++ ++L+R    ED +  WR+++GP+DP  A    P+S+RA YG ++  NAV+GS +  +  R + L+F  L+F++  +  P+ E
Sbjct:  100 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDKDTEAPQGE 250          

HSP 3 Score: 83.9593 bits (206), Expect = 4.385e-17
Identity = 48/137 (35.04%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  995 TLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEK----QNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1390
            TLA+++P A    + + I+ KI  AGF++   +E  +T+ E  LFY     +  FE+L+  M  G    L L +    ++ V  WR ++GP+D   A+   P SLRAQ+  E +  N +HGS   E A+ EL   FP
Sbjct:  100 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTE-MPFNAVHGSRDREDADRELALLFP 235          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 70.4774 bits (171), Expect = 7.239e-14
Identity = 39/137 (28.47%), Postives = 71/137 (51.82%), Query Frame = 2
Query:  980 SNVQRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1387
            SN +RT   ++P   +      I+ +    G+K+   K++  +K    + Y   KDKPFF  LI+ MS G ++A+  +  + V+  R MLG  +   +    P ++R  F  +  + N+ HGSD+ ++A  E+ ++F
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGR-NICHGSDAVDSANREIAHWF 134          

HSP 2 Score: 69.3218 bits (168), Expect = 1.463e-13
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGS 1816
            E+T  AIKPDG+      +I  +  +  +K+V +K++T  K+  E  Y D   + +F  LI +M SGP   MV    D ++  RS++G  +P  +    P +IR  +     +N  +GSD      R +   F + E N+  S
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYAS 144          

HSP 3 Score: 68.1662 bits (165), Expect = 4.835e-13
Identity = 40/135 (29.63%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 934
            E T   IKPD V  G V +IIA+  E G +++A +    +    +  Y  + D   F  LI++++SGP   +V    D  ++ + R ++G         ++P +IR  +   +  N  HG+D  D+A RE+A +F
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLD--VVKQGRSMLGAT---NPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 70.4774 bits (171), Expect = 7.239e-14
Identity = 39/137 (28.47%), Postives = 71/137 (51.82%), Query Frame = 2
Query:  980 SNVQRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1387
            SN +RT   ++P   +      I+ +    G+K+   K++  +K    + Y   KDKPFF  LI+ MS G ++A+  +  + V+  R MLG  +   +    P ++R  F  +  + N+ HGSD+ ++A  E+ ++F
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGR-NICHGSDAVDSANREIAHWF 134          

HSP 2 Score: 69.3218 bits (168), Expect = 1.463e-13
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGS 1816
            E+T  AIKPDG+      +I  +  +  +K+V +K++T  K+  E  Y D   + +F  LI +M SGP   MV    D ++  RS++G  +P  +    P +IR  +     +N  +GSD      R +   F + E N+  S
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYAS 144          

HSP 3 Score: 68.1662 bits (165), Expect = 4.835e-13
Identity = 40/135 (29.63%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 934
            E T   IKPD V  G V +IIA+  E G +++A +    +    +  Y  + D   F  LI++++SGP   +V    D  ++ + R ++G         ++P +IR  +   +  N  HG+D  D+A RE+A +F
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLD--VVKQGRSMLGAT---NPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 70.4774 bits (171), Expect = 7.239e-14
Identity = 39/137 (28.47%), Postives = 71/137 (51.82%), Query Frame = 2
Query:  980 SNVQRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1387
            SN +RT   ++P   +      I+ +    G+K+   K++  +K    + Y   KDKPFF  LI+ MS G ++A+  +  + V+  R MLG  +   +    P ++R  F  +  + N+ HGSD+ ++A  E+ ++F
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGR-NICHGSDAVDSANREIAHWF 134          

HSP 2 Score: 69.3218 bits (168), Expect = 1.463e-13
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGS 1816
            E+T  AIKPDG+      +I  +  +  +K+V +K++T  K+  E  Y D   + +F  LI +M SGP   MV    D ++  RS++G  +P  +    P +IR  +     +N  +GSD      R +   F + E N+  S
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYAS 144          

HSP 3 Score: 68.1662 bits (165), Expect = 4.835e-13
Identity = 40/135 (29.63%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 934
            E T   IKPD V  G V +IIA+  E G +++A +    +    +  Y  + D   F  LI++++SGP   +V    D  ++ + R ++G         ++P +IR  +   +  N  HG+D  D+A RE+A +F
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLD--VVKQGRSMLGAT---NPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 70.4774 bits (171), Expect = 7.239e-14
Identity = 39/137 (28.47%), Postives = 71/137 (51.82%), Query Frame = 2
Query:  980 SNVQRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1387
            SN +RT   ++P   +      I+ +    G+K+   K++  +K    + Y   KDKPFF  LI+ MS G ++A+  +  + V+  R MLG  +   +    P ++R  F  +  + N+ HGSD+ ++A  E+ ++F
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGR-NICHGSDAVDSANREIAHWF 134          

HSP 2 Score: 69.3218 bits (168), Expect = 1.463e-13
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGS 1816
            E+T  AIKPDG+      +I  +  +  +K+V +K++T  K+  E  Y D   + +F  LI +M SGP   MV    D ++  RS++G  +P  +    P +IR  +     +N  +GSD      R +   F + E N+  S
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYAS 144          

HSP 3 Score: 68.1662 bits (165), Expect = 4.835e-13
Identity = 40/135 (29.63%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 934
            E T   IKPD V  G V +IIA+  E G +++A +    +    +  Y  + D   F  LI++++SGP   +V    D  ++ + R ++G         ++P +IR  +   +  N  HG+D  D+A RE+A +F
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLD--VVKQGRSMLGAT---NPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Match: Y48G8AL.15 (pep chromosome:WBcel235:I:1254770:1258258:1 gene:WBGene00021692.1 transcript:Y48G8AL.15.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48G8AL.15)

HSP 1 Score: 51.9878 bits (123), Expect = 1.243e-7
Identity = 39/132 (29.55%), Postives = 66/132 (50.00%), Query Frame = 2
Query:  539 LALIKPDIVKAGKVDEI-IAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFF 931
            L ++KP+IV    + ++ +++L  NGIEI   +   ++   AK+ Y        ++ L++ I+SGP  I +   G+A      R+ IG   L    E + Q IR  +  + + N  H A D D A++EL  F
Sbjct:   13 LVVLKPEIVAHRVLAQVALSELRSNGIEIEEMRQMKISGSLAKQLYAQHQGKFFYDRLVRHISSGPV-IAMRVSGNA------RKCIGSSRLWPRLEPTVQPIRQRFALSDVRNVAH-ASDEDAAEKELQLF 136          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Match: nmdyn-D6 (gene:FBgn0030573 transcript:FBtr0073933)

HSP 1 Score: 94.3597 bits (233), Expect = 4.133e-22
Identity = 50/133 (37.59%), Postives = 72/133 (54.14%), Query Frame = 2
Query:  995 TLALVRPAAY-TEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1390
            TLAL++P      Y    +  + +  F +  QKEV +TKE +  FY +HK K F+  L   M+ G   AL L+ +  +Q WR +LGP  V +A   DPN +RA +   D + N  HGSDS+ +A  E+   FP
Sbjct:    4 TLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTR-NACHGSDSEASALREISILFP 135          

HSP 2 Score: 94.3597 bits (233), Expect = 4.213e-22
Identity = 45/134 (33.58%), Postives = 78/134 (58.21%), Query Frame = 2
Query: 1391 VEQTIAAIKPDGIENEEEI--FNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            +E T+A IKP  + N   +     ++   F I+  K + + K L+E FY++   + +++ L + M SGP+Y ++L  E  I+ WRSL+GP     A  + P+ IRA+YG    +NA +GSD+E+   R ++++F
Sbjct:    1 MEITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISILF 134          

HSP 3 Score: 88.9669 bits (219), Expect = 3.179e-20
Identity = 48/138 (34.78%), Postives = 73/138 (52.90%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 943
            E+TLALIKP +++     + I  L      IL Q++  +T E ++ FY        +  L  F+ SGPS  L+L       I ++R L+GP  +  A  + P  IRA+YG +   NA HG+D   +A RE++  FP+F
Sbjct:    2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSETC--IQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISILFPEF 137          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Match: CG18130 (gene:FBgn0030359 transcript:FBtr0073581)

HSP 1 Score: 98.2117 bits (243), Expect = 1.139e-20
Identity = 41/103 (39.81%), Postives = 69/103 (66.99%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPP 373
            MA+K  +  LQA+I T EE +  +++ GLLV+DVY +WCGPC+ ++   R++K ++G D L+ A+ K+DTI +L+++  R EP +L   G   V ++ G++ P
Sbjct:    1 MAKKGGQQQLQADIQTDEELERFMERPGLLVLDVYSEWCGPCQGMVGSLRKIKLDVGGDNLHLAICKSDTITALKRFNKRSEPIWLFVTGGRAVNLLFGSDVP 103          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Match: CG14221 (gene:FBgn0031042 transcript:FBtr0332485)

HSP 1 Score: 85.1149 bits (209), Expect = 1.065e-16
Identity = 34/103 (33.01%), Postives = 64/103 (62.14%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPP 373
            MA+K     LQA++ + EE+++ +++ GLLV+D+Y +WCGPC  ++   R++K E+G D L  A+ KA +I  L+++  + EP ++       + ++ G + P
Sbjct:    1 MAKKGGVQQLQADLASDEEFEKFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAICKAGSISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVP 103          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0346150)

HSP 1 Score: 68.9366 bits (167), Expect = 3.584e-13
Identity = 39/138 (28.26%), Postives = 70/138 (50.72%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEF 1801
            E+T   +KPDG++     +I  +     FK+V +K     K L E+ Y+D S + +F  L+ +M SGP   MV    + ++  R ++G  +P    D+ P +IR  +   + +N ++GSD     ++ + L F + E 
Sbjct:   21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPA---DSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKEL 155          

HSP 2 Score: 65.0846 bits (157), Expect = 8.505e-12
Identity = 42/138 (30.43%), Postives = 68/138 (49.28%), Query Frame = 2
Query:  977 ASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1387
            A+N +RT  +V+P          I+E+    GFK+   K    +KE     Y     +PFF  L+  M+ G ++ +  E  N V+  R MLG  +   +    P ++R  F  + +  N+IHGSD+ E+AE E+  +F
Sbjct:   17 AANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSL---PGTIRGDFCIQ-VGRNIIHGSDAVESAEKEIALWF 150          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0339146)

HSP 1 Score: 68.9366 bits (167), Expect = 3.584e-13
Identity = 39/138 (28.26%), Postives = 70/138 (50.72%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEF 1801
            E+T   +KPDG++     +I  +     FK+V +K     K L E+ Y+D S + +F  L+ +M SGP   MV    + ++  R ++G  +P    D+ P +IR  +   + +N ++GSD     ++ + L F + E 
Sbjct:   21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPA---DSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKEL 155          

HSP 2 Score: 65.0846 bits (157), Expect = 8.505e-12
Identity = 42/138 (30.43%), Postives = 68/138 (49.28%), Query Frame = 2
Query:  977 ASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1387
            A+N +RT  +V+P          I+E+    GFK+   K    +KE     Y     +PFF  L+  M+ G ++ +  E  N V+  R MLG  +   +    P ++R  F  + +  N+IHGSD+ E+AE E+  +F
Sbjct:   17 AANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSL---PGTIRGDFCIQ-VGRNIIHGSDAVESAEKEIALWF 150          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Match: nme8 (NME/NM23 family member 8 [Source:ZFIN;Acc:ZDB-GENE-070410-39])

HSP 1 Score: 453.366 bits (1165), Expect = 2.966e-149
Identity = 243/517 (47.00%), Postives = 343/517 (66.34%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEE----------IEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHM 1579
            MA KK+EI+LQ  IN  E+W E +  +GLLVVDVYQ WCGPC+AV+  FR++KNE+GD+ L+FA A+AD I++LE YRG+CEP FL Y G  LV V+RG N P+L+ TI+ +L  E  V++    R   KD  L + E      EV+ D E+           ++  T+A+IKPD+V  GK DEII K+ + G  ILA ++R LT  EA++FY H A    F++L++F++SGPS +LV++K  G   +I  +RE IGP  ++EA+   P+S+RA YG+ S+ N +HG+ DR+ A RELAFFFP+F    +   + E   V+RTLALVRP A  E RE IL +I  AGF+VAMQKE+ LT+E+  LFY+ H ++ +F  L++ M+ G +LALAL K+ AV+ WR +LGPKD  KAK   P+SLRAQFS E+  +N +HGS S E AE E+ +FFP E T+A IKPD  +++EEI  +I    F I ++K   + + +AEEFY +   + +F+ L+ +M
Sbjct:    1 MAAKKKEISLQININNDEQWSEALALKGLLVVDVYQQWCGPCRAVVGLFRKIKNELGDELLHFATAEADGIEALEMYRGKCEPTFLFYAGGELVSVLRGPNAPLLQKTIQEELSNEKNVLEHGGARRAVKDEGLTEEE------EVNDDTEDHPHDEDVTVPTDKSYTVAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAEPYFQELVQFMSSGPSHVLVISKTEGCEDVIPAWREFIGPADVEEARREQPESLRAQYGSESLLNGLHGSSDRERASRELAFFFPNFSF-SVWDSRPEEEPVERTLALVRPDAARENREEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEEEYFNSLMENMTSGLVLALALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQFSVENSSINQLHGSSSSEEAEKEISFFFPPEDTLAVIKPD-TQHKEEILEEIQAQGFTISQLKDTILSREMAEEFYKEHREKPFFSQLVDYM 509          

HSP 2 Score: 168.703 bits (426), Expect = 5.321e-44
Identity = 93/259 (35.91%), Postives = 145/259 (55.98%), Query Frame = 2
Query:  995 TLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEK----QNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP---------------VEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIY 1708
            T+A+++P      + + I+ KI +AGF +   +E  LT+ EA  FY     +P+F+EL++ MS G    L + K    ++ +  WR  +GP DVE+A+   P SLRAQ+  E + +N +HGS   E A  EL +FFP               VE+T+A ++PD   EN EEI ++I  A F++   K + + +     FYS    +EYFN L+ +M SG    + L +E A+  WR+++GPKDP  A++  PDS+RA +
Sbjct:  162 TVAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAEPYFQELVQFMSSGPSHVLVISKTEGCEDVIPAWREFIGPADVEEARREQPESLRAQYGSESL-LNGLHGSSDRERASRELAFFFPNFSFSVWDSRPEEEPVERTLALVRPDAARENREEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEEEYFNSLMENMTSGLVLALALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQF 419          

HSP 3 Score: 112.464 bits (280), Expect = 2.649e-25
Identity = 73/224 (32.59%), Postives = 127/224 (56.70%), Query Frame = 2
Query:  515 EEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGT-NSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSK 1183
            E +ER  TLAL++PD  +  + +EI++++ + G  +  Q++  LT E+ + FY    + E F  L++ + SG   +L LA    G +  +R ++GPK   +AK   P S+RA +   NS  N +HG+   + A++E++FFFP                 + TLA+++P   T+++E ILE+I   GF ++  K+  L++E A  FY +H++KPFF +L+  M +
Sbjct:  311 EPVER--TLALVRPDAARENR-EEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEEEYFNSLMENMTSG--LVLALALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQFSVENSSINQLHGSSSSEEAEKEISFFFPP----------------EDTLAVIKPD--TQHKEEILEEIQAQGFTISQLKDTILSREMAEEFYKEHREKPFFSQLVDYMCR 511          

HSP 4 Score: 96.6709 bits (239), Expect = 3.219e-20
Identity = 55/162 (33.95%), Postives = 86/162 (53.09%), Query Frame = 2
Query: 1337 HGSDSDETAETELKYFFPVEQTIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSR----EDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1804
            H  D D T  T+  Y      T+A IKPD + +   +EI  KI DA F I+  +  T+ ++ A++FY  ++ + YF +L+  M SGP++ +V+S+    ED I  WR  IGP D + A    P+S+RA YG +   N ++GS +     R +   F    F+
Sbjct:  147 HPHDEDVTVPTDKSY------TVAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAEPYFQELVQFMSSGPSHVLVISKTEGCEDVIPAWREFIGPADVEEARREQPESLRAQYGSESLLNGLHGSSDRERASRELAFFFPNFSFS 302          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Match: nme7 (NME/NM23 family member 7 [Source:ZFIN;Acc:ZDB-GENE-000210-35])

HSP 1 Score: 142.51 bits (358), Expect = 2.788e-36
Identity = 90/275 (32.73%), Postives = 145/275 (52.73%), Query Frame = 2
Query:  977 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEF---YSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1747
             S  +RTLA+++P A ++  + I++ I +A   V   K  +LT ++AA FY +H+ K FF  L++ +S G ++A+ L    AV  WR +LGP D   A++   +SLR QF  +  K N  HGSDS  +A  EL+YFFP              + T   IKP  I      +I   I++  F+I  ++   M+++ AEEF   Y     +  +  ++  + SGP   + +   DA R +R   GP DP+ A    P ++RA+YG++  +N V+ +D
Sbjct:   86 GSKKERTLAMIKPDAVSKVGD-IIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEAVSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTK-NAGHGSDSLASAARELEYFFPSTAGHGLSNTAKYSDCTCCIIKPHAISEALTGKILKSIIENGFEISALQMFNMDRANAEEFLEVYKGVVAE--YTKMVDELCSGPCMALEIHATDAPRTFREFCGPADPEIARHLRPKTLRALYGKNKLQNGVHCTD 356          

HSP 2 Score: 133.65 bits (335), Expect = 2.948e-33
Identity = 85/296 (28.72%), Postives = 155/296 (52.36%), Query Frame = 2
Query:  524 EREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQR----TLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1393
            ++E TLA+IKPD V   KV +II  +++  + +   +   LT ++A +FY        F +L++F++SGP   + L   +A  +  +R+++GP     A++ +  S+R  +GT+  +NA HG+D   +A REL +FFP       +   H  SN  +    T  +++P A +E     IL+ I   GF+++  +   + +  A  F   +K     + +++ E+  G  +AL +   +A + +R   GP D E A+ + P +LRA + K  ++ N +H +D  E    E++YFF +
Sbjct:   88 KKERTLAMIKPDAVS--KVGDIIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEA--VSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTKNAGHGSDSLASAARELEYFFP-------STAGHGLSNTAKYSDCTCCIIKPHAISEALTGKILKSIIENGFEISALQMFNMDRANAEEFLEVYKGVVAEYTKMVDELCSGPCMALEIHATDAPRTFREFCGPADPEIARHLRPKTLRALYGKNKLQ-NGVHCTDLPEDGILEVQYFFKI 371          

HSP 3 Score: 88.1965 bits (217), Expect = 4.557e-18
Identity = 43/131 (32.82%), Postives = 68/131 (51.91%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            E+T+A IKPD +    +I   I DA   + K K   +    A +FY +   + +FN+L+  + SGP   M L  ++A+  WR ++GP D   A+     S+R  +G D  KNA +GSD+ +   R +   F
Sbjct:   90 ERTLAMIKPDAVSKVGDIIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEAVSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTKNAGHGSDSLASAARELEYFF 220          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Match: nme5 (NME/NM23 family member 5 [Source:ZFIN;Acc:ZDB-GENE-040718-221])

HSP 1 Score: 101.679 bits (252), Expect = 1.028e-23
Identity = 51/135 (37.78%), Postives = 83/135 (61.48%), Query Frame = 2
Query:  986 VQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1390
            V+RTLAL++P A  +  E I + I  +GF +  ++ +QL+ E+ + FY +H  K  F  L   MS G ++ALAL +  A+  W+ ++GP    KA+E  P+ LRA+F   D++ N +HGS++   AE E+++ FP
Sbjct:   22 VERTLALIKPDAIHKTDE-IEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSGPVVALALARDQAIATWKAIMGPVSSIKARETHPDCLRARFGTCDLR-NAVHGSETFSAAEREIRFMFP 154          

HSP 2 Score: 98.9821 bits (245), Expect = 7.044e-23
Identity = 47/132 (35.61%), Postives = 79/132 (59.85%), Query Frame = 2
Query: 1391 VEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            VE+T+A IKPD I   +EI + IL + F I++ +R+ +      +FY++   + +F  L A M SGP   + L+R+ AI  W++++GP     A +T+PD +RA +G    +NAV+GS+  S  +R +  +F
Sbjct:   22 VERTLALIKPDAIHKTDEIEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSGPVVALALARDQAIATWKAIMGPVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAEREIRFMF 153          

HSP 3 Score: 86.6557 bits (213), Expect = 1.170e-18
Identity = 51/143 (35.66%), Postives = 79/143 (55.24%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKI 958
            E TLALIKPD +   K DEI   + ++G  IL ++   L+ E+  +FY        F  L  F++SGP   L LA+  A  I  ++ ++GP    +A+E  P  +RA +GT  + NA+HG++    A+RE+ F FP  ++  I
Sbjct:   23 ERTLALIKPDAIH--KTDEIEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSGPVVALALARDQA--IATWKAIMGPVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAEREIRFMFPHSVIEPI 161          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 91.2781 bits (225), Expect = 1.058e-20
Identity = 47/138 (34.06%), Postives = 81/138 (58.70%), Query Frame = 2
Query:  986 VQRTLALVRPAAYTEYRESILEKINNA---GFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1390
            +Q TLA+++P A       ILE ++      F +  +K++   K ++ +FY +H  + FF+ L++ MS G + A  L +++A+  WR M+GP  V +A+   P +LR ++   D + N  HGSDS E+A+ E+ +FFP
Sbjct:    7 LQLTLAVIKPDAMAH--PLILEALHQKILENFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTR-NTTHGSDSIESAKREISFFFP 141          

HSP 2 Score: 89.3521 bits (220), Expect = 5.039e-20
Identity = 48/139 (34.53%), Postives = 86/139 (61.87%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEII-AKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 943
            ++TLA+IKPD +    + E +  K+ EN I I+ ++D      +++ FY   +    F+ L++F++SGP +  +LA+ DA  I  +R ++GP  +  A+ +SP+++R  YG     N  HG+D  ++A+RE++FFFP+F
Sbjct:    8 QLTLAVIKPDAMAHPLILEALHQKILENFI-IIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILAREDA--ITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREISFFFPEF 143          

HSP 3 Score: 86.2705 bits (212), Expect = 5.990e-19
Identity = 45/135 (33.33%), Postives = 77/135 (57.04%), Query Frame = 2
Query: 1391 VEQTIAAIKPDGIENE---EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            ++ T+A IKPD + +    E +  KIL+  F I++ K +   K+ +E FY++ S + +F  L+  M SGP    +L+REDAI  WR+++GP     A  + P+++R  YG    +N  +GSD+    +R ++  F
Sbjct:    7 LQLTLAVIKPDAMAHPLILEALHQKILE-NFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREISFFF 140          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Match: nme2b.2 (NME/NM23 nucleoside diphosphate kinase 2b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-000210-33])

HSP 1 Score: 79.337 bits (194), Expect = 8.276e-17
Identity = 49/145 (33.79%), Postives = 77/145 (53.10%), Query Frame = 2
Query:  977 ASNVQRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIA 1408
            A   +RT   V+P          I+++    GF++   K VQ +++ A   Y   KD+PF+  L+K  S G LLA+  E  N ++  R MLG  D   +K   P ++R  F  E +  NLIHGSDS+++A TE+  +F  E+ ++
Sbjct:    2 AGKTERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAAKFVQASEDLAKQHYIDLKDQPFYAGLVKYTSSGPLLAMVWEGLNVIKTGRVMLGETDPFASK---PGTIRGDFCIE-VGRNLIHGSDSEKSAATEVSLWFKPEELVS 142          

HSP 2 Score: 68.9366 bits (167), Expect = 3.626e-13
Identity = 38/133 (28.57%), Postives = 69/133 (51.88%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            E+T  A+KPDG++     EI  +     F++V  K +   + LA++ Y D   Q ++  L+ +  SGP   MV    + I+  R ++G  DP  ++   P +IR  +  ++ +N ++GSD+E      ++L F
Sbjct:    6 ERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAAKFVQASEDLAKQHYIDLKDQPFYAGLVKYTSSGPLLAMVWEGLNVIKTGRVMLGETDPFASK---PGTIRGDFCIEVGRNLIHGSDSEKSAATEVSLWF 135          

HSP 3 Score: 59.3066 bits (142), Expect = 9.437e-10
Identity = 36/135 (26.67%), Postives = 66/135 (48.89%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 934
            E T   +KPD V+ G + EII +  + G  ++A +    + + AK+ Y  + D   +  L+K+ +SGP  +L +      +I   R ++G     +   + P +IR  +      N IHG+D   +A  E++ +F
Sbjct:    6 ERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAAKFVQASEDLAKQHYIDLKDQPFYAGLVKYTSSGP--LLAMVWEGLNVIKTGRVMLGE---TDPFASKPGTIRGDFCIEVGRNLIHGSDSEKSAATEVSLWF 135          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 537.339 bits (1383), Expect = 2.375e-180
Identity = 270/587 (46.00%), Postives = 388/587 (66.10%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV----QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1804
            MA KK+E  LQ  ++ QE+W+E +  +GLLVVDVYQ WCGPCK  ++ FR++KNE+GDD L+FAVA++DTIDSL KYRG+CEP FL+  G  LV V+RGAN P+L+ TI  +L  E KV+    ER+  KD  + + E DE V    Q  D++L    +  T+A+IKPD V  GK DEII K+ E+G EILA ++  +T  EA+EFY H    E F++LI+F++SGP  +L+++K D    +I  +RE IGP  ++ AK+  P+S+RA YGT  + NA+HG++DR+ A RELAFFFP+F +   +     +   +RTLAL+RP    + ++ IL+ I +AGF +AMQKEV LT+++   FY +H DK ++  L+K+M+ G +LALAL K +AV  WR MLGP  + +A    P+SLRAQF+  D  +N +HGS + E A+ EL +FFPVE T+A IKPD + E+ +EI  +I    F I +IK   + + +AEEFY +   + +F  L+ +M  GP   M+LS+E+A++ WRSL+GP DP  A+   PDS+RA + + I +NAV+GS N       M  IFG ++ +
Sbjct:    1 MAGKKRESTLQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDE-DEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHIDKDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQLHGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 586          

HSP 2 Score: 90.8929 bits (224), Expect = 3.465e-18
Identity = 51/150 (34.00%), Postives = 88/150 (58.67%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA 979
            E TLA IKPD ++  + DEI+ ++   G  I   ++ NL+ E A+EFY        FE L+ ++  GP  +++L+K +A  + E+R L+GP    EA++ SP S+RA +  + ++NA+HG+ + + A  ++ F F D     + R+ HE+
Sbjct:  449 EHTLATIKPDALEEHR-DEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENA--VQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDI---DLDRIVHES 592          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 536.184 bits (1380), Expect = 4.663e-180
Identity = 270/587 (46.00%), Postives = 388/587 (66.10%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV----QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1804
            MA KK+E  LQ  ++ QE+W+E +  +GLLVVDVYQ WCGPCK  ++ FR++KNE+GDD L+FAVA++DTIDSL KYRG+CEP FL+  G  LV V+RGAN P+L+ TI  +L  E KV+    ER+  KD  + + E DE V    Q  D++L    +  T+A+IKPD V  GK DEII K+ E+G EILA ++  +T  EA+EFY H    E F++LI+F++SGP  +L+++K D    +I  +RE IGP  ++ AK+  P+S+RA YGT  + NA+HG++DR+ A RELAFFFP+F +   +     +   +RTLAL+RP    + ++ IL+ I +AGF +AMQKEV LT+++   FY +H DK ++  L+K+M+ G +LALAL K +AV  WR MLGP  + +A    P+SLRAQF+  D  +N +HGS + E A+ EL +FFPVE T+A IKPD + E+ +EI  +I    F I +IK   + + +AEEFY +   + +F  L+ +M  GP   M+LS+E+A++ WRSL+GP DP  A+   PDS+RA + + I +NAV+GS N       M  IFG ++ +
Sbjct:    1 MAGKKRESTLQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDE-DEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHIDKDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQLHGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 586          

HSP 2 Score: 90.8929 bits (224), Expect = 4.140e-18
Identity = 51/150 (34.00%), Postives = 88/150 (58.67%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA 979
            E TLA IKPD ++  + DEI+ ++   G  I   ++ NL+ E A+EFY        FE L+ ++  GP  +++L+K +A  + E+R L+GP    EA++ SP S+RA +  + ++NA+HG+ + + A  ++ F F D     + R+ HE+
Sbjct:  449 EHTLATIKPDALEEHR-DEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENA--VQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDI---DLDRIVHES 592          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 528.094 bits (1359), Expect = 8.015e-177
Identity = 265/586 (45.22%), Postives = 383/586 (65.36%), Query Frame = 2
Query:   68 ARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV----QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1804
             +  Q    Q  ++ QE+W+E +  +GLLVVDVYQ WCGPCK  ++ FR++KNE+GDD L+FAVA++DTIDSL KYRG+CEP FL+  G  LV V+RGAN P+L+ TI  +L  E KV+    ER+  KD  + + E DE V    Q  D++L    +  T+A+IKPD V  GK DEII K+ E+G EILA ++  +T  EA+EFY H    E F++LI+F++SGP  +L+++K D    +I  +RE IGP  ++ AK+  P+S+RA YGT  + NA+HG++DR+ A RELAFFFP+F +   +     +   +RTLAL+RP    + ++ IL+ I +AGF +AMQKEV LT+++   FY +H DK ++  L+K+M+ G +LALAL K +AV  WR MLGP  + +A    P+SLRAQF+  D  +N +HGS + E A+ EL +FFPVE T+A IKPD + E+ +EI  +I    F I +IK   + + +AEEFY +   + +F  L+ +M  GP   M+LS+E+A++ WRSL+GP DP  A+   PDS+RA + + I +NAV+GS N       M  IFG ++ +
Sbjct:    3 GKTDQSTLFQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDE-DEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHIDKDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQLHGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 587          

HSP 2 Score: 90.5077 bits (223), Expect = 4.488e-18
Identity = 51/150 (34.00%), Postives = 88/150 (58.67%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA 979
            E TLA IKPD ++  + DEI+ ++   G  I   ++ NL+ E A+EFY        FE L+ ++  GP  +++L+K +A  + E+R L+GP    EA++ SP S+RA +  + ++NA+HG+ + + A  ++ F F D     + R+ HE+
Sbjct:  450 EHTLATIKPDALEEHR-DEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENA--VQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDI---DLDRIVHES 593          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 493.812 bits (1270), Expect = 7.260e-164
Identity = 251/582 (43.13%), Postives = 368/582 (63.23%), Query Frame = 2
Query:   68 ARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1804
             +  Q    Q  ++ QE+W+E +  +GLLVVDVYQ WCGPCK  ++ FR++KNE+GDD L+FAVA++DTIDSL KYRG+CEP FL+  G  LV V+RGAN P+L+ TI  +L  E KV+    ER+  KD   A  E ++++  V    E+ E    L  I               ++ E+G EILA ++  +T  EA+EFY H    E F++LI+F++SGP  +L+++K D    +I  +RE IGP  ++ AK+  P+S+RA YGT  + NA+HG++DR+ A RELAFFFP+F +   +     +   +RTLAL+RP    + ++ IL+ I +AGF +AMQKEV LT+++   FY +H DK ++  L+K+M+ G +LALAL K +AV  WR MLGP  + +A    P+SLRAQF+  D  +N +HGS + E A+ EL +FFPVE T+A IKPD + E+ +EI  +I    F I +IK   + + +AEEFY +   + +F  L+ +M  GP   M+LS+E+A++ WRSL+GP DP  A+   PDS+RA + + I +NAV+GS N       M  IFG ++ +
Sbjct:    3 GKTDQSTLFQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDE--AILEDEDEIVPVQAQTEDEELGEKLNKIYTSF-----------QIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHIDKDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQLHGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 571          

HSP 2 Score: 90.8929 bits (224), Expect = 3.195e-18
Identity = 51/150 (34.00%), Postives = 88/150 (58.67%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA 979
            E TLA IKPD ++  + DEI+ ++   G  I   ++ NL+ E A+EFY        FE L+ ++  GP  +++L+K +A  + E+R L+GP    EA++ SP S+RA +  + ++NA+HG+ + + A  ++ F F D     + R+ HE+
Sbjct:  434 EHTLATIKPDALEEHR-DEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENA--VQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDI---DLDRIVHES 577          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:394498])

HSP 1 Score: 162.155 bits (409), Expect = 6.702e-43
Identity = 99/275 (36.00%), Postives = 151/275 (54.91%), Query Frame = 2
Query:  977 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEF---YSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1747
             S  ++TLAL++P A T+   SI+E I ++GF ++  K V L + EA  FYN+H  K FF +LI  M+ G ++A+ +    AV  WR +LGP +   A+   P S+RA+F  +  K N  HGSDS  +A  EL++FFP              + T   IKP  I      +I N ILDA F+I  ++  T+E++ AEEF   Y     +  F+D+I  + SGP   + +   +A + +R   GP DP+ A    P ++RA +G++  KNAV+ +D
Sbjct:   88 GSKKEKTLALIKPDAVTKM-GSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTK-NAAHGSDSIASAARELEFFFPSSGGRAPKNTAKFTDCTCCIIKPHAISEGLTGKILNAILDAGFEISAMQMFTIERANAEEFCEIYKGVVAE--FSDMIVELCSGPCIALEIRDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTD 358          

HSP 2 Score: 144.05 bits (362), Expect = 1.028e-36
Identity = 99/289 (34.26%), Postives = 150/289 (51.90%), Query Frame = 2
Query:  524 EREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARV-KHEASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKY 1381
            ++E TLALIKPD V   K+  II  + ++G  I   +   L   EA +FY+       F DLI F+ SGP   + +   +A  +  +R+L+GP     A+   PQSIRA +GT+  +NA HG+D   +A REL FFFP        R  K+ A     T  +++P A +E     IL  I +AGF+++  +   + +  A  F   +K     F ++I E+  G  +AL +    A + +R   GP D E A+ + P +LRA+F K  IK N +H +D  E A  E++Y
Sbjct:   90 KKEKTLALIKPDAVT--KMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEA--VSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFFPS----SGGRAPKNTAKFTDCTCCIIKPHAISEGLTGKILNAILDAGFEISAMQMFTIERANAEEFCEIYKGVVAEFSDMIVELCSGPCIALEIRDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIK-NAVHCTDLPEDAPLEVRY 369          

HSP 3 Score: 101.679 bits (252), Expect = 2.192e-22
Identity = 49/131 (37.40%), Postives = 75/131 (57.25%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            E+T+A IKPD +     I   ILD+ F I K K + + ++ A +FY++   + +F+DLI+ M SGP   M +  ++A+  WR L+GP +   A    P SIRA +G D  KNA +GSD+ +   R +   F
Sbjct:   92 EKTLALIKPDAVTKMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFF 222          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Match: Nme8 (NME/NM23 family member 8 [Source:MGI Symbol;Acc:MGI:1920662])

HSP 1 Score: 338.191 bits (866), Expect = 1.545e-104
Identity = 196/593 (33.05%), Postives = 329/593 (55.48%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA-----------------GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEE-EIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            MA KK+E+ LQ+ +N+Q  WDE++  +GL V+DVYQ WCGPCKAV + FR++KNE+ +D  L+F VA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K++ GEM+R +  +  L D   DE+  EV    E       +A+IKPD V   K  E+  K+ + G  I  Q++  L  E  +EFY H+AD   FE+ +  + +G S +L++++ D+                 G++ E      P  + + ++    S++       + +     DD     + +   FPDF   K       ++NVQ TLAL+ P    E ++ +L  I+N GF + MQ+++ L++EEA      H+++ +F+ LI  M+      LAL ++N V+ W+ ++GPK +E+A    P SL  QF+  +   N  +GS S   AE E+ +FFP + T+A IKP     E  EI   I +A F++  +K + +    A + Y   + ++++ +++  +  G +  MVL++ +A+  WR ++GP DP+ A+   P+S+RA YG DI +NAV+G+ N SE   +++ +F
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQYVEIPLVD-AIDEEYGEVQ--YESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVIQEETLPQTDTEEEPGVLEEPHVRFAPVMIKKKRD----SLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPDFKTMK-------STNVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKPHVTHKERMEILKTIKEAGFELTLMKEMHLTPEHANKIYFKITGKDFYKNVLEVLSLGMSLVMVLTKWNAVAEWRRMVGPVDPEEAKLLSPESLRAKYGLDILRNAVHGASNFSEASEIISNVF 579          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Match: Nme8 (NME/NM23 family member 8 [Source:MGI Symbol;Acc:MGI:1920662])

HSP 1 Score: 270.396 bits (690), Expect = 1.266e-80
Identity = 159/470 (33.83%), Postives = 258/470 (54.89%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA-----------------GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKP 1420
            MA KK+E+ LQ+ +N+Q  WDE++  +GL V+DVYQ WCGPCKAV + FR++KNE+ +D  L+F VA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K++ GEM+R +  +  L D   DE+  EV    E       +A+IKPD V   K  E+  K+ + G  I  Q++  L  E  +EFY H+AD   FE+ +  + +G S +L++++ D+                 G++ E      P  + + ++    S++       + +     DD     + +   FPDF   K       ++NVQ TLAL+ P    E ++ +L  I+N GF + MQ+++ L++EEA      H+++ +F+ LI  M+      LAL ++N V+ W+ ++GPK +E+A    P SL  QF+  +   N  +GS S   AE E+ +FFP + T+A IKP
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQYVEIPLVD-AIDEEYGEVQ--YESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVIQEETLPQTDTEEEPGVLEEPHVRFAPVMIKKKRD----SLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPDFKTMK-------STNVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKP 456          

HSP 2 Score: 92.0485 bits (227), Expect = 6.627e-19
Identity = 75/298 (25.17%), Postives = 140/298 (46.98%), Query Frame = 2
Query:  965 VKHEASNVQRTLALVRPAAYTEYRE-SILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSL---RAQFSKEDIK---------VNLIHGSDSDETAETELKY------FFP---------VEQTIAAIKPDGIENE-EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGR-DINKNAVYGSDNESEVQR 1768
            V++E++     +A+++P A    +   + EKI   GF + +Q+ + L +E    FY    D+P FEE +  M+ G    L + ++++       L   D E+    +P  L     +F+   IK         ++  H SD  +  +  +K        FP         V+ T+A + PD  E E +++ N I +  F I+  ++I + +  A        ++EYF++LI HM S  +Y + L RE+ +  W++LIGPK  + A  ++P S+   +   +   N  YGS +++  ++
Sbjct:  146 VQYESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVIQEETLPQTDTEE----EPGVLEEPHVRFAPVMIKKKRDSLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPDFKTMKSTNVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEK 439          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Match: Nme9 (NME/NM23 family member 9 [Source:MGI Symbol;Acc:MGI:4359686])

HSP 1 Score: 248.44 bits (633), Expect = 2.404e-74
Identity = 134/298 (44.97%), Postives = 186/298 (62.42%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKV-MKGEMERNETKDSFLA--DFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 943
            M  +K+EIALQ  INTQE W+E++  +GL VVDVYQ WCGPCK +++ F++++ E+G D L+FA A+AD +D LEKY+G+CEP FL Y    LV V++GANP +L+ TI  +LE E KV  +G   R  T +  L    +    K    D D+    +  TL +IKPD V  GK +EII K+ E G +IL +++R LT  E + FY H A  E FE L+  + SGPS +L+L K  G   ++  +R  +GP   + A+   P+S+RA YGT    NA+HG+ DR+ A RELA  FP F
Sbjct:    1 MGNRKKEIALQVNINTQELWEEMLGSKGLTVVDVYQGWCGPCKPMVSLFQKMRIEVGLDRLHFASAEADRLDVLEKYQGKCEPTFLFYTRGELVAVVKGANPTLLQKTILQQLEAEKKVPAEGGEWRAATDEELLGALKWPPHRKDGGEDGDIASSGKTCTLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHHMCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTEMPFNAVHGSRDREDANRELALLFPSF 298          

HSP 2 Score: 102.064 bits (253), Expect = 7.079e-23
Identity = 49/142 (34.51%), Postives = 85/142 (59.86%), Query Frame = 2
Query: 1400 TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSR----EDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNE 1807
            T+  IKPD + +   EEI  KI +A F I+  +  T+ ++  + FY  ++ +E F  L+ HM SGP++ ++L++    ED +  WR+ +GP DP  A   +P+S+RA YG ++  NAV+GS +  +  R + L+F   +F++
Sbjct:  161 TLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHHMCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTEMPFNAVHGSRDREDANRELALLFPSFKFSD 302          

HSP 3 Score: 81.2629 bits (199), Expect = 5.422e-16
Identity = 51/143 (35.66%), Postives = 70/143 (48.95%), Query Frame = 2
Query:  977 ASNVQRTLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEK----QNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1390
            +S    TL +++P A    + E I+ KI  AGF + +++E  LT+ E   FY     +  FE L+  M  G    L L K    ++ V  WR  LGP D   A+   P SLRAQ+  E +  N +HGS   E A  EL   FP
Sbjct:  155 SSGKTCTLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHHMCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTE-MPFNAVHGSRDREDANRELALLFP 296          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 147.517 bits (371), Expect = 9.610e-38
Identity = 84/278 (30.22%), Postives = 151/278 (54.32%), Query Frame = 2
Query:  968 KHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIENEEEIFNKIL----DAKFKIVKIKRITMEKSLAEEFYS-DQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1747
            +   S  ++TLAL++P A ++  E I+E IN +GF +   + + LT++EAA F+  H  +PF+ ELI+ ++ G ++A+ + + +A+  W+ +LGP +   ++   P S+RA F  + ++ N  HG D+  +A  E++ FFP                T   IKP  I   E +  KIL    DA F +  I+   ++++  EEFY   +     +ND++  + SGP   + + + +  + +R   GP DP+ A    P+++RAI+G+   +NAV+ +D
Sbjct:  104 RQLGSRKEKTLALIKPDAVSKAGE-IIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVR-NAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAI--SEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTD 377          

HSP 2 Score: 143.665 bits (361), Expect = 1.511e-36
Identity = 99/335 (29.55%), Postives = 166/335 (49.55%), Query Frame = 2
Query:  434 MERNETKDSFLADFETDEKVQEVDKDLEEIE-------------REVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1393
            ++R + +D  L D     KV    + L  I+             +E TLALIKPD V   K  EII  ++++G  I   +   LT +EA +F+        + +LI+FI SGP   + + + DA  I E++ L+GP     ++ ++P SIRA++GT+ + NA HG D   +A RE+  FFP           + A     T  +++P A +E     IL  I +A F ++  +   L +     FY  +K     + +++ E+  G  +A+ +++ N  + +R   GP D E A+ + P +LRA F K  ++ N +H +D  E    E++YFF +
Sbjct:   66 LKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVS--KAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDA--ICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPS---SGGCGPANTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQ-NAVHCTDLPEDGLLEVQYFFKI 392          

HSP 3 Score: 97.4413 bits (241), Expect = 5.605e-21
Identity = 47/131 (35.88%), Postives = 74/131 (56.49%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            E+T+A IKPD +    EI   I  + F I K++ +T+ +  A +F+ D   + ++N+LI  + SGP   M + R+DAI  W+ L+GP +   +    P SIRA++G D  +NA +G D  +   R M L F
Sbjct:  111 EKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFF 241          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 147.517 bits (371), Expect = 9.610e-38
Identity = 84/278 (30.22%), Postives = 151/278 (54.32%), Query Frame = 2
Query:  968 KHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIENEEEIFNKIL----DAKFKIVKIKRITMEKSLAEEFYS-DQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1747
            +   S  ++TLAL++P A ++  E I+E IN +GF +   + + LT++EAA F+  H  +PF+ ELI+ ++ G ++A+ + + +A+  W+ +LGP +   ++   P S+RA F  + ++ N  HG D+  +A  E++ FFP                T   IKP  I   E +  KIL    DA F +  I+   ++++  EEFY   +     +ND++  + SGP   + + + +  + +R   GP DP+ A    P+++RAI+G+   +NAV+ +D
Sbjct:  104 RQLGSRKEKTLALIKPDAVSKAGE-IIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVR-NAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAI--SEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTD 377          

HSP 2 Score: 143.665 bits (361), Expect = 1.511e-36
Identity = 99/335 (29.55%), Postives = 166/335 (49.55%), Query Frame = 2
Query:  434 MERNETKDSFLADFETDEKVQEVDKDLEEIE-------------REVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1393
            ++R + +D  L D     KV    + L  I+             +E TLALIKPD V   K  EII  ++++G  I   +   LT +EA +F+        + +LI+FI SGP   + + + DA  I E++ L+GP     ++ ++P SIRA++GT+ + NA HG D   +A RE+  FFP           + A     T  +++P A +E     IL  I +A F ++  +   L +     FY  +K     + +++ E+  G  +A+ +++ N  + +R   GP D E A+ + P +LRA F K  ++ N +H +D  E    E++YFF +
Sbjct:   66 LKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVS--KAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDA--ICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPS---SGGCGPANTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQ-NAVHCTDLPEDGLLEVQYFFKI 392          

HSP 3 Score: 97.4413 bits (241), Expect = 5.605e-21
Identity = 47/131 (35.88%), Postives = 74/131 (56.49%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            E+T+A IKPD +    EI   I  + F I K++ +T+ +  A +F+ D   + ++N+LI  + SGP   M + R+DAI  W+ L+GP +   +    P SIRA++G D  +NA +G D  +   R M L F
Sbjct:  111 EKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFF 241          
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Match: sp|Q95YJ5|TXND3_CIOIN (Thioredoxin domain-containing protein 3 homolog OS=Ciona intestinalis OX=7719 GN=CiIC3 PE=2 SV=1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 270/601 (44.93%), Postives = 400/601 (66.56%), Query Frame = 2
Query:   74 KKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEE------IEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVP--------------KIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNED 1810
            K++E+ LQ  +NTQE W+  +    L VVD +Q WCGPC A++   +R+KNE+GDD L FA A+ D ID+LE+YRG+CEP FL YGG  LV  +RG N P+++ TI+  L+ EHK++ GEMER   +D +     +D   QE +++ EE      + +++T+ALIKPD+V+ G+VDEI+ K+ E GIE+LA ++R LT+EEA++FY +  + E F+ LI ++ SGP ++LVL KG++G  ++  +R++IGP     AKE +P S+RAIYGT++  NA+HG+   + A REL FFFPDF  P              + ++   +   +QRTLA++RP A   +++SIL+KI+ AGFK+AMQKE+ LT+E+A  FY++HKD  +FE L+K+M+ G +LAL L   +AV  WR MLGPK V  A E  P+SLRAQF  E+ +VN++HGSDS E AE EL   F VEQT+A IKPD I+ +E+I  K+ +A F I   K + + K +A E Y  +   EY++ LI HM SGPT  MVLS E+A+   R ++GP DP+ A++++P+S+RA++ + I +NA++        Q  + ++FG  +F+ D
Sbjct:    3 KRKEVILQETLNTQEAWEVAMNSGKLYVVDAHQKWCGPCTAIVGMLKRIKNELGDDLLRFATAQVDVIDTLEQYRGKCEPNFLFYGGGELVAAVRGCNAPLVQETIQETLKNEHKILSGEMERKVFRDVY-----SDTPDQEEEEEDEEEEEGGVVSKQITVALIKPDVVQNGQVDEILQKISEAGIEVLADEERMLTVEEARDFYKNKEEEEYFDQLIDYVTSGPCRVLVLTKGESGEGVVTLWRDIIGPFDAAVAKEENPDSLRAIYGTDATSNALHGSSSTEEAVRELGFFFPDFKPPTYRSAKSAASRASGRRSKTPSQKPRLQRTLAIIRPDALQAHKDSILQKIDEAGFKIAMQKEMVLTREQAESFYSEHKDTDYFEPLVKQMTCGPVLALCLAHDDAVDHWRSMLGPKVVADAVEEQPDSLRAQFRVEEAEVNMLHGSDSAEAAEEELSKIFHVEQTLAVIKPDAIDEKEQIMGKLKEAGFMISCQKDMNLSKEIASEIYKSKEGSEYYDHLIDHMTSGPTLMMVLSAENAVEKLRDIMGPTDPEVAKESHPESLRAMFAKSILENAIHSPSTNESAQEKIRIVFGDAQFDWD 598          
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Match: sp|P90666|TXND3_HELCR (Thioredoxin domain-containing protein 3 homolog OS=Heliocidaris crassispina OX=1043166 GN=NME8 PE=1 SV=1)

HSP 1 Score: 520.005 bits (1338), Expect = 5.025e-170
Identity = 278/636 (43.71%), Postives = 405/636 (63.68%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDE------------------KVQEVDK--DLEEIE-REVTLALIKPDIVKAGKVD------------------EIIAKLHENGI---------EILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA--GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1819
            M  KK++I LQ EI  QE WDEL+  EGL V+DVYQ WCGPC AV++ F+R++NEIGDD L FAVA+AD+I++LE+YRG+CEPCFL YG   LV V+RG N P L   ++ +L++EHKV++  +ER   KD  LA FE +E                  +++E+ +  D  E+  R V+   +  D +  G+ D                  + +A  H + I         EIL  +D+ LT +EA+EFY    + E FE L+ F+ASGPSKILVL +GD   G++ E R L+GPK ++ AKE +P S+RA +GT+   NA+HGAD ++TA RE+AF  P+F VP I         +++TLAL+RP+A  ++++ +L+KI  AGF+V +QK VQLT+++A  FY + +  P FE+LI+EM+ G +LAL L K++A+Q WR  +GP  +++AKE  P+SLRAQ+S  D +VN++HGSDS +TAE EL +FFP + T+A IKPD   E++E I  KI +A F I   + + + K LA + Y +   +E++ +LI HM SG +  MVLSREDA+ GWR+L+GP DP  A +  P+S+RA+ G+D+ +NAV+GS N  E +  +  +F  +E    G +
Sbjct:    1 MPAKKEQIQLQKEILNQEMWDELLSLEGLTVIDVYQKWCGPCAAVLSLFKRLRNEIGDDLLRFAVAEADSIETLERYRGKCEPCFLRYGSGQLVNVVRGVNAPALLKNVERELKQEHKVLEEGVERVVIKDPLLAAFEAEEQQAAQAEELEKKRLEEEARIKEIKELGDAGEVSVRPVSQGTV--DTLMHGRQDGPQTEPVPKEVTVVLIKPDAVANGHVDSIIAKIEEHGFEILTTEDKTLTEDEAREFYKQHEEEEHFEVLVTFMASGPSKILVLTRGDTGEGVVSEVRNLLGPKDIEVAKEEAPDSLRAQFGTDKKMNAMHGADSKETAAREMAFLLPNFSVP-IVPGTGPPPTIEKTLALIRPSALKDHKDEMLQKIQEAGFEVCLQKMVQLTEDQAKEFYKEQEGTPHFEDLIREMTSGEVLALGLAKESAIQSWREFIGPTTIDEAKEKAPDSLRAQYSIPDTQVNVVHGSDSVDTAEKELGFFFPKQTTLAVIKPDAAGEHKEAIIEKIKEAGFNISLQRDVELNKELASKLYLEHEGKEFYENLIDHMSSGLSMVMVLSREDAVDGWRTLMGPTDPDYAREHAPESLRALLGKDVLQNAVHGSSNPEEAKTRIERLFPDVEVLPGGEV 633          

HSP 2 Score: 94.3597 bits (233), Expect = 2.359e-18
Identity = 54/154 (35.06%), Postives = 90/154 (58.44%), Query Frame = 2
Query:  527 REVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNV 988
            ++ TLA+IKPD     K + II K+ E G  I  Q+D  L  E A + Y      E +E+LI  ++SG S ++VL++ DA  +  +R L+GP   D A+E++P+S+RA+ G + ++NA+HG+ + + A+  +   FPD  V     VK   +++
Sbjct:  490 KQTTLAVIKPDAAGEHK-EAIIEKIKEAGFNISLQRDVELNKELASKLYLEHEGKEFYENLIDHMSSGLSMVMVLSREDA--VDGWRTLMGPTDPDYAREHAPESLRALLGKDVLQNAVHGSSNPEEAKTRIERLFPDVEVLPGGEVKDSVASI 640          
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Match: sp|Q8N427|TXND3_HUMAN (Thioredoxin domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NME8 PE=2 SV=2)

HSP 1 Score: 357.066 bits (915), Expect = 8.632e-111
Identity = 206/599 (34.39%), Postives = 340/599 (56.76%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIH-----------------------EFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            MA KK+E+ LQ  IN Q  WDE+++ +GL V+DVYQ WCGPC+A+   FR++KNE+ +D  L+FAVA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K+  GEM R +  +  L D  +D +V E +   E ++   ++A+IKPD V + KV EI  K+ + G  I A+    LT E+   FY  +AD   FE+ + F+ SG S ILV+++G     H                       E    + P  +    +N   S++       +       +D     + +  FFPDF        K ++  +++TLAL+RP  + E ++ +L  I +  FK+  Q++V L+++EA     +++++ +F +LI+ M+ G  LAL L + N +Q W+ +LGP+ VE+A E  P SL AQF+ + + VN ++GSDS ETAE E+++FFP++ T+  IKP    E  E+I   + +A F + ++K++ +     E+ Y   + ++++ DL+  +  GP+  M+L++ +A+  WR L+GP DP+ A+   PDSIRA +G    KN V+G+ N  E + V+N +F
Sbjct:    1 MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVD--SDSEVSE-ESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSK---HNPPSEETEPQTDTEPNERSEDQPEVEAQVTPGMM----KNKQDSLQEYLERQHLAQLCDIEEDAANVAKFMDAFFPDFK-------KMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLF 582          

HSP 2 Score: 78.1814 bits (191), Expect = 1.882e-13
Identity = 48/151 (31.79%), Postives = 84/151 (55.63%), Query Frame = 2
Query:  512 LEEIEREV--------TLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD 940
            LE  ERE+        TL LIKP      + ++I+  + E G ++   +   LT E+ ++ Y  +   + ++DL++ ++ GPS +++L K +A  + E+R L+GP   +EAK  SP SIRA +G + ++N +HGA +   A+  +   F D
Sbjct:  437 LETAEREIQHFFPLQSTLGLIKPHATSEQR-EQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNA--VAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFED 584          
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Match: sp|Q715S9|TXND3_RAT (Thioredoxin domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nme8 PE=2 SV=2)

HSP 1 Score: 338.961 bits (868), Expect = 5.295e-104
Identity = 204/596 (34.23%), Postives = 336/596 (56.38%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREV-TLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKG-DAGIIHE-------------FRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEE-EIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEF 1801
            MA KK+E+ LQ+ +N+Q  WDE++  +GL V+DVYQ WCGPCKAV   FR++KNE+ +D  L+F VA+AD+I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K+  GEM R +  +  L D   DE+  EV     E   EV  +A+I PD V   K  EI  K+ + G  I  Q++  L  E A+EFY+HM D   FE+ +  + +  S +L++++G D  +I E               E    +F     +    S++       + +  H  DD     + +   FPDF   K       ++NVQRTL L+ P    E ++++L+ I N GF + MQ++V L++EEA    + H+D+ +F+ LI  M       L L ++++V+ W+ ++GPK VE+A    P+SL  +F+  +  VN  +GS S   AETE+++FFP + T+A IKP     E  EI   I DA+F++ ++K + +    A + Y   + ++++ +++  + SG +  M+L++ +A+  WR ++GP DP+ A+   P+S+RA YG D+ +NAV+G+ N SE    ++ +F +  F
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQALFRKLKNELNEDELLHFVVAEADSIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVIALIDEEKKIAAGEMARPQYVEIPLVD-SLDEEYGEVHY---ESNVEVYNMAVINPDAVLMRKNLEIKEKITKEGFIIEIQENMLLPEEVAREFYNHMIDEPDFEEFVYSMTNRLSCVLIISQGEDTEVIEEEALPQSDDEEEPDPLEEPHVRFAPMLVKKKRDSLQEYMDRQHMSDYCHVEDDAVKVSKFIDILFPDFKTMK-------STNVQRTLGLLYPEVCEEEKDNVLDIIQNEGFTILMQRQVVLSEEEARAVCHVHEDEDYFDNLIGYMCSNNSYILVLMREHSVERWKELIGPKTVEEAYASHPDSLCVRFASGNFPVNQFYGSSSKAAAETEIEHFFPPQSTLALIKPHVSHKERMEILKAIRDARFELTQMKEMHLTPEHASKVYFKITGKDFYKNVLDVLSSGMSVVMILTKWNAVGEWRRMMGPVDPEEAKLLSPNSLRARYGIDVLRNAVHGASNMSEAATAISNVFTESNF 585          
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Match: sp|Q715T0|TXND3_MOUSE (Thioredoxin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Nme8 PE=2 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.081e-103
Identity = 196/593 (33.05%), Postives = 329/593 (55.48%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA-----------------GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEE-EIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            MA KK+E+ LQ+ +N+Q  WDE++  +GL V+DVYQ WCGPCKAV + FR++KNE+ +D  L+F VA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K++ GEM+R +  +  L D   DE+  EV    E       +A+IKPD V   K  E+  K+ + G  I  Q++  L  E  +EFY H+AD   FE+ +  + +G S +L++++ D+                 G++ E      P  + + ++    S++       + +     DD     + +   FPDF   K       ++NVQ TLAL+ P    E ++ +L  I+N GF + MQ+++ L++EEA      H+++ +F+ LI  M+      LAL ++N V+ W+ ++GPK +E+A    P SL  QF+  +   N  +GS S   AE E+ +FFP + T+A IKP     E  EI   I +A F++  +K + +    A + Y   + ++++ +++  +  G +  MVL++ +A+  WR ++GP DP+ A+   P+S+RA YG DI +NAV+G+ N SE   +++ +F
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQYVEIPLVD-AIDEEYGEVQ--YESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVIQEETLPQTDTEEEPGVLEEPHVRFAPVMIKKKRD----SLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPDFKTMK-------STNVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKPHVTHKERMEILKTIKEAGFELTLMKEMHLTPEHANKIYFKITGKDFYKNVLEVLSLGMSLVMVLTKWNAVAEWRRMVGPVDPEEAKLLSPESLRAKYGLDILRNAVHGASNFSEASEIISNVF 579          
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Match: gnl|BL_ORD_ID|23495143 (tr|A0A210QRC6|A0A210QRC6_MIZYE Thioredoxin domain-containing protein 3-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24243 PE=3 SV=1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 316/590 (53.56%), Postives = 431/590 (73.05%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLA--DFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLL 1822
            MAR+KQEI LQ EI TQEEW++++ KEGL V+DVYQ+WCGPC  +I   +R+KNE+GDD L+FA+AKADTID+LEKYRG C+PCFL Y G  LV VIRGAN P++  T+  +L++EH+V+ G  ER E KD +++  D  +++  ++ ++  +E ++EVT+A+IKPD VKAGKVDEII  +  +GIEIL Q++R +T +EAK  Y H+ D + F DLI F+ SGPS ILVL KG  G  II+EFR+LIGP  +++AKE  P+S+RA +G  +  NA+HG+   D A RELAFFFPDF +P           +QRTLAL+RP A+  +++ +++ IN AGFKVA+QKE+ LTKE A  FY +H+ + +F EL   MS G L+AL L +++AV+GWR MLGPK+++KAKE  P+SLRA+F+ ED+ +N  HGSDS+  A+ EL +FFPV+QTIA IKPD +  ++EI  K+ DA FKI   K  T+ + +AEEFYSD   ++Y+NDL+ HM SGPT FMVLSREDA+ GWRSLIGP DP+ A++  PDS+RA+YG DI KNAV+GS N  + +  +  IFG L+F  +G L+
Sbjct:   10 MARRKQEIQLQQEIETQEEWEDIMSKEGLYVIDVYQEWCGPCSGLIANLKRLKNELGDDLLHFAIAKADTIDALEKYRGHCQPCFLFYAGGMLVAVIRGANSPMVMRTVTEQLQQEHRVIDGAAERKEIKDPYISMVDNMSNDADEDEEEAEDESKKEVTVAVIKPDAVKAGKVDEIIEDIKAHGIEILKQEERLMTEDEAKNIYTHLQDEDFFNDLITFMTSGPSHILVLTKGRTGENIINEFRDLIGPTSVEDAKEKQPESLRAKHGEKTFMNALHGSSSDDQAMRELAFFFPDFAIP----ASEGKPKLQRTLALIRPDAFKLHKDEVMQMINEAGFKVALQKEMSLTKEMAEDFYREHEGQEYFNELTTRMSSGPLMALGLAREDAVEGWRSMLGPKELDKAKEESPDSLRAKFALEDVAINQFHGSDSEAAAQKELDFFFPVQQTIAVIKPDALGTKDEIIEKVHDAGFKIAARKETTLSREIAEEFYSDHKDKDYYNDLVEHMSSGPTMFMVLSREDAVDGWRSLIGPTDPEKAKEESPDSLRALYGGDILKNAVHGSSNVDQAKTTIQKIFGDLKFTPEGLLI 595          
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Match: gnl|BL_ORD_ID|20303730 (tr|A0A1S3IQQ0|A0A1S3IQQ0_LINUN thioredoxin domain-containing protein 3 homolog isoform X6 OS=Lingula unguis OX=7574 GN=LOC106166507 PE=3 SV=1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 319/589 (54.16%), Postives = 430/589 (73.01%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV--QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA-GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA-SNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1819
            MA KK+EI LQ +I TQEEW+E + KEGLLVVDVYQ+W GPCKA++   R++K E+ DD+L+FA AKADTID+LEKYRG+C+PCFL + G  LV V+RGAN PV+E T+K +L +EHKVM+G  ER E +D  L + E ++    +E  +  E  ++EVT+A+IKPD VKAGKV+EI+ ++ E GIE+LAQ++R LT EEA+EFY    D E FEDL+ F++SGPS +LVL KG   GII E+R+L+GP  ++EAKE +P S+RA +G+    NA+HG+D +DTA RELAFFFP+F++P     K  A   VQRTLAL+RP A TE++++ILEKI  AGF +AMQKEVQLTKE+A  FY +HKD+P+FEEL   MS G LLAL+L + +AV  WRGMLGPK+V+KAKE  P SLRAQF+ E +++N +HGSDS  TA+ EL+YFFP++QT+A +KPD  + ++EI   I +A F I   K   +   + ++ Y +   +EY+ DL+ HM SGPT FMVLS+E+A+ GWR +IGP DP  A++  PDSIRA +G D+  NAV+GS +    +  +  IFG L F +DG+L
Sbjct:    1 MAGKKKEIVLQVQIETQEEWEEFMTKEGLLVVDVYQEWSGPCKAMVTNLRKLKMELSDDYLHFATAKADTIDALEKYRGKCQPCFLFFAGGCLVAVVRGANAPVIERTLKDQLAQEHKVMEGIAERKEIRDPALGEEEKEKGGLDEEETEKEEAPKKEVTVAIIKPDAVKAGKVEEILEQMKEAGIEVLAQEERQLTDEEAREFYSAQQDQEHFEDLVSFMSSGPSHVLVLTKGSGEGIIQEWRDLLGPTSVEEAKEQAPDSLRAKFGSEKYFNALHGSDSQDTATRELAFFFPNFVMPGSPAAKSAAKPQVQRTLALIRPDALTEHKDAILEKIQEAGFTIAMQKEVQLTKEQAEEFYKEHKDQPYFEELTNRMSCGPLLALSLARDDAVDAWRGMLGPKEVDKAKEEAPESLRAQFAVEGVEINPVHGSDSPTTAQQELEYFFPMQQTLAVVKPDAYKTKDEIMELIKEAGFHIAARKETELTPDIVQQLYKEHEGKEYYGDLVEHMTSGPTLFMVLSKENAVEGWRGIIGPTDPAKAKEEAPDSIRAQFGSDVKANAVHGSSDVEHAKEAITAIFGDLVFEKDGTL 589          
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Match: gnl|BL_ORD_ID|20333760 (tr|A0A1S3ISM9|A0A1S3ISM9_LINUN thioredoxin domain-containing protein 3 homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106166507 PE=3 SV=1)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 313/590 (53.05%), Postives = 428/590 (72.54%), Query Frame = 2
Query:   62 IMARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV--QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA-GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEAS-NVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1819
            +  + K+E A+  +I TQEEW+E + KEGL+VVDVYQ+W GPCKA++   R++K E+ DD+L+FA AKADTID+LEKYRG+C+PCFL + G  LV V+RGAN PV+E T+K +L +EHKVM+G  ER E +D  L + E ++    +E  +  E  ++EVT+A+IKPD VKAGKV+EI+ ++ E GIE+LAQ++R LT EEA+EFY    D E FEDL+ F++SGPS +LVL KG   GII E+R+L+GP  ++EAKE +P S+RA +G+    NA+HG+D +DTA RELAFFFP+F++P     K  A   VQRTLAL+RP A TE++++ILEKI  AGF +AMQKEVQLTKE+A  FY +HKD+P+FEEL   MS G LLAL+L + +AV  WRGMLGPK+V+KAKE  P SLRAQF+ E +++N +HGSDS  TA+ EL+YFFP++QT+A +KPD  + ++EI   I +A F I   K   +   + ++ Y +   +EY+ DL+ HM SGPT FMVLS+E+A+ GWR +IGP DP  A++  PDSIRA +G D+  NAV+GS +    +  +  IFG L F +DG+L
Sbjct:    1 MAGKGKKEAAIAVDIGTQEEWEECLAKEGLIVVDVYQEWSGPCKAMVTNLRKLKMELSDDYLHFATAKADTIDALEKYRGKCQPCFLFFAGGCLVAVVRGANAPVIERTLKDQLAQEHKVMEGIAERKEIRDPALGEEEKEKGGLDEEETEKEEAPKKEVTVAIIKPDAVKAGKVEEILEQMKEAGIEVLAQEERQLTDEEAREFYSAQQDQEHFEDLVSFMSSGPSHVLVLTKGSGEGIIQEWRDLLGPTSVEEAKEQAPDSLRAKFGSEKYFNALHGSDSQDTATRELAFFFPNFVMPGSPAAKSAAKPQVQRTLALIRPDALTEHKDAILEKIQEAGFTIAMQKEVQLTKEQAEEFYKEHKDQPYFEELTNRMSCGPLLALSLARDDAVDAWRGMLGPKEVDKAKEEAPESLRAQFAVEGVEINPVHGSDSPTTAQQELEYFFPMQQTLAVVKPDAYKTKDEIMELIKEAGFHIAARKETELTPDIVQQLYKEHEGKEYYGDLVEHMTSGPTLFMVLSKENAVEGWRGIIGPTDPAKAKEEAPDSIRAQFGSDVKANAVHGSSDVEHAKEAITAIFGDLVFEKDGTL 590          
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Match: gnl|BL_ORD_ID|20323686 (tr|A0A1S3IRI1|A0A1S3IRI1_LINUN thioredoxin domain-containing protein 3 homolog isoform X2 OS=Lingula unguis OX=7574 GN=LOC106166507 PE=3 SV=1)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 313/592 (52.87%), Postives = 428/592 (72.30%), Query Frame = 2
Query:   62 IMARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV--QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADS--EIFEDLIKFIASGPSKILVLAKGDA-GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA-SNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1819
            +  + K+E A+  +I TQEEW+E + KEGL+VVDVYQ+W GPCKA++   R++K E+ DD+L+FA AKADTID+LEKYRG+C+PCFL + G  LV V+RGAN PV+E T+K +L +EHKVM+G  ER E +D  L + E ++    +E  +  E  ++EVT+A+IKPD VKAGKV+EI+ ++ E GIE+LAQ++R LT EEA+EFY    D   E FEDL+ F++SGPS +LVL KG   GII E+R+L+GP  ++EAKE +P S+RA +G+    NA+HG+D +DTA RELAFFFP+F++P     K  A   VQRTLAL+RP A TE++++ILEKI  AGF +AMQKEVQLTKE+A  FY +HKD+P+FEEL   MS G LLAL+L + +AV  WRGMLGPK+V+KAKE  P SLRAQF+ E +++N +HGSDS  TA+ EL+YFFP++QT+A +KPD  + ++EI   I +A F I   K   +   + ++ Y +   +EY+ DL+ HM SGPT FMVLS+E+A+ GWR +IGP DP  A++  PDSIRA +G D+  NAV+GS +    +  +  IFG L F +DG+L
Sbjct:    1 MAGKGKKEAAIAVDIGTQEEWEECLAKEGLIVVDVYQEWSGPCKAMVTNLRKLKMELSDDYLHFATAKADTIDALEKYRGKCQPCFLFFAGGCLVAVVRGANAPVIERTLKDQLAQEHKVMEGIAERKEIRDPALGEEEKEKGGLDEEETEKEEAPKKEVTVAIIKPDAVKAGKVEEILEQMKEAGIEVLAQEERQLTDEEAREFYSAQQDQFKEHFEDLVSFMSSGPSHVLVLTKGSGEGIIQEWRDLLGPTSVEEAKEQAPDSLRAKFGSEKYFNALHGSDSQDTATRELAFFFPNFVMPGSPAAKSAAKPQVQRTLALIRPDALTEHKDAILEKIQEAGFTIAMQKEVQLTKEQAEEFYKEHKDQPYFEELTNRMSCGPLLALSLARDDAVDAWRGMLGPKEVDKAKEEAPESLRAQFAVEGVEINPVHGSDSPTTAQQELEYFFPMQQTLAVVKPDAYKTKDEIMELIKEAGFHIAARKETELTPDIVQQLYKEHEGKEYYGDLVEHMTSGPTLFMVLSKENAVEGWRGIIGPTDPAKAKEEAPDSIRAQFGSDVKANAVHGSSDVEHAKEAITAIFGDLVFEKDGTL 592          
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Match: gnl|BL_ORD_ID|20307003 (tr|A0A1S3IR48|A0A1S3IR48_LINUN thioredoxin domain-containing protein 3 homolog isoform X3 OS=Lingula unguis OX=7574 GN=LOC106166507 PE=3 SV=1)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 313/592 (52.87%), Postives = 428/592 (72.30%), Query Frame = 2
Query:   62 IMARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV--QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADS--EIFEDLIKFIASGPSKILVLAKGDA-GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA-SNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1819
            +  + K+E A+  +I TQEEW+E + KEGL+VVDVYQ+W GPCKA++   R++K E+ DD+L+FA AKADTID+LEKYRG+C+PCFL + G  LV V+RGAN PV+E T+K +L +EHKVM+G  ER E +D  L + E ++    +E  +  E  ++EVT+A+IKPD VKAGKV+EI+ ++ E GIE+LAQ++R LT EEA+EFY    D   E FEDL+ F++SGPS +LVL KG   GII E+R+L+GP  ++EAKE +P S+RA +G+    NA+HG+D +DTA RELAFFFP+F++P     K  A   VQRTLAL+RP A TE++++ILEKI  AGF +AMQKEVQLTKE+A  FY +HKD+P+FEEL   MS G LLAL+L + +AV  WRGMLGPK+V+KAKE  P SLRAQF+ E +++N +HGSDS  TA+ EL+YFFP++QT+A +KPD  + ++EI   I +A F I   K   +   + ++ Y +   +EY+ DL+ HM SGPT FMVLS+E+A+ GWR +IGP DP  A++  PDSIRA +G D+  NAV+GS +    +  +  IFG L F +DG+L
Sbjct:    1 MAGKGKKEAAIAVDIGTQEEWEECLAKEGLIVVDVYQEWSGPCKAMVTNLRKLKMELSDDYLHFATAKADTIDALEKYRGKCQPCFLFFAGGCLVAVVRGANAPVIERTLKDQLAQEHKVMEGIAERKEIRDPALGEEEKEKGGLDEEETEKEEAPKKEVTVAIIKPDAVKAGKVEEILEQMKEAGIEVLAQEERQLTDEEAREFYSAQQDQFKEHFEDLVSFMSSGPSHVLVLTKGSGEGIIQEWRDLLGPTSVEEAKEQAPDSLRAKFGSEKYFNALHGSDSQDTATRELAFFFPNFVMPGSPAAKSAAKPQVQRTLALIRPDALTEHKDAILEKIQEAGFTIAMQKEVQLTKEQAEEFYKEHKDQPYFEELTNRMSCGPLLALSLARDDAVDAWRGMLGPKEVDKAKEEAPESLRAQFAVEGVEINPVHGSDSPTTAQQELEYFFPMQQTLAVVKPDAYKTKDEIMELIKEAGFHIAARKETELTPDIVQQLYKEHEGKEYYGDLVEHMTSGPTLFMVLSKENAVEGWRGIIGPTDPAKAKEEAPDSIRAQFGSDVKANAVHGSSDVEHAKEAITAIFGDLVFEKDGTL 592          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 277/588 (47.11%), Postives = 395/588 (67.18%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDE----KVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIAR----VKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKL 1795
            MA KK+E++LQ  I   E+W E++  +GL VVDVYQ WCGPC+AVI+ FR++KNE+GDD L+FAVA+AD+I+ LEKYRG+CEP FL Y G  LV V+RGAN P+L+  +  +L +E +V++  ++R   KD  L D E  E     +Q  +  L    R  T+A+IKPDIV  GK DEII K+ + G EILA ++R LT  EA+EFY H A    F++L++F++SGPS +LV++K  G   +I  +RE +GP  ++EAK   P S+RA YG+ ++ NA+HG+ D + A RELAFFFP+F      R       E   V+RTLAL+RP    E RE IL KI+ AGFKVAMQKEV LT+E+  LFY++H+++ +F  L+K M+ G +LALAL KQ AV+ WR +LGPKD ++AKE  P SLRAQF+ E   VN +HGS S E AE E+ +FFP EQT+A IKPD   E+ +EI  +I    F I +++   + + +AEEFY +   + +F+ L+ +M  GP   ++L++E+A+  WR+++GP DP  A++  P S+RA + +DI +NAV+GS N    Q  ++ +FG++
Sbjct:    1 MAGKKKEVSLQVSIGNDEQWGEMLVCKGLTVVDVYQQWCGPCRAVISLFRKIKNELGDDLLHFAVAEADSINVLEKYRGKCEPTFLFYAGGELVAVLRGANAPLLQRIVVEELVKEKRVLEQGVQRIVVKDEGLVDEEEQEDDAGPIQNDEDILVTDNRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPKEQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCRGPCTMLILTKENAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLFGEI 588          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 502.671 bits (1293), Expect = 1.612e-166
Identity = 261/588 (44.39%), Postives = 375/588 (63.78%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDE----KVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIAR----VKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKL 1795
            MA KK+E++LQ  I   E+W E++  +GL VVDVYQ WCGPC+AVI+ FR++KNE+GDD L+FAV                        G  LV V+RGAN P+L+  +  +L +E +V++  ++R   KD  L D E  E     +Q  +  L    R  T+A+IKPDIV  GK DEII K+ + G EILA ++R LT  EA+EFY H A    F++L++F++SGPS +LV++K  G   +I  +RE +GP  ++EAK   P S+RA YG+ ++ NA+HG+ D + A RELAFFFP+F      R       E   V+RTLAL+RP    E RE IL KI+ AGFKVAMQKEV LT+E+  LFY++H+++ +F  L+K M+ G +LALAL KQ AV+ WR +LGPKD ++AKE  P SLRAQF+ E   VN +HGS S E AE E+ +FFP EQT+A IKPD   E+ +EI  +I    F I +++   + + +AEEFY +   + +F+ L+ +M  GP   ++L++E+A+  WR+++GP DP  A++  P S+RA + +DI +NAV+GS N    Q  ++ +FG++
Sbjct:    1 MAGKKKEVSLQVSIGNDEQWGEMLVCKGLTVVDVYQQWCGPCRAVISLFRKIKNELGDDLLHFAV------------------------GGELVAVLRGANAPLLQRIVVEELVKEKRVLEQGVQRIVVKDEGLVDEEEQEDDAGPIQNDEDILVTDNRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPKEQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCRGPCTMLILTKENAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLFGEI 564          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 461.07 bits (1185), Expect = 1.253e-152
Identity = 240/495 (48.48%), Postives = 333/495 (67.27%), Query Frame = 2
Query:  128 ELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDE----KVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIAR----VKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHM 1579
            E++  +GL VVDVYQ WCGPC+AVI+ FR++KNE+GDD L+FAVA+AD+I+ LEKYRG+CEP FL Y G  LV V+RGAN P+L+  +  +L +E +V++  ++R   KD  L D E  E     +Q  +  L    R  T+A+IKPDIV  GK DEII K+ + G EILA ++R LT  EA+EFY H A    F++L++F++SGPS +LV++K  G   +I  +RE +GP  ++EAK   P S+RA YG+ ++ NA+HG+ D + A RELAFFFP+F      R       E   V+RTLAL+RP    E RE IL KI+ AGFKVAMQKEV LT+E+  LFY++H+++ +F  L+K M+ G +LALAL KQ AV+ WR +LGPKD ++AKE  P SLRAQF+ E   VN +HGS S E AE E+ +FFP EQT+A IKPD   E+ +EI  +I    F I +++   + + +AEEFY +   + +F+ L+ +M
Sbjct:    1 EMLVCKGLTVVDVYQQWCGPCRAVISLFRKIKNELGDDLLHFAVAEADSINVLEKYRGKCEPTFLFYAGGELVAVLRGANAPLLQRIVVEELVKEKRVLEQGVQRIVVKDEGLVDEEEQEDDAGPIQNDEDILVTDNRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPKEQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYM 495          

HSP 2 Score: 178.333 bits (451), Expect = 1.976e-47
Identity = 104/297 (35.02%), Postives = 161/297 (54.21%), Query Frame = 2
Query:  983 NVQRTLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQ----NAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP--------------------VEQTIAAIKPD-GIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIY-GRDINKNAVYGSDNESEVQRVMNLIFGK 1792
            N   T+A+++P      + + I+ KI +AGF++   +E  LT+ EA  FY     +P+F+EL++ MS G    L + K     + +  WR  LGP D+E+AK   P+SLRAQ+  E +  N +HGS   E A  EL +FFP                    VE+T+A I+PD   EN E I  KI  A FK+   K + + +     FYS+  ++EYF  L+  M SGP   + L+++ A+  WR+L+GPKDPK A++  P+S+RA + G     N ++GS +  E ++ ++  F K
Sbjct:  137 NRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETL-FNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPK 432          

HSP 3 Score: 141.739 bits (356), Expect = 3.967e-35
Identity = 80/224 (35.71%), Postives = 131/224 (58.48%), Query Frame = 2
Query:  515 EEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIY-GTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSK 1183
            E +ER  TLALI+PD  +  + + I+AK+H+ G ++  Q++  LT E+   FY    + E F  L+K + SGP  +L LA    G +  +R L+GPK   +AKE+ P+S+RA + G +   N +HG+   + A++E++FFFP                 ++TLA+++P    E+R+ ILE+I   GF ++  +E  L++E A  FY +H+DKPFF +L+  M +
Sbjct:  295 EPVER--TLALIRPDTARENR-EMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGP--VLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPK----------------EQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCR 497          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 151.754 bits (382), Expect = 7.151e-40
Identity = 92/275 (33.45%), Postives = 149/275 (54.18%), Query Frame = 2
Query:  977 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEF---YSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1747
             S  +RTLA+++P A T+  + I++ I +AG  V   +  +L+ ++AA FY +H+ K FF  L++ +S G ++ + L    AV  WR +LGP D   A++    SLRAQF  +  K N  HGSDS  +A  EL++FFP              + T   IKP  +      +I N I +A F+I  ++  +++++ AEEF   Y     +  +  L+A + SGP   + +   DA R +R   GP DP+ A    P ++RA+YG++  +NAV+ +D
Sbjct:   52 GSQKERTLAMIKPDAVTKVGD-IIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTK-NAGHGSDSMASAARELEFFFPSTAGHSPPNTAKFSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTE--YTSLVAELCSGPCMALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQNAVHCTD 322          

HSP 2 Score: 145.206 bits (365), Expect = 1.169e-37
Identity = 89/296 (30.07%), Postives = 157/296 (53.04%), Query Frame = 2
Query:  524 EREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQR----TLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1393
            ++E TLA+IKPD V   KV +II  +++ G+ +   +   L+ ++A +FY        F +L++F++SGP  ++ L   +A  +  +R+++GP     A++++  S+RA +GT+  +NA HG+D   +A REL FFFP       +   H   N  +    T  +++P A +E     IL  I  AGF+++  +   L +  A  F   +K     +  L+ E+  G  +AL +   +A + +R   GP D E A+ + P +LRA + K  ++ N +H +D  E    E++YFF +
Sbjct:   54 QKERTLAMIKPDAVT--KVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEA--VSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFP-------STAGHSPPNTAKFSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTEYTSLVAELCSGPCMALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQ-NAVHCTDLPEDGLLEVQYFFKI 337          

HSP 3 Score: 89.7373 bits (221), Expect = 8.936e-19
Identity = 43/131 (32.82%), Postives = 68/131 (51.91%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            E+T+A IKPD +    +I   I DA   + K +   +    A +FY +   + +FN+L+  + SGP   M L  ++A+  WR ++GP D   A      S+RA +G D  KNA +GSD+ +   R +   F
Sbjct:   56 ERTLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFF 186          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 150.599 bits (379), Expect = 3.632e-39
Identity = 92/275 (33.45%), Postives = 149/275 (54.18%), Query Frame = 2
Query:  977 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEF---YSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1747
             S  +RTLA+++P A T+  + I++ I +AG  V   +  +L+ ++AA FY +H+ K FF  L++ +S G ++ + L    AV  WR +LGP D   A++    SLRAQF  +  K N  HGSDS  +A  EL++FFP              + T   IKP  +      +I N I +A F+I  ++  +++++ AEEF   Y     +  +  L+A + SGP   + +   DA R +R   GP DP+ A    P ++RA+YG++  +NAV+ +D
Sbjct:   86 GSQKERTLAMIKPDAVTKVGD-IIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTK-NAGHGSDSMASAARELEFFFPSTAGHSPPNTAKFSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTE--YTSLVAELCSGPCMALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQNAVHCTD 356          

HSP 2 Score: 144.821 bits (364), Expect = 3.918e-37
Identity = 89/296 (30.07%), Postives = 157/296 (53.04%), Query Frame = 2
Query:  524 EREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQR----TLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1393
            ++E TLA+IKPD V   KV +II  +++ G+ +   +   L+ ++A +FY        F +L++F++SGP  ++ L   +A  +  +R+++GP     A++++  S+RA +GT+  +NA HG+D   +A REL FFFP       +   H   N  +    T  +++P A +E     IL  I  AGF+++  +   L +  A  F   +K     +  L+ E+  G  +AL +   +A + +R   GP D E A+ + P +LRA + K  ++ N +H +D  E    E++YFF +
Sbjct:   88 QKERTLAMIKPDAVT--KVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEA--VSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFP-------STAGHSPPNTAKFSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTEYTSLVAELCSGPCMALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQ-NAVHCTDLPEDGLLEVQYFFKI 371          

HSP 3 Score: 89.3521 bits (220), Expect = 1.760e-18
Identity = 43/131 (32.82%), Postives = 68/131 (51.91%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            E+T+A IKPD +    +I   I DA   + K +   +    A +FY +   + +FN+L+  + SGP   M L  ++A+  WR ++GP D   A      S+RA +G D  KNA +GSD+ +   R +   F
Sbjct:   90 ERTLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFF 220          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008106.1 (pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 gene:ENSPMAG00000007330.1 transcript:ENSPMAT00000008106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 1.996e-27
Identity = 46/120 (38.33%), Postives = 72/120 (60.00%), Query Frame = 2
Query: 1445 IFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1804
            +   I +A F I   K + + +  A EFY +   Q+YF  L+ HM  GP+  +VL+REDA+  WR L+GP DP  A  T P+S+RA + R + +NA++G+ N    Q  ++L+FG + F+
Sbjct:    7 VLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNREDAVEEWRRLMGPADPDVARKTAPESLRARFARSLLENALHGASNLHHAQENIHLLFGDISFS 126          

HSP 2 Score: 96.6709 bits (239), Expect = 7.242e-24
Identity = 45/117 (38.46%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1037 ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1387
            +++L  I  AGF +AMQKEV LT+E+A  FY +H+ + +F  L+K M++G  L L L +++AV+ WR ++GP D + A++  P SLRA+F++  ++ N +HG+ +   A+  +   F
Sbjct:    5 DTVLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNREDAVEEWRRLMGPADPDVARKTAPESLRARFARSLLE-NALHGASNLHHAQENIHLLF 120          

HSP 3 Score: 83.1889 bits (204), Expect = 3.088e-19
Identity = 44/121 (36.36%), Postives = 70/121 (57.85%), Query Frame = 2
Query:  578 VDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD 940
             D ++  + E G  I  Q++  LT E+A+EFY      + F  L+K +  GPS +LVL + DA  + E+R L+GP   D A++ +P+S+RA +  + +ENA+HGA +   AQ  +   F D
Sbjct:    4 ADTVLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNREDA--VEEWRRLMGPADPDVARKTAPESLRARFARSLLENALHGASNLHHAQENIHLLFGD 122          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Sea Lamprey
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 95.5153 bits (236), Expect = 5.951e-23
Identity = 48/139 (34.53%), Postives = 78/139 (56.12%), Query Frame = 2
Query: 1391 VEQTIAAIKPDGIENE---EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLE 1798
            ++ T+A +KPD + +    E +   +L  KF IVK K + +++S +E FY+    + +F  L+  M SGP    VL+  DA+RGWR L+GP     A  T P+SIRA YG    +N  +GSD+ +   + ++  F + +
Sbjct:   10 LQLTLALLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHHDAVRGWRELMGPTKVFRAVHTAPESIRACYGLTDTRNTTHGSDSSASALQEISFFFPEFD 148          

HSP 2 Score: 95.1301 bits (235), Expect = 9.363e-23
Identity = 51/141 (36.17%), Postives = 83/141 (58.87%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAK-LHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMV 949
            ++TLAL+KPD +  G   E + + + +N   I+  ++  L   +++ FY        F+ L++F+ASGP ++ VLA  DA  +  +REL+GP  +  A   +P+SIRA YG     N  HG+D   +A +E++FFFP+F V
Sbjct:   11 QLTLALLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHHDA--VRGWRELMGPTKVFRAVHTAPESIRACYGLTDTRNTTHGSDSSASALQEISFFFPEFDV 149          

HSP 3 Score: 92.8189 bits (229), Expect = 4.686e-22
Identity = 48/137 (35.04%), Postives = 77/137 (56.20%), Query Frame = 2
Query:  986 VQRTLALVRPAAYTE--YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1390
            +Q TLAL++P A       E++ + +    F +   KE++L + ++  FY  HK K FF+ L++ M+ G +    L   +AV+GWR ++GP  V +A    P S+RA +   D + N  HGSDS  +A  E+ +FFP
Sbjct:   10 LQLTLALLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHHDAVRGWRELMGPTKVFRAVHTAPESIRACYGLTDTR-NTTHGSDSSASALQEISFFFP 145          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Sea Lamprey
Match: nme3 (NME/NM23 nucleoside diphosphate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-000210-34])

HSP 1 Score: 77.0258 bits (188), Expect = 1.408e-16
Identity = 41/133 (30.83%), Postives = 71/133 (53.38%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            E+T+ AIKPDG++     +I  +      K+V +K +    +L ++ Y D   + +++ L+  M SGP   MV      +R  R ++G  DP    D+ P +IR  +  DI +N ++GSD+E   Q+ ++L F
Sbjct:   21 ERTLLAIKPDGVQRRLMGDIVKRFEGKGLKLVAMKFLKPPVALLQQHYIDLKDKAFYSSLVQFMNSGPVLAMVWEGNGVVRTCRRMLGETDPA---DSAPGTIRGDFCIDIGRNVIHGSDSEESAQKEISLWF 150          

HSP 2 Score: 65.855 bits (159), Expect = 9.457e-13
Identity = 35/139 (25.18%), Postives = 73/139 (52.52%), Query Frame = 2
Query:  518 EIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 934
            E   E TL  IKPD V+   + +I+ +    G++++A +     +   ++ Y  + D   +  L++F+ SGP  +L +     G++   R ++G     +  +++P +IR  +  +   N IHG+D  ++AQ+E++ +F
Sbjct:   17 EPRHERTLLAIKPDGVQRRLMGDIVKRFEGKGLKLVAMKFLKPPVALLQQHYIDLKDKAFYSSLVQFMNSGP--VLAMVWEGNGVVRTCRRMLGET---DPADSAPGTIRGDFCIDIGRNVIHGSDSEESAQKEISLWF 150          

HSP 3 Score: 65.4698 bits (158), Expect = 1.542e-12
Identity = 45/143 (31.47%), Postives = 70/143 (48.95%), Query Frame = 2
Query:  989 QRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALF---YNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTI 1405
            +RTL  ++P          I+++    G K+   K     K   AL    Y   KDK F+  L++ M+ G +LA+  E    V+  R MLG  D   +    P ++R  F   DI  N+IHGSDS+E+A+ E+  +F  E+ +
Sbjct:   21 ERTLLAIKPDGVQRRLMGDIVKRFEGKGLKLVAMK---FLKPPVALLQQHYIDLKDKAFYSSLVQFMNSGPVLAMVWEGNGVVRTCRRMLGETDPADSA---PGTIRGDFCI-DIGRNVIHGSDSEESAQKEISLWFQPEELV 156          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Yeast
Match: YNK1 (Nucleoside diphosphate kinase; catalyzes the transfer of gamma phosphates from nucleoside triphosphates, usually ATP, to nucleoside diphosphates by a mechanism that involves formation of an autophosphorylated enzyme intermediate; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001550])

HSP 1 Score: 80.1073 bits (196), Expect = 5.239e-18
Identity = 41/138 (29.71%), Postives = 76/138 (55.07%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEF 1801
            E+T  A+KPDG++     +I ++     +K+V IK +  +  L E+ Y++   + +F  +++ M+SGP    V   +D +R  R+++G  +P  +    P +IR  +G D+ +N  +GSD+    +R +NL F K E 
Sbjct:    6 ERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSA---PGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEEL 140          

HSP 2 Score: 63.5438 bits (153), Expect = 3.248e-12
Identity = 42/144 (29.17%), Postives = 71/144 (49.31%), Query Frame = 2
Query:  977 ASNVQRTLALVRPAAYTEYRES-ILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTI 1405
            +S  +RT   V+P        S IL +    G+K+   K V+   +     Y +H  KPFF +++  M  G +LA   E ++ V+  R +LG  +   +    P ++R  F   D+  N+ HGSDS ++AE E+  +F  E+ +
Sbjct:    2 SSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSA---PGTIRGDFGI-DLGRNVCHGSDSVDSAEREINLWFKKEELV 141          

HSP 3 Score: 57.7658 bits (138), Expect = 3.187e-10
Identity = 34/137 (24.82%), Postives = 67/137 (48.91%), Query Frame = 2
Query:  524 EREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 934
            + E T   +KPD V+ G V +I+++  + G +++A +      +  ++ Y        F  ++ F+ SGP  IL        ++ + R ++G         ++P +IR  +G +   N  HG+D  D+A+RE+  +F
Sbjct:    4 QTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGP--ILATVWEGKDVVRQGRTILGA---TNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWF 135          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Yeast
Match: TRX1 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx2p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases iunder DNA replication stress; TRX1 has a paralog, TRX2, that arose from the whole genome duplication [Source:SGD;Acc:S000004033])

HSP 1 Score: 45.4394 bits (106), Expect = 1.932e-6
Identity = 27/91 (29.67%), Postives = 40/91 (43.96%), Query Frame = 2
Query:  101 EINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGD-DFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANP 370
            +  T  E+D  I ++ L+VVD Y  WCGPCK +     +   +    DF    V +    D  +K      P  L++     V  + GANP
Sbjct:    4 QFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELG--DVAQKNEVSAMPTLLLFKNGKEVAKVVGANP 92          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Yeast
Match: TRX3 (Mitochondrial thioredoxin; highly conserved oxidoreductase required to maintain the redox homeostasis of the cell, forms the mitochondrial thioredoxin system with Trr2p, redox state is maintained by both Trr2p and Glr1p [Source:SGD;Acc:S000000679])

HSP 1 Score: 44.2838 bits (103), Expect = 8.692e-6
Identity = 29/95 (30.53%), Postives = 42/95 (44.21%), Query Frame = 2
Query:   98 AEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCE----PCFLIYGGRSLVGVIRGANP 370
             ++    E+  LIK+   LV+D Y  WCGPCK +     ++     D  + F     D    + K    CE    P F++     L+G I GANP
Sbjct:   28 TKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPD--VRFVKCDVDESPDIAK---ECEVTAMPTFVLGKDGQLIGKIIGANP 117          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Match: EDO42234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S268])

HSP 1 Score: 530.406 bits (1365), Expect = 1.810e-178
Identity = 275/572 (48.08%), Postives = 392/572 (68.53%), Query Frame = 2
Query:  155 VVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLE-EIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA------GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIF-NKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLE 1846
            +VD Y +WCGPCKA+I+  +R+KNEIGDD L FA+A+ D+IDSLEKYR R +P FL Y   +LV VIRG + P L  TI+ +L+ EHKV++G  ER   K+    +   +E+ +E+ K  +  + ++VT+A+IKPD VKAG V+EII K+ E GIE+L  ++R LT EEA EFY     +E F+ L++F++SGP   L L+K         G+I  FRELIGPK ++ AKE +P S+RA+YGT+++ NA+HG D  ++A RELAFFFPDF  P +A  K +   +QRTLAL+RP A    RESI+ KI  AGF++AM KE+ LT+E+A  FY++HKD+ FF+ L+  MS G ++AL L +++A++GWRGMLGPK+VEKAK+  P SLRAQF  ED  +N +HGSD+ E AE E++ FFP++ T+A IKP+   ++ E+   +I +A FKI   K +T+ K LA +FY +   +++F  L  +M SGPT FMVLS+EDA+ GWRSL+GP DP+ A++  P+SIRA  G+D+ KN V+G  +  +  +V+   F + +   DG++     DK E
Sbjct:    1 MVDAYSEWCGPCKAIISSLKRLKNEIGDDLLIFAMAETDSIDSLEKYRMRSQPTFLFYAAGTLVNVIRGCHCPKLLKTIRKELDHEHKVLEGNAERKVVKEEKKEEITPEEEEEEIGKTHDFHLPKQVTVAVIKPDAVKAGLVEEIIRKVEEAGIEVLKMEERTLTREEAAEFYKQHEGTEHFDQLVEFMSSGPLMTLALSKAGETPEALEGVIDNFRELIGPKDVNVAKEEAPNSLRAMYGTDTVMNAVHGCDSNESAARELAFFFPDFAAPTVAN-KRKKRQLQRTLALIRPDALRSRRESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFDTLVTNMSSGPMMALCLAREDAIEGWRGMLGPKEVEKAKDEAPESLRAQFQVEDSPINPLHGSDTAENAEKEIQKFFPMQSTVAVIKPEVEPDQRELIKQRIKEAGFKIQLQKEVTLSKELASQFYHEHEGKDFFEGLTDYMSSGPTMFMVLSKEDAVSGWRSLMGPVDPEQAKEMAPESIRAALGKDVMKNVVHGPSDPEKAGKVIKEFFPEAKILPDGTVKKVQPDKAE 571          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Match: EDO34502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP47])

HSP 1 Score: 160.614 bits (405), Expect = 5.547e-43
Identity = 91/266 (34.21%), Postives = 150/266 (56.39%), Query Frame = 2
Query:  989 QRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQ---------TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSH--QEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1747
            ++TLA+++P A       I+E I+ AGFK+   K V+L ++EA+ FY +H  +PF++ L++ +S G ++A  L+   AV  WR +LGP D   A+   P S+RA+F  ++ K N  HGSDS E+AE E+ +FF   +         T+  +KP  + +     I   I DA F+I  ++   +E++ AEEF+        EY  +++  + SGP   + +  +D  + +R  +GP DP+ A    P S+RA +G+D  KNAV+ +D
Sbjct:   89 EKTLAMIKPDA-VGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTK-NAAHGSDSTESAEREVSFFFDKRRQNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYKGVVNEYERNMVEELCSGPCLAVEVRGQDVTKTFRDFVGPADPEIARHLRPKSLRAKFGKDKIKNAVHCTD 352          

HSP 2 Score: 147.132 bits (370), Expect = 2.184e-38
Identity = 90/291 (30.93%), Postives = 159/291 (54.64%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKD--KPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1393
            E TLA+IKPD V  G +  I+  + + G ++   +   L  +EA +FY   A    ++ L++FI+SGP  ++       G +  +R+++GP     A+  +P S+RA +GT++ +NA HG+D  ++A+RE++FFF         R ++ A     TL +V+P A  +     I+  I +AGF+++  +   L +  A  F+  +K     +   +++E+  G  LA+ +  Q+  + +R  +GP D E A+ + P SLRA+F K+ IK N +H +D  E    E++YFF +
Sbjct:   89 EKTLAMIKPDAV--GCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGP--VVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDK-------RRQNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYKGVVNEYERNMVEELCSGPCLAVEVRGQDVTKTFRDFVGPADPEIARHLRPKSLRAKFGKDKIK-NAVHCTDLPEDGLLEVEYFFKI 367          

HSP 3 Score: 92.8189 bits (229), Expect = 3.698e-20
Identity = 45/133 (33.83%), Postives = 72/133 (54.14%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGK 1792
            E+T+A IKPD +     I   I  A FK+ + K + + +  A +FY + + Q +++ L+  + SGP     L    A+  WR ++GP D  TA +  P S+RA +G D  KNA +GSD+    +R ++  F K
Sbjct:   89 EKTLAMIKPDAVGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDK 221          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Match: EDO50065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFA5])

HSP 1 Score: 121.324 bits (303), Expect = 2.678e-30
Identity = 68/192 (35.42%), Postives = 111/192 (57.81%), Query Frame = 2
Query:  989 QRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQ---------TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFY 1531
            ++TLA+++P A       I+E I+ AGFK+   K V+L ++EA+ FY +H  +PF++ L++ +S G ++A  L+   AV  WR +LGP D   A+   P S+RA+F  ++ K N  HGSDS E+AE E+ +FF   +         T+  +KP  + +     I   I DA F+I  ++   +E++ AEEF+
Sbjct:   89 EKTLAMIKPDA-VGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTK-NAAHGSDSTESAEREVSFFFDKRRQNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFH 278          

HSP 2 Score: 98.5969 bits (244), Expect = 1.554e-22
Identity = 62/205 (30.24%), Postives = 111/205 (54.15%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHK 1141
            E TLA+IKPD V  G +  I+  + + G ++   +   L  +EA +FY   A    ++ L++FI+SGP  ++       G +  +R+++GP     A+  +P S+RA +GT++ +NA HG+D  ++A+RE++FFF         R ++ A     TL +V+P A  +     I+  I +AGF+++  +   L +  A  F+  +K
Sbjct:   89 EKTLAMIKPDAV--GCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGP--VVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDK-------RRQNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYK 282          

HSP 3 Score: 92.4337 bits (228), Expect = 1.834e-20
Identity = 45/133 (33.83%), Postives = 72/133 (54.14%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGK 1792
            E+T+A IKPD +     I   I  A FK+ + K + + +  A +FY + + Q +++ L+  + SGP     L    A+  WR ++GP D  TA +  P S+RA +G D  KNA +GSD+    +R ++  F K
Sbjct:   89 EKTLAMIKPDAVGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDK 221          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Match: EDO39201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT1])

HSP 1 Score: 114.005 bits (284), Expect = 1.293e-28
Identity = 64/161 (39.75%), Postives = 101/161 (62.73%), Query Frame = 2
Query:  521 IEREVTLALIKPDIV-KAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTL 1000
            I  E TLALIKPD V K+ +++EII    ++G  IL ++  +LT E+  +FY        F  L+ +++SGP   LVLA+ +A  I  +R+LIGP    +A++ +P+S+RAIYGT+S  NA+HG+D   +A +E+ FFFPD +V  ++  +     + RT+
Sbjct:   15 IHIERTLALIKPDAVHKSDEIEEIIL---QHGFTILQKRRAHLTPEQTSDFYAEHYGKMFFPSLVAYMSSGPIMALVLARENA--ISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTRNALHGSDGTVSADKEIHFFFPDSIVEPVSTGQAAKDYLTRTV 170          

HSP 2 Score: 110.538 bits (275), Expect = 2.374e-27
Identity = 51/132 (38.64%), Postives = 80/132 (60.61%), Query Frame = 2
Query: 1391 VEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            +E+T+A IKPD +   +EI   IL   F I++ +R  +      +FY++   + +F  L+A+M SGP   +VL+RE+AI  WR LIGP + + A D  P+S+RAIYG D  +NA++GSD      + ++  F
Sbjct:   17 IERTLALIKPDAVHKSDEIEEIILQHGFTILQKRRAHLTPEQTSDFYAEHYGKMFFPSLVAYMSSGPIMALVLARENAISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTRNALHGSDGTVSADKEIHFFF 148          

HSP 3 Score: 107.842 bits (268), Expect = 2.078e-26
Identity = 53/138 (38.41%), Postives = 85/138 (61.59%), Query Frame = 2
Query:  977 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1390
            A +++RTLAL++P A  +  E I E I   GF +  ++   LT E+ + FY +H  K FF  L+  MS G ++AL L ++NA+  WR ++GP + +KA++  P SLRA +  +  + N +HGSD   +A+ E+ +FFP
Sbjct:   14 AIHIERTLALIKPDAVHKSDE-IEEIILQHGFTILQKRRAHLTPEQTSDFYAEHYGKMFFPSLVAYMSSGPIMALVLARENAISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTR-NALHGSDGTVSADKEIHFFFP 149          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Match: EDO26764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB54])

HSP 1 Score: 100.523 bits (249), Expect = 1.324e-25
Identity = 42/76 (55.26%), Postives = 61/76 (80.26%), Query Frame = 2
Query: 1037 ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVE 1264
            ESI+ KI  AGF++AM KE+ LT+E+A  FY++HKD+ FF+ L+  MS G ++AL L +++A++GWRGMLGPK+VE
Sbjct:    2 ESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFDTLVTNMSSGPMMALCLAREDAIEGWRGMLGPKEVE 77          

HSP 2 Score: 78.5666 bits (192), Expect = 7.499e-18
Identity = 34/74 (45.95%), Postives = 50/74 (67.57%), Query Frame = 2
Query: 1439 EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKD 1660
            E I +KI +A F+I   K + + +  AEEFYS+   QE+F+ L+ +M SGP   + L+REDAI GWR ++GPK+
Sbjct:    2 ESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFDTLVTNMSSGPMMALCLAREDAIEGWRGMLGPKE 75          

HSP 3 Score: 58.5362 bits (140), Expect = 7.184e-11
Identity = 30/76 (39.47%), Postives = 47/76 (61.84%), Query Frame = 2
Query:  578 VDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPK 805
             + I++K+ E G EI   ++ +LT E+A+EFY    D E F+ L+  ++SGP   L LA+ DA  I  +R ++GPK
Sbjct:    1 TESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFDTLVTNMSSGPMMALCLAREDA--IEGWRGMLGPK 74          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Match: nme8 (thioredoxin domain-containing protein 6 [Source:NCBI gene;Acc:101170553])

HSP 1 Score: 464.922 bits (1195), Expect = 4.695e-153
Identity = 238/589 (40.41%), Postives = 371/589 (62.99%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIE--REVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGI--IHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIE-NEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGS 1816
            MA KK+E  LQ  I  Q++W++++  +GL VVDVYQ WCGPCK ++   R+VKNE+GD  L+FA A+AD+I+ L+ +RG+C P FL Y    LVGV++ ANPP+L+ TI  +L +E + +    +    K   ++D E +E  +  +K +  +   +  T+A+IKPD V   K +EII K+ E+G EILA +   LT  EA+ FY H A+   F+DL++F++SG   ILVL+  D+ +  +  + E +GP  + EA+   P+ +RA YGT ++ NA+HG++D + A RELAFFFP+F V +      E   V+RTLAL+RP    E RE IL +I+ AGF V++Q+EV LT+E+  L Y QH ++ +F  L++ M+ G + A+ L  + AV  W+ ++GP D++KAK  +P  LRAQF  E+  ++ IHGS+  E AE E+ +FFP + T+A IK + +E + E I  +I D  F + + K + + + LAEE Y +   + +F  L+ ++  G    +VL++E+A+  WR ++GP DP  A++T  +S+RA +G DI +N+V+GS N    +  + LIFG +   E+ S
Sbjct:    1 MAVKKKEATLQVSITNQKQWEKMLATKGLTVVDVYQKWCGPCKPIVKHLRKVKNELGDVLLHFATAEADSIEDLKMFRGKCIPTFLFYADGMLVGVLQRANPPLLQRTIVKQLAKEKQSLNEGGQHKPIKPFCISDDE-NEDGKLGNKQVMSVPAGKSYTVAIIKPDAVSHRKTNEIIMKIQESGFEILAHKKHKLTEAEARRFYQHKAEEPCFQDLVQFMSSGHCHILVLSHTDSSVSVLPAWLEFMGPTDVSEARRAKPECLRAQYGTETLHNAVHGSEDSNHASRELAFFFPNFRVEQDG----EEERVERTLALIRPGLARENREEILARIHKAGFTVSLQREVMLTEEQVRLLYFQHINEDYFPALLQSMTSGPVAAMVLAGKEAVHHWKNIIGPSDLDKAKAENPECLRAQFPVENEPISHIHGSEDQEAAEREISFFFPKQNTLAVIKHEAMEQHRETILEEIRDRGFSVTQQKEMVLSRELAEELYKEHKEKPFFTKLVDYICQGHCLMLVLTKENAVEEWRVMMGPSDPAKAKETSTESLRARFGSDILQNSVHGSSNVQHAEEEIQLIFGDISNEEELS 584          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:101164143])

HSP 1 Score: 149.443 bits (376), Expect = 8.888e-39
Identity = 88/299 (29.43%), Postives = 160/299 (53.51%), Query Frame = 2
Query:  524 EREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQR----TLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQT 1402
            ++E TLALIKPD+V   K+ +++  ++ + + +   +   L+  +A +FY        F +L++F++SGP   + +   +A  +  +R+L+GP     A+  +PQSIRA +GT+ ++N  HG++  D A REL FFFP       + + H  SN       T  +++P A ++     IL  I+ AGF+++  +   + +  A  FY  +K     +  ++ E+  G  +AL +   +  + +R   GP D E A+ + PN+LRA + K+ ++ N +H +D  E    E++YFF +  T
Sbjct:   88 KKERTLALIKPDVVT--KIGDVMELVYSSNLIVTKAKMTRLSWSQAADFYMEHQSKSFFNNLVQFMSSGPVVAMEIMGDEATSV--WRKLLGPADSAAARREAPQSIRAHFGTDGLQNVGHGSESLDAAARELEFFFP-------SAIGHGPSNTATFTDCTCCIIKPHAVSDGLTGKILNSISAAGFEISALQMFNMERVNAEEFYEVYKGVVLEYPGMVTELCSGPCMALEIRGTDTPKTFREFCGPADPEIARHLRPNTLRALYGKDKVR-NAVHCTDLPEDGVLEVQYFFKILDT 374          

HSP 2 Score: 146.362 bits (368), Expect = 1.054e-37
Identity = 86/273 (31.50%), Postives = 143/273 (52.38%), Query Frame = 2
Query:  977 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEY-FNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1747
             S  +RTLAL++P   T+  + ++E + ++   V   K  +L+  +AA FY +H+ K FF  L++ MS G ++A+ +    A   WR +LGP D   A+   P S+RA F  + ++ N+ HGS+S + A  EL++FFP              + T   IKP  + +    +I N I  A F+I  ++   ME+  AEEFY         +  ++  + SGP   + +   D  + +R   GP DP+ A    P+++RA+YG+D  +NAV+ +D
Sbjct:   86 GSKKERTLALIKPDVVTKIGD-VMELVYSSNLIVTKAKMTRLSWSQAADFYMEHQSKSFFNNLVQFMSSGPVVAMEIMGDEATSVWRKLLGPADSAAARREAPQSIRAHFGTDGLQ-NVGHGSESLDAAARELEFFFPSAIGHGPSNTATFTDCTCCIIKPHAVSDGLTGKILNSISAAGFEISALQMFNMERVNAEEFYEVYKGVVLEYPGMVTELCSGPCMALEIRGTDTPKTFREFCGPADPEIARHLRPNTLRALYGKDKVRNAVHCTD 356          

HSP 3 Score: 80.4925 bits (197), Expect = 1.344e-15
Identity = 41/131 (31.30%), Postives = 66/131 (50.38%), Query Frame = 2
Query: 1394 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            E+T+A IKPD +    ++   +  +   + K K   +  S A +FY +   + +FN+L+  M SGP   M +  ++A   WR L+GP D   A    P SIRA +G D  +N  +GS++     R +   F
Sbjct:   90 ERTLALIKPDVVTKIGDVMELVYSSNLIVTKAKMTRLSWSQAADFYMEHQSKSFFNNLVQFMSSGPVVAMEIMGDEATSVWRKLLGPADSAAARREAPQSIRAHFGTDGLQNVGHGSESLDAAARELEFFF 220          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 110.153 bits (274), Expect = 2.902e-27
Identity = 58/163 (35.58%), Postives = 100/163 (61.35%), Query Frame = 2
Query:  968 KHEASNVQRTLALVRP--AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIF 1450
            +H +  +Q TLA+++P   A+    E++ +KI +  FK+   K++   ++++  FY +H  + F++ L++ MS G + A  L +++A++ WRG++GP  V +A+  DPNS+RAQF   D + N  HGSDS E+A+ E+ +FFP   T      D +E EE +F
Sbjct:    6 RHLSRVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTR-NTTHGSDSPESAQREISFFFPDFHT-----ADWMEKEEPLF 162          

HSP 2 Score: 102.064 bits (253), Expect = 2.103e-24
Identity = 54/135 (40.00%), Postives = 80/135 (59.26%), Query Frame = 2
Query: 1391 VEQTIAAIKPDGIENE---EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            ++ T+A IKPD + +    E +  KILD  FKIV+ K +  E+  +E+FY++ S + ++  L+  M SGP    VL+REDAIR WR L+GP     A  T P+SIRA +G    +N  +GSD+    QR ++  F
Sbjct:   12 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 146          

HSP 3 Score: 92.8189 bits (229), Expect = 3.147e-21
Identity = 51/139 (36.69%), Postives = 85/139 (61.15%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEII-AKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 943
            ++TLA+IKPD V    + E +  K+ +N  +I+  +D     +++++FY   +    ++ L++F++SGP +  VLA+ DA  I  +R L+GP  +  A+   P SIRA +G     N  HG+D  ++AQRE++FFFPDF
Sbjct:   13 QLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDA--IRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPDF 149          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 110.153 bits (274), Expect = 2.902e-27
Identity = 58/163 (35.58%), Postives = 100/163 (61.35%), Query Frame = 2
Query:  968 KHEASNVQRTLALVRP--AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIF 1450
            +H +  +Q TLA+++P   A+    E++ +KI +  FK+   K++   ++++  FY +H  + F++ L++ MS G + A  L +++A++ WRG++GP  V +A+  DPNS+RAQF   D + N  HGSDS E+A+ E+ +FFP   T      D +E EE +F
Sbjct:    6 RHLSRVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTR-NTTHGSDSPESAQREISFFFPDFHT-----ADWMEKEEPLF 162          

HSP 2 Score: 102.064 bits (253), Expect = 2.103e-24
Identity = 54/135 (40.00%), Postives = 80/135 (59.26%), Query Frame = 2
Query: 1391 VEQTIAAIKPDGIENE---EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            ++ T+A IKPD + +    E +  KILD  FKIV+ K +  E+  +E+FY++ S + ++  L+  M SGP    VL+REDAIR WR L+GP     A  T P+SIRA +G    +N  +GSD+    QR ++  F
Sbjct:   12 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 146          

HSP 3 Score: 92.8189 bits (229), Expect = 3.147e-21
Identity = 51/139 (36.69%), Postives = 85/139 (61.15%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEII-AKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 943
            ++TLA+IKPD V    + E +  K+ +N  +I+  +D     +++++FY   +    ++ L++F++SGP +  VLA+ DA  I  +R L+GP  +  A+   P SIRA +G     N  HG+D  ++AQRE++FFFPDF
Sbjct:   13 QLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDA--IRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPDF 149          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 108.997 bits (271), Expect = 7.140e-27
Identity = 57/157 (36.31%), Postives = 97/157 (61.78%), Query Frame = 2
Query:  986 VQRTLALVRP--AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIF 1450
            +Q TLA+++P   A+    E++ +KI +  FK+   K++   ++++  FY +H  + F++ L++ MS G + A  L +++A++ WRG++GP  V +A+  DPNS+RAQF   D + N  HGSDS E+A+ E+ +FFP   T      D +E EE +F
Sbjct:   10 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTR-NTTHGSDSPESAQREISFFFPDFHT-----ADWMEKEEPLF 160          

HSP 2 Score: 103.219 bits (256), Expect = 8.374e-25
Identity = 57/137 (41.61%), Postives = 81/137 (59.12%), Query Frame = 2
Query: 1388 PVEQ-TIAAIKPDGIENE---EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1786
            PV Q T+A IKPD + +    E +  KILD  FKIV+ K +  E+  +E+FY++ S + ++  L+  M SGP    VL+REDAIR WR L+GP     A  T P+SIRA +G    +N  +GSD+    QR ++  F
Sbjct:    8 PVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 144          

HSP 3 Score: 93.2041 bits (230), Expect = 2.155e-21
Identity = 51/139 (36.69%), Postives = 85/139 (61.15%), Query Frame = 2
Query:  530 EVTLALIKPDIVKAGKVDEII-AKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 943
            ++TLA+IKPD V    + E +  K+ +N  +I+  +D     +++++FY   +    ++ L++F++SGP +  VLA+ DA  I  +R L+GP  +  A+   P SIRA +G     N  HG+D  ++AQRE++FFFPDF
Sbjct:   11 QLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDA--IRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPDF 147          
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000043677.1 (SMESG000043677.1)

HSP 1 Score: 1686.77 bits (4367), Expect = 0.000e+0
Identity = 888/889 (99.89%), Postives = 888/889 (99.89%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVXXXXXXXXXXXXXXXXXXXXXXXXRESPRLFNSSERIMMEAEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTXXXXXXXXXXXXXXXXPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNERSRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQTDREDENQ 2731
            MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKL ENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVEESNKESINIEETQQETEVTDEKQRESPRLFNSSERIMMEAEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTDENKSSNEKSEKSEDKPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNERSRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQTDREDENQ
Sbjct:    1 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVEESNKESINIEETQQETEVTDEKQRESPRLFNSSERIMMEAEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTDENKSSNEKSEKSEDKPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNERSRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQTDREDENQ 889          
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000043677.1 (SMESG000043677.1)

HSP 1 Score: 1655.19 bits (4285), Expect = 0.000e+0
Identity = 876/889 (98.54%), Postives = 877/889 (98.65%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVXXXXXXXXXXXXXXXXXXXXXXXXRESPRLFNSSERIMMEAEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTXXXXXXXXXXXXXXXXPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNERSRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQTDREDENQ 2731
            MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKL ENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVEESNKESINIEETQQETEVTDEKQRESP+           AEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTDENKSSNEKSEKSEDKPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNERSRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQTDREDENQ
Sbjct:    1 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVEESNKESINIEETQQETEVTDEKQRESPK-----------AEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTDENKSSNEKSEKSEDKPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNERSRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQTDREDENQ 878          
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000065659.1 (SMESG000065659.1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 277/576 (48.09%), Postives = 388/576 (67.36%), Query Frame = 2
Query:   92 LQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1819
             Q  INT++EW+ELI  EGL V+DVYQDW  PCK ++ F  R+K ++ D  LNFAVAK++TI+SLEKYRGRCEPCFLIYG   LVGVIRG NPP LE  IK KLEEEH  MKG  ER E KD F    E  +  +E+ KD EE   E+ L +IKP I+  GK+ EII+ + +NGI IL ++++ +T EEA + Y H+ +++    LIKFI S     ++L K +  II+E R L+GPK LD+AK   P SIRA+Y  +++ENAIH  +DR++ +REL+ F+PDF+ P I   ++   N+Q T+A++RP+AY E++E I+  I    F++  Q E + T+ EA  FY  +    + E+LI EM +G  L L L +++AV  WR ++G KD+  A + +P  LRA +SK +I +NLIHGSDS ETAE ELKYFFP+EQTI AIKPD  +N +EI   I +  FKI   K + + K   +  Y    ++ Y++DL+ +M  G + F++LS++DA++ WR++IGP DP+ A +  PD  RA+YGRDI +NA+YGS ++ EV  +M +IFG L FN+DGS+
Sbjct:    7 FQKLINTEDEWEELIFNEGLQVIDVYQDWSSPCKPIVKFLWRLKTQLNDKILNFAVAKSNTIESLEKYRGRCEPCFLIYGNGILVGVIRGCNPPSLEILIKTKLEEEHLAMKGLGERMEIKDPFFKYMEELKLEEEMAKDFEEAPAEIVLVIIKPGIIYEGKLPEIISIIVDNGITILKEEEKYMTEEEAGQLYEHLQNTDFHHGLIKFITSENCYFMILMKENE-IINELRNLVGPKSLDDAKTFYPNSIRALYAKSTLENAIHCGEDRESCERELSIFYPDFVAPLIKLRRNLMENIQTTVAIIRPSAYKEFKEKIINSIVENEFEILRQDEFKFTRNEAEKFYEVNMMGDYLEDLILEMIEGPFLVLLLSRKDAVNKWRTLIGSKDLTFASKCEPECLRALYSKSNIFINLIHGSDSVETAEKELKYFFPIEQTIGAIKPDSYDNRDEIIELINEFGFKISMTKELILTKEQIDTMYQKDKYKSYYSDLVRYMTGGKSLFLILSKQDAVKEWRNVIGPTDPEVAVEENPDYFRALYGRDILENAIYGSSDKEEVSTMMKMIFGDLIFNDDGSI 581          
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000006982.1 (SMESG000006982.1)

HSP 1 Score: 350.903 bits (899), Expect = 5.168e-108
Identity = 208/589 (35.31%), Postives = 316/589 (53.65%), Query Frame = 2
Query:   65 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQ-HKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLG---PKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1819
            M  KK +      +  QE WD+L+K +GL V D+YQ+W GPCK+V++ F ++  E+  D + FA  K D++ SL  Y+G+CEP FLI GG  LVGVIRG+N P++  T   K  EE KVM+GEMER   +DS +   E  E V   +   E  E E+T A+IKPD +   K++E+I  + E    I+ ++ R L+ EE    Y      +I E+   F+ SG   I+ L       + + RE+ GPK ++ AK +SP S+RAIYG    +NAIH A+ R+ A + ++  FPD +  K      ++   +R + L+    Y E + SI+ +  +A  KV  Q E  L K      Y +    +  FEE ++E +      +  E +N +     MLG   P+D       D +  +      DI  +L++ S   E A+ +  YFFP++ T A IKPD  E  +EI   I    F +  +  I +  + AEE Y +     YF+ +I ++ S  +  MVLS+ DAIR WR  IG  +P+ A +  PD +R I+G  I +NA++GS +  +V R +NL+FG  +F+E G+L
Sbjct:    1 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVL-AETVYEFTEGEMTFAIIKPDAIVNNKMNEMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSEDS---ERVVILLPERIYIEDKNSIINQFTDADLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEETNGSVFYVICFECKNCINIVNYMLGLYIPED-------DMDYRKLTVRDMDIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPEEAAEESPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNL 577          
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000006982.1 (SMESG000006982.1)

HSP 1 Score: 328.561 bits (841), Expect = 6.249e-100
Identity = 197/559 (35.24%), Postives = 300/559 (53.67%), Query Frame = 2
Query:  155 VVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQH-KDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLG---PKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1819
            V D+YQ+W GPCK+V++ F ++  E+  D + FA  K D++ SL  Y+G+CEP FLI GG  LVGVIRG+N P++  T   K  EE KVM+GEMER   +DS +   E  E V   +   E  E E+T A+IKPD +   K++E+I  + E    I+ ++ R L+ EE    Y      +I E+   F+ SG   I+ L       + + RE+ GPK ++ AK +SP S+RAIYG    +NAIH A+ R+ A + ++  FPD +  K      ++   +R + L+    Y E + SI+ +  +A  KV  Q E  L K      Y +    +  FEE ++E +      +  E +N +     MLG   P+D       D +  +      DI  +L++ S   E A+ +  YFFP++ T A IKPD  E  +EI   I    F +  +  I +  + AEE Y +     YF+ +I ++ S  +  MVLS+ DAIR WR  IG  +P+ A +  PD +R I+G  I +NA++GS +  +V R +NL+FG  +F+E G+L
Sbjct:    5 VADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVL-AETVYEFTEGEMTFAIIKPDAIVNNKMNEMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSEDS---ERVVILLPERIYIEDKNSIINQFTDADLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEETNGSVFYVICFECKNCINIVNYMLGLYIPED-------DMDYRKLTVRDMDIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPEEAAEESPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNL 551          
The following BLAST results are available for this feature:
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NME81.797e-11134.39NME/NM23 family member 8 [Source:HGNC Symbol;Acc:H... [more]
NME81.797e-11134.39NME/NM23 family member 8 [Source:HGNC Symbol;Acc:H... [more]
NME96.656e-8347.67NME/NM23 family member 9 [Source:HGNC Symbol;Acc:H... [more]
NME96.877e-6039.93NME/NM23 family member 9 [Source:HGNC Symbol;Acc:H... [more]
NME96.877e-6039.93NME/NM23 family member 9 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndk-17.239e-1428.47Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-17.239e-1428.47Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-17.239e-1428.47Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-17.239e-1428.47Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
Y48G8AL.151.243e-729.55pep chromosome:WBcel235:I:1254770:1258258:1 gene:W... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmdyn-D64.133e-2237.59gene:FBgn0030573 transcript:FBtr0073933[more]
CG181301.139e-2039.81gene:FBgn0030359 transcript:FBtr0073581[more]
CG142211.065e-1633.01gene:FBgn0031042 transcript:FBtr0332485[more]
awd3.584e-1328.26gene:FBgn0000150 transcript:FBtr0346150[more]
awd3.584e-1328.26gene:FBgn0000150 transcript:FBtr0339146[more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme82.966e-14947.00NME/NM23 family member 8 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme72.788e-3632.73NME/NM23 family member 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme51.028e-2337.78NME/NM23 family member 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme61.058e-2034.06NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme2b.28.276e-1733.79NME/NM23 nucleoside diphosphate kinase 2b, tandem ... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme92.375e-18046.00NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme94.663e-18046.00NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme98.015e-17745.22NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme97.260e-16443.13NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme76.702e-4336.00NME/NM23 family member 7 [Source:NCBI gene;Acc:394... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nme81.545e-10433.05NME/NM23 family member 8 [Source:MGI Symbol;Acc:MG... [more]
Nme81.266e-8033.83NME/NM23 family member 8 [Source:MGI Symbol;Acc:MG... [more]
Nme92.404e-7444.97NME/NM23 family member 9 [Source:MGI Symbol;Acc:MG... [more]
Nme79.610e-3830.22NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
Nme79.610e-3830.22NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95YJ5|TXND3_CIOIN0.000e+044.93Thioredoxin domain-containing protein 3 homolog OS... [more]
sp|P90666|TXND3_HELCR5.025e-17043.71Thioredoxin domain-containing protein 3 homolog OS... [more]
sp|Q8N427|TXND3_HUMAN8.632e-11134.39Thioredoxin domain-containing protein 3 OS=Homo sa... [more]
sp|Q715S9|TXND3_RAT5.295e-10434.23Thioredoxin domain-containing protein 3 OS=Rattus ... [more]
sp|Q715T0|TXND3_MOUSE1.081e-10333.05Thioredoxin domain-containing protein 3 OS=Mus mus... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|234951430.000e+053.56tr|A0A210QRC6|A0A210QRC6_MIZYE Thioredoxin domain-... [more]
gnl|BL_ORD_ID|203037300.000e+054.16tr|A0A1S3IQQ0|A0A1S3IQQ0_LINUN thioredoxin domain-... [more]
gnl|BL_ORD_ID|203337600.000e+053.05tr|A0A1S3ISM9|A0A1S3ISM9_LINUN thioredoxin domain-... [more]
gnl|BL_ORD_ID|203236860.000e+052.87tr|A0A1S3IRI1|A0A1S3IRI1_LINUN thioredoxin domain-... [more]
gnl|BL_ORD_ID|203070030.000e+052.87tr|A0A1S3IR48|A0A1S3IR48_LINUN thioredoxin domain-... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme80.000e+047.11thioredoxin domain-containing protein 3 homolog [S... [more]
nme81.612e-16644.39thioredoxin domain-containing protein 3 homolog [S... [more]
nme81.253e-15248.48thioredoxin domain-containing protein 3 homolog [S... [more]
nme77.151e-4033.45NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
nme73.632e-3933.45NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000008106.11.996e-2738.33pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 ... [more]
nme65.951e-2334.53NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme31.408e-1630.83NME/NM23 nucleoside diphosphate kinase 3 [Source:Z... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YNK15.239e-1829.71Nucleoside diphosphate kinase; catalyzes the trans... [more]
TRX11.932e-629.67Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
TRX38.692e-630.53Mitochondrial thioredoxin; highly conserved oxidor... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422341.810e-17848.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345025.547e-4334.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500652.678e-3035.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392011.293e-2839.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267641.324e-2555.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme84.695e-15340.41thioredoxin domain-containing protein 6 [Source:NC... [more]
nme78.888e-3929.43NME/NM23 family member 7 [Source:NCBI gene;Acc:101... [more]
nme62.902e-2735.58NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme62.902e-2735.58NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme67.140e-2736.31NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043677.10.000e+099.89SMESG000043677.1[more]
SMESG000043677.10.000e+098.54SMESG000043677.1[more]
SMESG000065659.10.000e+048.09SMESG000065659.1[more]
SMESG000006982.15.168e-10835.31SMESG000006982.1[more]
SMESG000006982.16.249e-10035.24SMESG000006982.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004448 ID=SMED30004448|Name=Thioredoxin domain-containing protein 3-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2832bp
CTCTAAGTGGCTTTTATTGTAATTATCTTAAATTTATCAAATAGAATTTT
TTTCAATTTAAATAATGGCAAGAAAGAAGCAAGAAATCGCATTACAAGCA
GAGATTAATACTCAAGAAGAATGGGATGAATTAATAAAAAAGGAAGGATT
ACTTGTTGTTGACGTTTATCAAGATTGGTGTGGCCCATGCAAAGCAGTAA
TAAATTTTTTCAGGAGAGTAAAAAATGAAATTGGTGACGATTTTCTCAAT
TTTGCAGTGGCAAAAGCAGATACGATAGATTCACTAGAGAAATATCGCGG
AAGATGTGAACCATGCTTTTTAATTTATGGAGGTAGATCTTTGGTTGGAG
TTATAAGAGGAGCAAACCCCCCGGTTCTGGAAACAACAATTAAATTAAAG
TTAGAGGAAGAGCATAAAGTGATGAAAGGGGAAATGGAAAGAAATGAAAC
TAAAGATTCTTTCTTAGCAGATTTCGAAACTGACGAAAAAGTCCAAGAAG
TCGACAAAGATTTAGAAGAAATCGAACGAGAAGTGACTCTGGCTCTCATC
AAGCCTGACATTGTCAAAGCGGGAAAGGTCGACGAAATAATAGCTAAATT
ACATGAGAACGGAATTGAGATTTTGGCTCAACAGGATCGCAATTTGACTA
TCGAAGAAGCCAAAGAATTTTATCATCACATGGCTGACTCGGAGATCTTT
GAGGATTTAATCAAATTCATTGCGTCAGGCCCGAGTAAAATATTGGTCCT
TGCCAAAGGGGACGCCGGAATAATTCACGAATTCAGAGAACTCATTGGCC
CGAAATTTCTCGACGAAGCTAAAGAAAATTCACCACAAAGTATTCGAGCT
ATTTATGGCACAAATTCCATTGAAAACGCAATTCACGGAGCTGATGACAG
AGATACTGCACAACGGGAGTTGGCATTTTTCTTTCCTGACTTCATGGTTC
CAAAAATTGCACGTGTAAAGCACGAAGCAAGCAATGTTCAAAGAACTTTA
GCGCTTGTTCGGCCTGCAGCTTACACAGAGTATCGTGAAAGTATTCTAGA
GAAAATCAACAACGCTGGGTTTAAAGTTGCAATGCAAAAAGAAGTTCAAC
TTACCAAAGAAGAAGCAGCTTTATTTTACAATCAACACAAAGACAAACCC
TTCTTTGAAGAGTTGATTAAAGAAATGTCCAAAGGAACATTGTTGGCACT
TGCATTGGAAAAACAAAATGCAGTTCAAGGCTGGAGAGGAATGTTAGGGC
CAAAAGACGTCGAAAAAGCAAAGGAAATTGATCCGAATTCACTGCGAGCA
CAATTTTCTAAAGAAGACATTAAAGTCAATTTGATTCACGGTTCAGATTC
AGATGAAACAGCAGAGACTGAATTGAAATATTTCTTCCCAGTTGAACAAA
CAATTGCTGCAATTAAGCCCGATGGAATAGAAAATGAAGAGGAGATCTTT
AACAAGATTCTCGATGCTAAATTCAAAATCGTTAAAATTAAAAGAATTAC
TATGGAAAAATCGCTTGCTGAAGAGTTCTATTCTGATCAGTCTCATCAAG
AATATTTCAATGATCTCATTGCTCACATGGAGAGTGGACCAACATACTTT
ATGGTTTTATCTCGAGAAGATGCCATTAGAGGATGGAGATCCCTCATTGG
ACCTAAAGATCCTAAAACAGCAGAAGATACATATCCTGATAGTATTCGAG
CTATTTATGGACGAGATATCAATAAAAATGCAGTATATGGAAGTGACAAT
GAAAGTGAAGTTCAAAGAGTTATGAACTTGATATTTGGCAAATTGGAATT
CAACGAAGACGGAAGTTTGTTACCAGAATATGAAGACAAACTCGAAGTTG
TTGAAGAATCAAATAAAGAATCGATAAATATCGAAGAGACCCAACAAGAG
ACAGAAGTTACTGATGAAAAACAAAGAGAATCTCCAAGATTATTCAATTC
GTCAGAAAGAATAATGATGGAGGCTGAAGTGTCGGAAACATTAGAAGATG
AAGATTTGAAAAATAAATCCCAAATTACACAAGAAAATGAAGAAACAAAT
GTAGGAGAAAAAGAAAATTCCGAAGAACCTGATTCAACACATTTAGAAAC
TACAGAAAATGTTGAGGACAGCCAGGAAACCTCTCATAAAACAGACGAAA
ATAAAAGTTCGAATGAAAAATCTGAAAAATCAGAGGATAAACCTGATTCA
ACACAAGATGAAACGAAAAATAATGAAAGTCACGAAGAGTTAGTAAAAGA
GCAAACAACTAATGAAACAAAAGAGGAAATTACAGTGGCTGATGATTCGG
TTGTAAGTGAATTGGAAACTAAAGGCAGTAATGAAAGGTCTAGAGATGAA
ATTGATACAAATGAAAAGTCTCGAGACGAAATTGATACAGATGAAAAGTT
TCGAGACGAAATTGACACAAATGAAAAGTCTCAAGACGAAATTGATACAA
ATGAAAGAAGTAAAACTCAAAACGATAGCAAGGAACAAGAGGAAAGTGAC
GTAACCGCTAAAAATGAAAGTACGAATAGAGATGAGAAAGACTTAGACGA
ATCTGCGGTAGAAAATTCTGAAATCGAAAATGCTACTAGTAATGTAATAC
AAGAGACGGAAAATCCTGATAAAACGGAAAGTGAAAACGTAGATGTGGAT
ATAGATCAGACTAATAATAACTTGAATGCTGATGAAACGGAAAACACCAA
AGATCAAACAGACAGAGAAGACGAAAATCAATAAAGATTTATTTGAAAAT
AATATAATAGATTGGCCATAGATATTGATCAGTGCAGTGTAAAAATCAAT
TGAATTTTTTTATTATCAATAAATAGATTTGA
back to top

protein sequence of SMED30004448-orf-1

>SMED30004448-orf-1 ID=SMED30004448-orf-1|Name=SMED30004448-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=890bp
MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFR
RVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGA
NPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDL
EEIEREVTLALIKPDIVKAGKVDEIIAKLHENGIEILAQQDRNLTIEEAK
EFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLD
EAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIAR
VKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEE
AALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVE
KAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAI
KPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFND
LIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGR
DINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVEESN
KESINIEETQQETEVTDEKQRESPRLFNSSERIMMEAEVSETLEDEDLKN
KSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTDENKSSN
EKSEKSEDKPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSEL
ETKGSNERSRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSK
TQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETEN
PDKTESENVDVDIDQTNNNLNADETENTKDQTDREDENQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR034907NDK-like_dom
IPR036850NDK-like_dom_sf
IPR036249Thioredoxin-like_sf
IPR001564Nucleoside_diP_kinase
IPR012336Thioredoxin-like_fold
IPR013766Thioredoxin_domain
IPR017937Thioredoxin_CS
Vocabulary: molecular function
TermDefinition
GO:0004550nucleoside diphosphate kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006241CTP biosynthetic process
GO:0006228UTP biosynthetic process
GO:0006165nucleoside diphosphate phosphorylation
GO:0006183GTP biosynthetic process
GO:0045454cell redox homeostasis
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 110..130
NoneNo IPR availableCOILSCoilCoilcoord: 143..163
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 750..829
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 644..743
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 861..875
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 834..849
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 599..626
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 599..889
NoneNo IPR availablePANTHERPTHR46135FAMILY NOT NAMEDcoord: 1..585
NoneNo IPR availableCDDcd02948TRX_NDPKcoord: 11..109
e-value: 6.43077E-46
score: 157.497
NoneNo IPR availableCDDcd04416NDPk_TXcoord: 309..441
e-value: 1.22883E-45
score: 158.142
IPR001564Nucleoside diphosphate kinasePRINTSPR01243NUCDPKINASEcoord: 158..180
score: 41.23
coord: 202..221
score: 28.23
coord: 271..290
score: 45.56
IPR034907Nucleoside diphosphate kinase-like domainSMARTSM00562ndk_5coord: 443..581
e-value: 1.1E-44
score: 164.4
coord: 308..442
e-value: 1.9E-45
score: 167.0
coord: 155..297
e-value: 5.7E-44
score: 162.1
IPR034907Nucleoside diphosphate kinase-like domainPFAMPF00334NDKcoord: 156..292
e-value: 1.2E-33
score: 116.0
coord: 309..442
e-value: 3.4E-36
score: 124.3
coord: 444..578
e-value: 7.9E-35
score: 119.8
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 14..102
e-value: 4.9E-9
score: 36.1
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 1..184
score: 8.511
IPR036850Nucleoside diphosphate kinase-like domain superfamilyGENE3DG3DSA:3.30.70.141coord: 146..301
e-value: 5.7E-41
score: 141.7
coord: 302..443
e-value: 4.0E-44
score: 152.0
coord: 444..584
e-value: 3.8E-42
score: 145.5
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 308..442
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 442..580
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 155..293
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 3..121
e-value: 2.6E-15
score: 58.0
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 13..106
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 31..49