Origin recognition complex subunit 5

Overview
NameOrigin recognition complex subunit 5
Smed IDSMED30004441
Length (bp)1528
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Origin recognition complex subunit 5 (SMED30004441) t-SNE clustered cells

Violin plots show distribution of expression levels for Origin recognition complex subunit 5 (SMED30004441) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Origin recognition complex subunit 5 (SMED30004441) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Origin recognition complex subunit 5 (SMED30004441) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004441

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004441h1SMcG0004422 SmedASXL_011527SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30004441h1SMcG0004422 SmedASXL_011528SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30004441h1SMcG0004422 Contig3857GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30004441h1SMcG0004422 dd_Smed_v4_12818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004441h1SMcG0004422 dd_Smed_v4_12818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004441h1SMcG0012119 Contig3857GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
whole organismSMED30004441h1SMcG0004422 Contig13182newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30004441h1SMcG0004422 Contig13182uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Origin recognition complex subunit 5 vs. Ensembl Human
Match: ORC5 (origin recognition complex subunit 5 [Source:HGNC Symbol;Acc:HGNC:8491])

HSP 1 Score: 84.3445 bits (207), Expect = 8.334e-17
Identity = 62/235 (26.38%), Postives = 111/235 (47.23%), Query Frame = 3
Query:  696 YYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTTNEI---------PSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAI-YSIVLEDSIDDRFWSVEKLVENLVS--IRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            +Y  ++  +L   Y +C  + EL ++   ++  +   +   E   E +    W+ +   LK ++  VY R +++++          P       A   +ELPY  +++LIA Y+AS+N   TDK  F+      K+     K + + N   GPKPF +DRL AI YSIV     D R      +   + S      + ++   D L+  +Y C  S +F   I++++NFD++++L
Sbjct:  203 FYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEA-SERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIV-----DSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIARTVNFDIIKYL 431          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Celegans
Match: orc-5 (ORC (Origin Recognition Complex) subunit [Source:UniProtKB/TrEMBL;Acc:D3YT51])

HSP 1 Score: 60.4622 bits (145), Expect = 1.213e-9
Identity = 63/243 (25.93%), Postives = 120/243 (49.38%), Query Frame = 3
Query:  648 EITEILLDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFLLKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFM---GKTQLSKQKKGAIKK-QISKNIFSGPKPFSIDRLFAIYSIVL---EDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            E T++L+       PK    F+    ++L++ C S + L+ II  +W           +YDE    +K+   L        S     N +  N +    +    +P   RYLLIA Y AS N   +D   F+   G+ + S++K+  +++ +++K++  GPK   + R+  IY  +L   E +I    + ++ ++ +L S+ L + + ++S+ L+  +  C+ S E AL+IS+SLN ++  +L
Sbjct:  169 ETTKVLISRAN---PKINAQFLHVACQSLFMACKSPNILLSIISDAWL----------MYDERRTGDKFDSTLAKECLNRSSGEKLGNVVGENLAKENENSFDAMPLAMRYLLIAAYCASNNPHQSDCRFFVKNHGREKRSEKKELRLEENRLAKDL--GPKAADLQRIICIYETLLKINESTITG--FDLKSVIASLDSMGL-VSVTNRSN-LDIPKIKCLISLESALKISRSLNLELRNYL 392          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Fly
Match: Orc5 (gene:FBgn0015271 transcript:FBtr0080543)

HSP 1 Score: 81.6481 bits (200), Expect = 3.009e-16
Identity = 73/270 (27.04%), Postives = 127/270 (47.04%), Query Frame = 3
Query:  591 FGSHNSEIFSMFVRNLTKKEI-TEILLDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTTNE------IPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFM---GKTQLSKQKKGAIKKQISK-NIFSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPL-NSCRYVCVASREFALEISKSLNFDMLRFL 1355
            F    +++   F ++  + EI  E + +++ NN   Y  LF    L   Y  C  V EL    +     +   + D  V D  ++S  W+ +   L+ +++ +Y R+    E         ++S+   ++ LELPY  ++LLIA ++AS N    DK +F+   GK +   Q   A  K   K +   GPK FSIDRL AI+  +LE+ +     ++   +  LV + L   +  + + +  S R  C    EF L+I K + F++ ++L
Sbjct:  196 FQQVRNQLLEQFAQDKKRLEICQEAVTEDFYNN---YLNLF----LSVFYKACRDVPELQLTARKCLSTYLEPVLDGTV-DATDISRLWRHIAGPLRSALTQIYMRIEKPAEEVEDFTAIEDQSVRKLAQSLELPYYAKFLLIAAFLASHNAAKQDKRLFVKHHGKQRKRMQTVNARAKTTEKMSTTLGPKSFSIDRLLAIFYAILEEKV-GLTCNLLSQISTLVHLNLLSFVSGEQNIMEGSARLQCTIGLEFVLQIGKVVGFNVRQYL 456          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Zebrafish
Match: orc5 (origin recognition complex, subunit 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2275])

HSP 1 Score: 99.7525 bits (247), Expect = 4.848e-22
Identity = 75/256 (29.30%), Postives = 131/256 (51.17%), Query Frame = 3
Query:  633 NLTKKEITEILL-DEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTT----------NEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAI-YSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            + +K E+ +IL  D + +  P+ Y  ++  +L   + +C  + EL ++   ++  F   L   E   E ++   WK +   L  ++  VY R +++           E  + R +  A   +ELPY  ++LLIA Y+ASFN   TD+  F+      K+     K + + N   GPKPF +DRL AI YS+V  DS      S+   + +LV+++L   +    D L+S +Y C  S +F L IS++++FD++++L
Sbjct:  190 DYSKVELVQILSKDHHPSYTPELYASYINILLGVFFSVCRDLRELRHLAMLNFSKFCEPLEKGEA-KESDIHKLWKNIEPHLHRAMQTVYLREVSSVQWEQQQMDEKEATALRGLS-AHAHIELPYYSKFLLIAAYLASFNPARTDRRFFLKSHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAIFYSVV--DSRVAPTASIFSQISSLVTLQLLSQV-GHDDQLDSPKYKCAVSLDFILAISRTVSFDVVKYL 440          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Xenopus
Match: orc5 (origin recognition complex subunit 5 [Source:NCBI gene;Acc:549767])

HSP 1 Score: 92.0485 bits (227), Expect = 1.934e-19
Identity = 72/265 (27.17%), Postives = 127/265 (47.92%), Query Frame = 3
Query:  609 EIFSMFVRNLTKKEITEILLDEYK-NNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTTNE----IPSNRSIGF-----ASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAI-YSIVLEDSIDDRFWSVEKLVENLVS--IRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            E  +++  + +K E+ +IL  E+      ++Y  ++  +L   Y +C  + EL ++   ++  F   +   E   E +    WK +   LK ++  VY R +++++       +R         A   +ELPY  ++LLIA Y+ASFN   TDK  F+      K+     K + + N   GPKPF +DRL AI YSIV     D R      +   + S      + ++   D L+  +Y C  S +F   +++++NFD++R+L
Sbjct:  159 EPLTLYFPDYSKVELQKILSSEFPVKYSAEFYASYINILLGVFYTVCRDIKELRHLAALNFPKFCEPVIKGEA-KESDSHKLWKNIEPHLKRAMQTVYLREISSSQWERIQQEDREASHLKGLSAHAHVELPYYSKFLLIAAYLASFNPARTDKRFFLKHHGKIKKTDFLKKHEKTSNHLLGPKPFPLDRLLAILYSIV-----DSRVAPTANIFSQISSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAVARTVNFDIVRYL 417          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Xenopus
Match: orc5 (origin recognition complex subunit 5 [Source:NCBI gene;Acc:549767])

HSP 1 Score: 91.2781 bits (225), Expect = 3.481e-19
Identity = 72/265 (27.17%), Postives = 127/265 (47.92%), Query Frame = 3
Query:  609 EIFSMFVRNLTKKEITEILLDEYK-NNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTTNE----IPSNRSIGF-----ASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAI-YSIVLEDSIDDRFWSVEKLVENLVS--IRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            E  +++  + +K E+ +IL  E+      ++Y  ++  +L   Y +C  + EL ++   ++  F   +   E   E +    WK +   LK ++  VY R +++++       +R         A   +ELPY  ++LLIA Y+ASFN   TDK  F+      K+     K + + N   GPKPF +DRL AI YSIV     D R      +   + S      + ++   D L+  +Y C  S +F   +++++NFD++R+L
Sbjct:  168 EPLTLYFPDYSKVELQKILSSEFPVKYSAEFYASYINILLGVFYTVCRDIKELRHLAALNFPKFCEPVIKGEA-KESDSHKLWKNIEPHLKRAMQTVYLREISSSQWERIQQEDREASHLKGLSAHAHVELPYYSKFLLIAAYLASFNPARTDKRFFLKHHGKIKKTDFLKKHEKTSNHLLGPKPFPLDRLLAILYSIV-----DSRVAPTANIFSQISSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAVARTVNFDIVRYL 426          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Xenopus
Match: orc5 (origin recognition complex subunit 5 [Source:NCBI gene;Acc:549767])

HSP 1 Score: 91.2781 bits (225), Expect = 4.619e-19
Identity = 72/265 (27.17%), Postives = 127/265 (47.92%), Query Frame = 3
Query:  609 EIFSMFVRNLTKKEITEILLDEYK-NNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTTNE----IPSNRSIGF-----ASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAI-YSIVLEDSIDDRFWSVEKLVENLVS--IRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            E  +++  + +K E+ +IL  E+      ++Y  ++  +L   Y +C  + EL ++   ++  F   +   E   E +    WK +   LK ++  VY R +++++       +R         A   +ELPY  ++LLIA Y+ASFN   TDK  F+      K+     K + + N   GPKPF +DRL AI YSIV     D R      +   + S      + ++   D L+  +Y C  S +F   +++++NFD++R+L
Sbjct:  186 EPLTLYFPDYSKVELQKILSSEFPVKYSAEFYASYINILLGVFYTVCRDIKELRHLAALNFPKFCEPVIKGEA-KESDSHKLWKNIEPHLKRAMQTVYLREISSSQWERIQQEDREASHLKGLSAHAHVELPYYSKFLLIAAYLASFNPARTDKRFFLKHHGKIKKTDFLKKHEKTSNHLLGPKPFPLDRLLAILYSIV-----DSRVAPTANIFSQISSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAVARTVNFDIVRYL 444          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Xenopus
Match: orc5 (origin recognition complex subunit 5 [Source:NCBI gene;Acc:549767])

HSP 1 Score: 77.7962 bits (190), Expect = 1.038e-14
Identity = 67/255 (26.27%), Postives = 117/255 (45.88%), Query Frame = 3
Query:  609 EIFSMFVRNLTKKEITEILLDEYK-NNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTTNE----IPSNRSIGF-----ASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAI-YSIVLEDSIDDRFWSVEKLVENLVS--IRLFIPILSKSDPLNSCRYVCVASREFALEISK 1325
            E  +++  + +K E+ +IL  E+      ++Y  ++  +L   Y +C  + EL ++   ++  F   +   E   E +    WK +   LK ++  VY R +++++       +R         A   +ELPY  ++LLIA Y+ASFN   TDK  F+      K+     K + + N   GPKPF +DRL AI YSIV     D R      +   + S      + ++   D L+  +Y C  S +F   +++
Sbjct:  186 EPLTLYFPDYSKVELQKILSSEFPVKYSAEFYASYINILLGVFYTVCRDIKELRHLAALNFPKFCEPVIKGEA-KESDSHKLWKNIEPHLKRAMQTVYLREISSSQWERIQQEDREASHLKGLSAHAHVELPYYSKFLLIAAYLASFNPARTDKRFFLKHHGKIKKTDFLKKHEKTSNHLLGPKPFPLDRLLAILYSIV-----DSRVAPTANIFSQISSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAVAR 434          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Mouse
Match: Orc5 (origin recognition complex, subunit 5 [Source:MGI Symbol;Acc:MGI:1347044])

HSP 1 Score: 92.0485 bits (227), Expect = 1.652e-19
Identity = 67/233 (28.76%), Postives = 116/233 (49.79%), Query Frame = 3
Query:  696 YYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTT---------NEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAI-YSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            +Y  ++  +L   Y +C  + EL ++   ++  +   +   E   E +    W+ +   LK ++  VY R +++         N  P       A   +ELPY  +++LIA Y+AS+N   TDK  F+      K+     K + + N   GPKPF +DRL AI YSIV  DS      ++   + +LV+++L + I+   D LN  +Y C  S +F   I++ +NFD++++L
Sbjct:  203 FYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEA-GERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDNTDPGQLKGLSAYTHMELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIV--DSRVAPTANIFSQITSLVTLQL-LTIVGHEDQLNGPKYKCTVSLDFIRAIARMVNFDIIKYL 431          
BLAST of Origin recognition complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q9WUV0|ORC5_MOUSE (Origin recognition complex subunit 5 OS=Mus musculus OX=10090 GN=Orc5 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.156e-18
Identity = 67/233 (28.76%), Postives = 116/233 (49.79%), Query Frame = 3
Query:  696 YYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTT---------NEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAI-YSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            +Y  ++  +L   Y +C  + EL ++   ++  +   +   E   E +    W+ +   LK ++  VY R +++         N  P       A   +ELPY  +++LIA Y+AS+N   TDK  F+      K+     K + + N   GPKPF +DRL AI YSIV  DS      ++   + +LV+++L + I+   D LN  +Y C  S +F   I++ +NFD++++L
Sbjct:  203 FYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEA-GERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDNTDPGQLKGLSAYTHMELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIV--DSRVAPTANIFSQITSLVTLQL-LTIVGHEDQLNGPKYKCTVSLDFIRAIARMVNFDIIKYL 431          
BLAST of Origin recognition complex subunit 5 vs. UniProt/SwissProt
Match: sp|O43913|ORC5_HUMAN (Origin recognition complex subunit 5 OS=Homo sapiens OX=9606 GN=ORC5 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.002e-16
Identity = 62/235 (26.38%), Postives = 111/235 (47.23%), Query Frame = 3
Query:  696 YYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTTNEI---------PSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAI-YSIVLEDSIDDRFWSVEKLVENLVS--IRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            +Y  ++  +L   Y +C  + EL ++   ++  +   +   E   E +    W+ +   LK ++  VY R +++++          P       A   +ELPY  +++LIA Y+AS+N   TDK  F+      K+     K + + N   GPKPF +DRL AI YSIV     D R      +   + S      + ++   D L+  +Y C  S +F   I++++NFD++++L
Sbjct:  203 FYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEA-SERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIV-----DSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIARTVNFDIIKYL 431          
BLAST of Origin recognition complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q24169|ORC5_DROME (Origin recognition complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=Orc5 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.017e-15
Identity = 73/270 (27.04%), Postives = 127/270 (47.04%), Query Frame = 3
Query:  591 FGSHNSEIFSMFVRNLTKKEI-TEILLDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTTNE------IPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFM---GKTQLSKQKKGAIKKQISK-NIFSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPL-NSCRYVCVASREFALEISKSLNFDMLRFL 1355
            F    +++   F ++  + EI  E + +++ NN   Y  LF    L   Y  C  V EL    +     +   + D  V D  ++S  W+ +   L+ +++ +Y R+    E         ++S+   ++ LELPY  ++LLIA ++AS N    DK +F+   GK +   Q   A  K   K +   GPK FSIDRL AI+  +LE+ +     ++   +  LV + L   +  + + +  S R  C    EF L+I K + F++ ++L
Sbjct:  196 FQQVRNQLLEQFAQDKKRLEICQEAVTEDFYNN---YLNLF----LSVFYKACRDVPELQLTARKCLSTYLEPVLDGTV-DATDISRLWRHIAGPLRSALTQIYMRIEKPAEEVEDFTAIEDQSVRKLAQSLELPYYAKFLLIAAFLASHNAAKQDKRLFVKHHGKQRKRMQTVNARAKTTEKMSTTLGPKSFSIDRLLAIFYAILEEKV-GLTCNLLSQISTLVHLNLLSFVSGEQNIMEGSARLQCTIGLEFVLQIGKVVGFNVRQYL 456          
BLAST of Origin recognition complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q10CI8|ORC5_ORYSJ (Origin of replication complex subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=ORC5 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 7.814e-7
Identity = 83/374 (22.19%), Postives = 161/374 (43.05%), Query Frame = 3
Query:  381 PGDFFIELNEVLRT--NKWTTVYIVLDNFETLKNSTPFXXXXXXXXXXXXXXXXXXXXXITIFKSLLPPIKLFGSHNS-EIFSMFVRNLTKKEITEILLDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFLLKDSISLVYSRML------TTNEIPSNRSIG-------FASK---CLELPYN----CRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKN---------IFSGPKPFSIDRLFAIY---SIVLEDSIDD----RFWSVEKLVENLVS-IRLFIPIL--------SKSDPL-NSCRYVCVASREFALEISKSLNFDMLRFL 1355
            P DF   L + L    ++   VY+V DN E +++        L  L   L +     +++ ++ S   P   +    S E   ++  + T  E+ +IL+ ++ N  PK Y  F+   L+ L+ +   V EL  +++  ++ +   L D +   +  +  +    ++  +++  +         + +EI    S G       FA K     EL ++     +YLL++ ++AS N  + D  +F     L  +K+     Q S +         +  GP  F ++RL AI+   + V ED +D+       + E     L+S + L +  L        S+S PL  S RY      + AL++++S+NF + +++
Sbjct:  152 PSDFVAALRDALNGIVSQGEVVYLVFDNLEVVRSWD--KGGQLLPLLLRLHDLLQLPQVVLVYVSSATPDAYYSMTGSVEPNYVYFPDYTVDEVRDILMHDHPN--PKLYSSFLSVALKPLFRVTRRVDELSAVLEPLFRRYCEPLGDLKAVPDEGMKRRLFEHVQSHLAVALNETFNVPMRASMDEIKDGGSAGKGSAKRQFAGKDGLSSELEFHMSVSAKYLLLSAFLASRNPATLDAALFDSTGGLDNRKRKRKSSQASMHMKDTIVEEMLMKGPGTFPLERLLAIFQCITSVSEDILDEIDCPGNMASESGTTGLMSDVLLQLSTLCNSNFLSKSRSCPLEGSARYRSNIDEDLALKVARSVNFPLSKYM 521          
BLAST of Origin recognition complex subunit 5 vs. UniProt/SwissProt
Match: sp|B8AK78|ORC5_ORYSI (Origin of replication complex subunit 5 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_13614 PE=3 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 7.814e-7
Identity = 83/374 (22.19%), Postives = 161/374 (43.05%), Query Frame = 3
Query:  381 PGDFFIELNEVLRT--NKWTTVYIVLDNFETLKNSTPFXXXXXXXXXXXXXXXXXXXXXITIFKSLLPPIKLFGSHNS-EIFSMFVRNLTKKEITEILLDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFLLKDSISLVYSRML------TTNEIPSNRSIG-------FASK---CLELPYN----CRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKN---------IFSGPKPFSIDRLFAIY---SIVLEDSIDD----RFWSVEKLVENLVS-IRLFIPIL--------SKSDPL-NSCRYVCVASREFALEISKSLNFDMLRFL 1355
            P DF   L + L    ++   VY+V DN E +++        L  L   L +     +++ ++ S   P   +    S E   ++  + T  E+ +IL+ ++ N  PK Y  F+   L+ L+ +   V EL  +++  ++ +   L D +   +  +  +    ++  +++  +         + +EI    S G       FA K     EL ++     +YLL++ ++AS N  + D  +F     L  +K+     Q S +         +  GP  F ++RL AI+   + V ED +D+       + E     L+S + L +  L        S+S PL  S RY      + AL++++S+NF + +++
Sbjct:  152 PSDFVAALRDALNGIVSQGEVVYLVFDNLEVVRSWD--KGGQLLPLLLRLHDLLQLPQVVLVYVSSATPDAYYSMTGSVEPNYVYFPDYTVDEVRDILMHDHPN--PKLYSSFLSVALKPLFRVTRRVDELSAVLEPLFRRYCEPLGDLKAVPDEGMKRRLFEHVQSHLAVALNETFNVPMRASMDEIKDGGSAGKGSAKRQFAGKDGLSSELEFHMSVSAKYLLLSAFLASRNPATLDAALFDSTGGLDNRKRKRKSSQASMHMKDTIVEEMLMKGPGTFPLERLLAIFQCITSVSEDILDEIDCPGNMASESGTTGLMSDVLLQLSTLCNSNFLSKSRSCPLEGSARYRSNIDEDLALKVARSVNFPLSKYM 521          
BLAST of Origin recognition complex subunit 5 vs. TrEMBL
Match: A0A0X3PK18 (Origin recognition complex subunit 5 OS=Schistocephalus solidus OX=70667 GN=ORC5 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.604e-23
Identity = 114/482 (23.65%), Postives = 213/482 (44.19%), Query Frame = 3
Query:  111 KNELELIQSCIDKLNPLTNKLYVYGESKWANSLLINNFINQFKNDNKVKILNINCSESVTLDSDFK------PLYDEIILKLKIRNIDVKPISVKC--PGDFFIELNEVLRT------NKWTTVYIVLDNFETLKNSTPFXXXXXXXXXXXXXXXXXXXXXITIFKSLLPPI-----------KLF-GSHNSEIFSMFVRNLTKKEITEILLDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVY--DEWELSNKWKFLL---KDSISLVYSRMLTTNEIP-------SNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKT-QLSKQKKGAIKKQISKNIFS-GPKPFSIDRLFAIYSIVLE-----DSIDDRFWSVEKLVENLVS--------------------------IRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDM 1343
            +++ + + S +    P+T+ + + G      SLLI + ++     + ++ + ++C E+    +          L+D ++  LK R      ++ +C  P  F     ++L +       K     IVL   E L++S    L+I+  LN+ +                +P +           K + G+  SE  ++++++ T++++  IL+       P+Y   FVE +L   + +  SV EL+Y+ + +WK F + +   +V   DEW    +W++ L   K S+S +Y R   +  IP       ++ +   +S  LELP+  R+LL+A YIAS+N +S DK   +  T +L+ + K   KK  + NI   GP+ F +DRL AI+  + +     D    R      L+ + V+                            L  P  +  DPL + R+ C+ S E A  ++KS+N ++
Sbjct:   10 EDDYDFLHSLLGADQPVTSCIVISGPPGSGKSLLIASVLDDLLQSSNMRSVKVSCLEACPTSTGVLNTSQNLVLFDLLLYHLKFRYCPTAELTTRCDNPSVFIERFTDLLLSISCKDEKKPANFCIVLHQAEKLRDSAADLLSIMVALNSLVAEHARIYHPSIFSSGFIPNVVSVLLTSCSWDKFYSGTFASEPTTLYLKSYTREQLAAILVHAAPTESPRYAR-FVELLLTVCFPVTRSVRELLYLAQFNWKAFDDPVASGKVAADDEWA---QWRYALPTLKRSLSTIYLRPELSPAIPLAGPVIYADTTAAPSSSVLELPFYARFLLVAAYIASYNPRSADKRFLVKNTGKLTSRAKKQTKKTENVNIHMLGPRFFPLDRLLAIFYALFDLESDTDCQHKRRPPYTSLLASQVACLSGLGLIAAASITTAAGALSTRHGNAGLPGPYSNPDDPLANPRFRCLVSLETARAVAKSVNINL 487          
BLAST of Origin recognition complex subunit 5 vs. TrEMBL
Match: A0A4E0S345 (Origin recognition complex subunit OS=Fasciola hepatica OX=6192 GN=D915_002274 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 3.364e-22
Identity = 87/297 (29.29%), Postives = 143/297 (48.15%), Query Frame = 3
Query:  579 PIKLFGSHNSEIFSMFV--RNLTKKEITEILLD-EYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVY--DEWELSNKWKFL---LKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFM--GKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKS--------------------------DPLNSCRYVCVASREFALEISKSLNFDMLRFLNE 1361
            P + F S    +  M +   + T+ +IT IL+     N+ PK +  FV+ +L   + +C +  ELIY+++S+W  F+  +N   V   DEW    +WK     LK S++ +Y R    N    N    + S  LELPY  RYLLIA ++AS+N ++ DK   +   + Q  ++KK     + +K +  GP+ F +DRL AI+  +L D  +        L+ + V+    + +LS +                          DPL + RY C+ S E A  ++KSL+FD+  +L +
Sbjct:  187 PWEKFSSQTFHLEPMVIPITSYTRDQITCILMSLAPSNSDPKCFARFVDLLLTVCFPVCRNAGELIYLMQSNWSAFEEPVNKGLVAADDEWA---QWKLAQPTLKRSLANLYLRT-QKNRDTKNAVTPYNSSALELPYFTRYLLIAAFMASYNPRTADKKFLVKNSEKQSLRKKKQEKMSEKTKGLLRGPQLFPLDRLLAIFHALLRD--ESTPVPTSSLLLSQVACLTALGLLSATNPANVVGGFLSTGLGAVASGHHQSEMDPLANPRYRCLLSFETARAVAKSLDFDLPAYLTD 477          
BLAST of Origin recognition complex subunit 5 vs. TrEMBL
Match: A0A504YGK3 (Origin recognition complex subunit OS=Fasciola gigantica OX=46835 GN=FGIG_04253 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 5.510e-22
Identity = 86/297 (28.96%), Postives = 143/297 (48.15%), Query Frame = 3
Query:  579 PIKLFGSHNSEIFSMFV--RNLTKKEITEILLD-EYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVY--DEWELSNKWKFL---LKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFM--GKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKS--------------------------DPLNSCRYVCVASREFALEISKSLNFDMLRFLNE 1361
            P + F S    +  M +   + T+ +IT IL+     N+ PK +  FV+ +L   + +C +  ELIY+++S+W  F+  +N   V   DEW    +WK     LK S++ +Y R    N    N    + S  LELPY  RYLLIA ++AS+N ++ DK   +   + Q  ++KK     + +K +  GP+ F +DRL AI+  +L D  +        L+ + V+    + +LS +                          DPL + RY C+ S E A  +++SL+FD+  +L +
Sbjct:  194 PWEKFSSQTFHLEPMVIPITSYTRDQITCILMSLAPSNSDPKCFARFVDLLLTVCFPVCRNAGELIYLMQSNWSAFEEPVNKGLVAADDEWA---QWKLAQPTLKRSLANLYLRT-QKNRDTKNAVTPYNSSALELPYFTRYLLIAAFMASYNPRTADKKFLVKNSEKQSLRKKKQEKMSEKTKGLLRGPQVFPLDRLLAIFHALLRD--ESTPVPTSSLLLSQVACLTALGLLSATNPANVVSGFLSTGLGAVASGHHQSEMDPLANPRYRCLLSFETARAVAQSLDFDLPAYLTD 484          
BLAST of Origin recognition complex subunit 5 vs. TrEMBL
Match: A0A183TNJ6 (Origin recognition complex subunit 5 OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS18044 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.234e-21
Identity = 113/491 (23.01%), Postives = 212/491 (43.18%), Query Frame = 3
Query:  111 KNELELIQSCIDKLNPLTNKLYVYGESKWANSLLINNFINQFKNDNKVKILNINCSESVTLDSDFK------PLYDEIILKLKIRNIDVKPISVKC--PGDFFIELNEVLRT------NKWTTVYIVLDNFETLKNSTPFXXXXXXXXXXXXXXXXXXXXXITIFKSLLPPI-----------KLF-GSHNSEIFSMFVRNLTKKEITEILLDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVY--DEWELSNKWKFLL---KDSISLVYSRMLTTNEIP-------SNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFM----------GKTQLSKQKKGAIKKQISKNIFS-GPKPFSIDRLFAIYSIVLE-----DSIDDRFWSVEKLVENLVS--------------------------IRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDM 1343
            +++ + + S +    P+T+ + + G      SLLI + ++     + ++ + ++C E+    +          L+D ++  LK R      ++ +C  P  F     ++L +       K     IVL   E L++S    L+I+  LN+ +                +P +           K + G+  SE  ++++++ T++++  IL+       P+Y   FVE +L   + +  SV EL+Y+ + +WK F + +   +V   DEW    +W++ L   K S+S +Y R   +  IP       ++ +   +S  LELP+  R+LL+A YIAS+N +S DK   +             +L+ + K   KK  + NI   GP+ F +DRL AI+  + +     D    R      L+ + V+                            L  P  +  DPL + R+ C+ S E A  ++KS+N ++
Sbjct:   18 EDDYDFLHSLLGADQPVTSCIVISGPPGSGKSLLIASVLDDLLQSSNMRSVKVSCLEACPTSTGVLNTSQNLVLFDLLLYHLKFRYCPTAELTTRCDNPSVFIERFTDLLLSISCKDEKKPANFCIVLHQAEKLRDSAADLLSIMVALNSLVAEHARIYHPSIFSSGFIPNVVSVLLTSCSWDKFYSGTFASEPTTLYLKSYTREQLAAILVHAAPTESPRYAR-FVELLLTVCFPVTRSVRELLYLAQFNWKAFDDPVASGKVAADDEWA---QWRYALPTLKRSLSTIYLRPELSPAIPLAGPVIYADTTAAPSSSVLELPFYARFLLVAAYIASYNPRSADKRFLVKVRSSFISLYNTGKLTSRAKKQTKKTENVNIHMLGPRFFPLDRLLAIFYALFDLESDTDCQHKRRPPYTSLLASQVACLSGLGLIAAASITTAAGALSTRHGNAGLPGPYSNPDDPLANPRFRCLVSLETARAVAKSVNINL 504          
BLAST of Origin recognition complex subunit 5 vs. TrEMBL
Match: A0A1S8WJF0 (AAA_16 domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09629 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 3.649e-21
Identity = 115/461 (24.95%), Postives = 226/461 (49.02%), Query Frame = 3
Query:  153 NPLTNKLYVYGESKWANSLLINNFINQFKNDNKVKILNINC-------SESVTLDSDFKPLYDEIILKLKIR-NIDVKPISVKCPGDF-FIE-LNEVLRTNK------WTTVYIVLDNFETLKNSTPFXXXXXXXXXXXXXXX------XXXXXXITIFKSLLPPIKLF-GSHNSEIFSMFVRNLTKKEITEILLDEYKNNMPKYYEL----FVEKMLETLYIICSSVSELIYIIKSSWKNFQ-----NLLNDDEVYDEWELSNKWKFLLKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKT-QLSKQKKGAIKKQISKN-IFSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSC------------------------RYVCVASREFALEISKSLNFDMLRFLNE 1361
            +P+++ + + G S    S+L+++   Q +     K + ++C       + SV+ +   K L++ II  +  +        + +C G   F+E L+++LRT K        ++ +VLD  E L++S P  L +L  L + + ++      +++ +L+T+  +  P  K   G+ + E   + + + ++ ++T+ILL       P+  EL    FV+ +L   + +C S  E+I++++ +W  F+      L+  D+ + +W+L+      LK S++ +Y R  +++   ++      +  LELPY  R++LIA ++AS+N +  DK   +  T +LS Q+K   KK    N +  GP+ F +DRLFAI+  +L D  +    +   L+ + V+    + +LS + P N+                         RY C+ S E A  I++SL+FD+  +L +
Sbjct:   46 DPVSSCIVLTGPSGCGKSVLLSSTFTQLQRLYGQKWILVSCLEGCCSPTHSVSANVSSKLLFELIIHSIVSKCTPQSTATAYRCDGPAAFVEILSDLLRTMKNADPVSPVSLVLVLDQAEKLRDSDPLLLPLLVRLGSLVQDNLNLVDNRIDARLVTLLITRSPWEKFSSGTFHLEPVVLAMSSYSRDQMTQILLSLRP---PEASELRFSRFVDLLLTVCFPVCRSAGEIIHLMQVNWPAFEEPVVKGLVGPDDEWGQWKLAQP---TLKRSLATLYLRPQSSSTACADGEGIIPATTLELPYFSRFMLIASFLASYNPREADKKFLVKNTGKLSTQRKRREKKTERTNALLQGPRLFPLDRLFAIFHAILRDQAEPTLCT--SLLVSQVACLTALGLLSAASPANAIGGLYTTGMFSGSASLNDVDSLANPRYRCLLSFEAAKTIAQSLDFDLPAYLTD 498          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Cavefish
Match: orc5 (origin recognition complex subunit 5 [Source:NCBI gene;Acc:103037958])

HSP 1 Score: 101.679 bits (252), Expect = 8.290e-23
Identity = 78/256 (30.47%), Postives = 130/256 (50.78%), Query Frame = 3
Query:  633 NLTKKEITEIL-LDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTT----------NEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAI-YSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            + TK E+ +IL LD   +  P+ Y  ++  +L   Y +C  + EL ++   ++  F   L   E   E +    W+ +   LK ++  VY R +++           E  + R +  A   +ELPY  ++LLIA Y+AS+N   TD+  F+      K+     K + + N   GPKPF +DRL AI YS+V  DS      SV   + +LV+++L   +    D L+S +Y C  S +F   IS++++FD++R+L
Sbjct:  190 DYTKAELLQILSLDSNPSYSPELYSSYINILLGVFYSVCRDLRELRHLAALNFPKFCEPLEKGEA-KESDTHKLWRNIEPHLKRAMQTVYLREVSSVQWEQQQMEEKEATALRGLS-AHAHVELPYYSKFLLIAAYLASYNPARTDRRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAIFYSVV--DSRVAPTASVFSQISSLVTLQLLTQV-GHDDQLDSPKYKCAVSLDFISAISRTVSFDIVRYL 440          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Nematostella
Match: EDO32229 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVN7])

HSP 1 Score: 90.5077 bits (223), Expect = 1.652e-19
Identity = 99/418 (23.68%), Postives = 196/418 (46.89%), Query Frame = 3
Query:  171 LYVYGESKWANSLLINNFINQFKNDNKVKILNINCSESVTLDSDFKPLYDEIILKLKIRN--IDVKPISVKCPGDFF--IELNEVLRTNKWTTVYIVLDNFETLKNSTPFXXXXXXXXXXXXXXXXXXXXXITIFKSLLPPIKLF-GSHNSEIFSMFVRNLTKKEITEIL-LDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVY--DEWELSNKWKFLLKDSISLVYSRMLTTNE------IPSNRSIGFAS------KCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNI---FSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            ++VYG +    SL++   +   +    ++ + INC E  T     + LY+ I+ +L+  +   D+ P   +   +F   ++L       +  T+YIVLD  E L++     ++           +        I  S +   K F G+   +  ++   + +K E+ +I+ LD ++++  ++Y  + + +L   + +C  ++EL ++       +   + ++E    D  +L       LK +++ VY R +++ +        +    G +S        +ELP+  +YLL+A YIAS+N   TDK  F  K      K  A  K     +    +GPK F +DRL AI+  ++ED++     S+   + +LVS+ L +   S  D +++ +Y C+ S +F   I+K L+FD++++L
Sbjct:   48 IFVYGHTATGKSLVVKTLLKVLE----LQHVLINCVECFT----GRLLYEHILYQLEDNDDGTDLFPPRCENVAEFLRLLKLKATKLNLEKETLYIVLDKAERLRD-----MDANVLAGFLRLQELAGLNFCVILLSEITWEKFFTGTGFLDPITVHFPDYSKSELQKIMCLDRHEDHPLEFYGSYCQLLLSVFHTVCRDLNELRHLAALHLTKYCEPITNNEATFNDSHKLWRNINPHLKRALNTVYLREVSSEQWEAMLTQEAQTDSGGSSLIVPQRSHIELPFYSKYLLVAAYIASYNPPRTDKRFFSKKAPKMSNKAKAAAKTNKGRVNCQLTGPKAFPLDRLMAIFYTIVEDNVAPS-ASILSQITSLVSLNL-LSQTSADDQIDAAKYKCLVSFDFIRGIAKQLDFDIVQYL 450          
BLAST of Origin recognition complex subunit 5 vs. Ensembl Medaka
Match: orc5 (origin recognition complex subunit 5 [Source:NCBI gene;Acc:101155894])

HSP 1 Score: 99.3673 bits (246), Expect = 4.454e-22
Identity = 73/253 (28.85%), Postives = 130/253 (51.38%), Query Frame = 3
Query:  639 TKKEITEIL-LDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFL---LKDSISLVYSRMLTT----------NEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFL 1355
            +K E+ +IL  D + +   + Y  +V  +L   Y +C  + EL ++   ++  F   L + +V  E +    WK +   LK ++  VY R +++           E  + + +  A   +ELP+  ++LLIA Y+AS+N   TDK  F+      K+     K + + N   GPKPF +DRL AI+  V++  +     S+   + +LV+++L   + S  D L+S +Y C  S EF   IS+++NFD++++L
Sbjct:  189 SKVELQQILSQDRHPSFSAELYSFYVSVLLGVFYSVCRDLRELRHLAALNFSKFCEPLAEGKV-KETDTHKLWKNIEPHLKKAMQTVYLREVSSLQWEQMQQMEEETGALKGLS-AHTHVELPFYSKFLLIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKNEKTTNHLLGPKPFPLDRLLAIFYSVVDGRVAPT-ASIFSQISSLVTLQLLAQV-SHDDQLDSPKYKCAVSLEFICNISRTVNFDIMKYL 437          
BLAST of Origin recognition complex subunit 5 vs. Planmine SMEST
Match: SMESG000055362.1 (SMESG000055362.1)

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 402/423 (95.04%), Postives = 404/423 (95.51%), Query Frame = 3
Query:   96 MKLFFKNELELIQSCIDKLNPLTNKLYVYGESKWANSLLINNFINQFKNDNKVKILNINCSESVTLDSDFKPLYDEIILKLKIRNIDVKPISVKCPGDFFIELNEVLRTNKWTTVYIVLDNFETLKNSTPFXXXXXXXXXXXXXXXXXXXXXITIFKSLLPPIKLFGSHNSEIFSMFVRNLTKKEITEILLDEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFLLKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFLNEN 1364
            MKLFFKNELELIQSCIDKLNPLTNKLYVYGESKWANSLLINNFINQFKNDNKVKILNINCSESVTLDSDFKPLYDEIILKLKIRNIDVKPISVKCPGDFFIELNEVLRTNKWTTVYIVLDNFETLKNSTPFNLNILANLNNYLDNDKLNCKLITIFKSLLPP+KLFGSHNSEIFSMFVRNLTKKEITEILL+EYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFLLKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFM                  KN FSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFLNEN
Sbjct:    1 MKLFFKNELELIQSCIDKLNPLTNKLYVYGESKWANSLLINNFINQFKNDNKVKILNINCSESVTLDSDFKPLYDEIILKLKIRNIDVKPISVKCPGDFFIELNEVLRTNKWTTVYIVLDNFETLKNSTPFNLNILANLNNYLDNDKLNCKLITIFKSLLPPVKLFGSHNSEIFSMFVRNLTKKEITEILLNEYKNNMPKYYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELSNKWKFLLKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFM------------------KNNFSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFLNEN 405          
BLAST of Origin recognition complex subunit 5 vs. Planmine SMEST
Match: SMESG000054627.1 (SMESG000054627.1)

HSP 1 Score: 344.739 bits (883), Expect = 1.035e-117
Identity = 178/198 (89.90%), Postives = 178/198 (89.90%), Query Frame = 3
Query:  771 IIKSSWKNFQNLLNDDEVYDEWELSNKWKFLLKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFLNEN 1364
            I KSSWKNFQNLLNDDEVYDEWELSNKWKFLLKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFM                  KN FSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFLNEN
Sbjct:   16 IDKSSWKNFQNLLNDDEVYDEWELSNKWKFLLKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAGYIASFNKKSTDKDVFM------------------KNNFSGPKPFSIDRLFAIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVASREFALEISKSLNFDMLRFLNEN 195          
The following BLAST results are available for this feature:
BLAST of Origin recognition complex subunit 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ORC58.334e-1726.38origin recognition complex subunit 5 [Source:HGNC ... [more]
back to top
BLAST of Origin recognition complex subunit 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
orc-51.213e-925.93ORC (Origin Recognition Complex) subunit [Source:... [more]
back to top
BLAST of Origin recognition complex subunit 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Orc53.009e-1627.04gene:FBgn0015271 transcript:FBtr0080543[more]
back to top
BLAST of Origin recognition complex subunit 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
orc54.848e-2229.30origin recognition complex, subunit 5 [Source:ZFIN... [more]
back to top
BLAST of Origin recognition complex subunit 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
orc51.934e-1927.17origin recognition complex subunit 5 [Source:NCBI ... [more]
orc53.481e-1927.17origin recognition complex subunit 5 [Source:NCBI ... [more]
orc54.619e-1927.17origin recognition complex subunit 5 [Source:NCBI ... [more]
orc51.038e-1426.27origin recognition complex subunit 5 [Source:NCBI ... [more]
back to top
BLAST of Origin recognition complex subunit 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Orc51.652e-1928.76origin recognition complex, subunit 5 [Source:MGI ... [more]
back to top
BLAST of Origin recognition complex subunit 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WUV0|ORC5_MOUSE1.156e-1828.76Origin recognition complex subunit 5 OS=Mus muscul... [more]
sp|O43913|ORC5_HUMAN4.002e-1626.38Origin recognition complex subunit 5 OS=Homo sapie... [more]
sp|Q24169|ORC5_DROME3.017e-1527.04Origin recognition complex subunit 5 OS=Drosophila... [more]
sp|Q10CI8|ORC5_ORYSJ7.814e-722.19Origin of replication complex subunit 1 OS=Oryza s... [more]
sp|B8AK78|ORC5_ORYSI7.814e-722.19Origin of replication complex subunit 5 OS=Oryza s... [more]
back to top
BLAST of Origin recognition complex subunit 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PK183.604e-2323.65Origin recognition complex subunit 5 OS=Schistocep... [more]
A0A4E0S3453.364e-2229.29Origin recognition complex subunit OS=Fasciola hep... [more]
A0A504YGK35.510e-2228.96Origin recognition complex subunit OS=Fasciola gig... [more]
A0A183TNJ62.234e-2123.01Origin recognition complex subunit 5 OS=Schistocep... [more]
A0A1S8WJF03.649e-2124.95AAA_16 domain-containing protein (Fragment) OS=Opi... [more]
back to top
BLAST of Origin recognition complex subunit 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
orc58.290e-2330.47origin recognition complex subunit 5 [Source:NCBI ... [more]
back to top
BLAST of Origin recognition complex subunit 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Origin recognition complex subunit 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Origin recognition complex subunit 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO322291.652e-1923.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Origin recognition complex subunit 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
orc54.454e-2228.85origin recognition complex subunit 5 [Source:NCBI ... [more]
back to top
BLAST of Origin recognition complex subunit 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000055362.10.000e+095.04SMESG000055362.1[more]
SMESG000054627.11.035e-11789.90SMESG000054627.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004441 ID=SMED30004441|Name=Origin recognition complex subunit 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1528bp
TAAATTCAATTAATAATATATTATAAAAACTTAAAATAACAATTAAAACA
TTAATAAATTTTATACTATTTTGTGTTTTCAATCTAACGCTAACAATGAA
ATTATTTTTCAAAAATGAACTTGAATTAATTCAAAGTTGTATTGATAAAT
TAAATCCTTTAACTAATAAACTCTATGTTTACGGCGAAAGTAAATGGGCA
AATTCATTATTAATAAATAACTTTATTAATCAATTCAAAAATGATAATAA
AGTCAAAATTCTAAACATAAATTGTTCTGAGAGTGTTACTTTGGATTCTG
ATTTCAAACCGTTATATGATGAAATAATACTCAAATTAAAAATAAGAAAC
ATTGATGTGAAACCCATTTCAGTAAAATGTCCAGGAGATTTTTTCATTGA
ATTAAATGAGGTCTTAAGAACTAACAAATGGACCACAGTTTACATCGTTT
TAGATAATTTTGAAACACTGAAAAATTCCACTCCATTTAATCTCAATATT
TTAGCTAACTTGAATAATTATTTAGATAACGATAAACTTAACTGTAAATT
AATAACAATTTTCAAATCACTGCTTCCTCCAATAAAATTATTTGGATCCC
ATAATTCCGAAATATTTTCAATGTTTGTTCGTAATCTTACAAAAAAAGAA
ATTACTGAAATTCTATTAGATGAGTATAAGAATAATATGCCTAAATATTA
CGAATTGTTTGTTGAGAAAATGCTAGAAACTTTGTATATAATTTGCTCTA
GCGTGTCCGAATTAATCTATATAATAAAATCGTCATGGAAAAATTTCCAG
AATTTATTAAATGATGACGAAGTATATGATGAATGGGAGTTGTCGAATAA
ATGGAAATTTCTATTGAAAGATTCAATTTCATTGGTTTATAGTAGAATGC
TAACAACCAATGAAATTCCCTCAAATAGATCGATTGGCTTTGCATCAAAA
TGCTTGGAATTGCCATATAATTGCAGATATTTATTAATCGCTGGATATAT
TGCTTCATTCAATAAAAAATCGACAGATAAAGATGTTTTCATGGGTAAAA
CTCAATTATCAAAACAAAAGAAGGGAGCGATAAAGAAGCAAATCAGCAAA
AATATCTTTTCTGGTCCAAAACCGTTTTCCATTGATCGGCTATTTGCGAT
TTATTCCATTGTTCTGGAGGATTCAATTGACGATAGGTTTTGGTCAGTTG
AAAAACTAGTGGAAAATCTTGTCAGTATCAGGTTATTTATACCGATCCTG
TCGAAATCAGATCCATTGAATAGCTGTAGATATGTTTGTGTTGCCTCGCG
AGAATTTGCGTTGGAAATTTCCAAGAGCTTGAATTTTGATATGCTAAGAT
TTTTGAATGAGAATTAATAAACCTTTTAAGAATAAAATTTATGTTTCGAG
AGTAAGTATGTGATCTGAATCAGTCCTGGCACTTATTGATGTCTTGTTTT
TTATCATATTGGGTTAAACCAATAGGATTCAATGTACAAGAATTTATTTA
TTTCAATAAATCACTCATTAGATAAAAA
back to top

protein sequence of SMED30004441-orf-1

>SMED30004441-orf-1 ID=SMED30004441-orf-1|Name=SMED30004441-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=424bp
MKLFFKNELELIQSCIDKLNPLTNKLYVYGESKWANSLLINNFINQFKND
NKVKILNINCSESVTLDSDFKPLYDEIILKLKIRNIDVKPISVKCPGDFF
IELNEVLRTNKWTTVYIVLDNFETLKNSTPFNLNILANLNNYLDNDKLNC
KLITIFKSLLPPIKLFGSHNSEIFSMFVRNLTKKEITEILLDEYKNNMPK
YYELFVEKMLETLYIICSSVSELIYIIKSSWKNFQNLLNDDEVYDEWELS
NKWKFLLKDSISLVYSRMLTTNEIPSNRSIGFASKCLELPYNCRYLLIAG
YIASFNKKSTDKDVFMGKTQLSKQKKGAIKKQISKNIFSGPKPFSIDRLF
AIYSIVLEDSIDDRFWSVEKLVENLVSIRLFIPILSKSDPLNSCRYVCVA
SREFALEISKSLNFDMLRFLNEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000136whole organism
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR020796ORC5
IPR027417P-loop_NTPase
Vocabulary: cellular component
TermDefinition
GO:0000808origin recognition complex
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020796Origin recognition complex, subunit 5PFAMPF14630ORC5_Ccoord: 179..420
e-value: 4.4E-35
score: 121.6
IPR020796Origin recognition complex, subunit 5PANTHERPTHR12705ORIGIN RECOGNITION COMPLEX SUBUNIT 5coord: 8..421
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 5..174
e-value: 2.1E-11
score: 45.9
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 9..229