Nudix hydrolase domain-containing protein

Overview
NameNudix hydrolase domain-containing protein
Smed IDSMED30004436
Length (bp)1108
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nudix hydrolase domain-containing protein (SMED30004436) t-SNE clustered cells

Violin plots show distribution of expression levels for Nudix hydrolase domain-containing protein (SMED30004436) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nudix hydrolase domain-containing protein (SMED30004436) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nudix hydrolase domain-containing protein (SMED30004436) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004436

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004436h1SMcG0000701 SmedASXL_010522SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Human
Match: DCP2 (decapping mRNA 2 [Source:HGNC Symbol;Acc:HGNC:24452])

HSP 1 Score: 119.398 bits (298), Expect = 8.181e-30
Identity = 77/202 (38.12%), Postives = 106/202 (52.48%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +           + DFA  VF   P ++P+    E+  D WK  K   PT  A+I+D+ L+ V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI + I  D  I L   D + R  YII  +P +TKF PKT  EI  I WF I+ LP  + D    S +      F   +  IR ++ W+
Sbjct:   39 IELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARL-YIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWL 239          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Human
Match: DCP2 (decapping mRNA 2 [Source:HGNC Symbol;Acc:HGNC:24452])

HSP 1 Score: 119.783 bits (299), Expect = 9.541e-30
Identity = 77/202 (38.12%), Postives = 106/202 (52.48%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +           + DFA  VF   P ++P+    E+  D WK  K   PT  A+I+D+ L+ V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI + I  D  I L   D + R  YII  +P +TKF PKT  EI  I WF I+ LP  + D    S +      F   +  IR ++ W+
Sbjct:   39 IELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARL-YIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWL 239          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Human
Match: DCP2 (decapping mRNA 2 [Source:HGNC Symbol;Acc:HGNC:24452])

HSP 1 Score: 74.7146 bits (182), Expect = 4.235e-14
Identity = 51/130 (39.23%), Postives = 70/130 (53.85%), Query Frame = 3
Query:  417 MVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
             V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI + I  D  I L   D + R  YII  +P +TKF PKT  EI  I WF I+ LP  + D    S +      F   +  IR ++ W+
Sbjct:   93 QVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARL-YIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWL 221          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Celegans
Match: dcap-2 (mRNA-decapping enzyme 2 [Source:UniProtKB/Swiss-Prot;Acc:O62255])

HSP 1 Score: 86.2705 bits (212), Expect = 4.240e-18
Identity = 68/218 (31.19%), Postives = 103/218 (47.25%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFT--KLST-ANVDLIDFATQ------VFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGF--GSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEK---------DGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCFSSINAHAKDFIPTMNVIRIIKKWV 794
            +E  HW+Y+D      K+S   NV   DF  Q      V +++ H        +E    ++  KS  PT  A+++D  +  V++V+ +    K W FP GK+ + E  +  AIRE  EE GFD          I  EK         DG+ R  Y++ NVP +  F+P+T  EI KI WF I DLP  K D+  + +  +   F   M  ++ I+ +V
Sbjct:  164 LELAHWYYIDHMVEDDKISGCPNVGSRDFNFQMCQHCRVLRKYAHRA------DEVLAKFREYKSTVPTYGAILVDPEMDHVVLVQSYFAKGKNWGFPKGKINQAEPPRDAAIRETFEETGFDFG--------IYSEKEKKFQRFINDGMVRL-YLVKNVPKDFNFQPQTRKEIRKIEWFKIDDLPTDKTDELPAYLQGN--KFYMVMPFVKDIQIYV 364          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Celegans
Match: dcap-2 (mRNA-decapping enzyme 2 [Source:UniProtKB/Swiss-Prot;Acc:O62255])

HSP 1 Score: 85.8853 bits (211), Expect = 5.236e-18
Identity = 68/218 (31.19%), Postives = 103/218 (47.25%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFT--KLST-ANVDLIDFATQ------VFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGF--GSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEK---------DGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCFSSINAHAKDFIPTMNVIRIIKKWV 794
            +E  HW+Y+D      K+S   NV   DF  Q      V +++ H        +E    ++  KS  PT  A+++D  +  V++V+ +    K W FP GK+ + E  +  AIRE  EE GFD          I  EK         DG+ R  Y++ NVP +  F+P+T  EI KI WF I DLP  K D+  + +  +   F   M  ++ I+ +V
Sbjct:  180 LELAHWYYIDHMVEDDKISGCPNVGSRDFNFQMCQHCRVLRKYAHRA------DEVLAKFREYKSTVPTYGAILVDPEMDHVVLVQSYFAKGKNWGFPKGKINQAEPPRDAAIRETFEETGFDFG--------IYSEKEKKFQRFINDGMVRL-YLVKNVPKDFNFQPQTRKEIRKIEWFKIDDLPTDKTDELPAYLQGN--KFYMVMPFVKDIQIYV 380          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Celegans
Match: dcap-2 (mRNA-decapping enzyme 2 [Source:UniProtKB/Swiss-Prot;Acc:O62255])

HSP 1 Score: 85.8853 bits (211), Expect = 5.335e-18
Identity = 68/218 (31.19%), Postives = 103/218 (47.25%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFT--KLST-ANVDLIDFATQ------VFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGF--GSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEK---------DGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCFSSINAHAKDFIPTMNVIRIIKKWV 794
            +E  HW+Y+D      K+S   NV   DF  Q      V +++ H        +E    ++  KS  PT  A+++D  +  V++V+ +    K W FP GK+ + E  +  AIRE  EE GFD          I  EK         DG+ R  Y++ NVP +  F+P+T  EI KI WF I DLP  K D+  + +  +   F   M  ++ I+ +V
Sbjct:   80 LELAHWYYIDHMVEDDKISGCPNVGSRDFNFQMCQHCRVLRKYAHRA------DEVLAKFREYKSTVPTYGAILVDPEMDHVVLVQSYFAKGKNWGFPKGKINQAEPPRDAAIRETFEETGFDFG--------IYSEKEKKFQRFINDGMVRL-YLVKNVPKDFNFQPQTRKEIRKIEWFKIDDLPTDKTDELPAYLQGN--KFYMVMPFVKDIQIYV 280          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Celegans
Match: dcap-2 (mRNA-decapping enzyme 2 [Source:UniProtKB/Swiss-Prot;Acc:O62255])

HSP 1 Score: 76.6406 bits (187), Expect = 4.705e-15
Identity = 56/181 (30.94%), Postives = 88/181 (48.62%), Query Frame = 3
Query:  288 QVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGF--GSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEK---------DGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCFSSINAHAKDFIPTMNVIRIIKKWV 794
            +V +++ H        +E    ++  KS  PT  A+++D  +  V++V+ +    K W FP GK+ + E  +  AIRE  EE GFD          I  EK         DG+ R  Y++ NVP +  F+P+T  EI KI WF I DLP  K D+  + +  +   F   M  ++ I+ +V
Sbjct:   27 RVLRKYAHRA------DEVLAKFREYKSTVPTYGAILVDPEMDHVVLVQSYFAKGKNWGFPKGKINQAEPPRDAAIRETFEETGFDFG--------IYSEKEKKFQRFINDGMVRL-YLVKNVPKDFNFQPQTRKEIRKIEWFKIDDLPTDKTDELPAYLQGN--KFYMVMPFVKDIQIYV 190          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Match: DCP2 (gene:FBgn0036534 transcript:FBtr0075539)

HSP 1 Score: 106.686 bits (265), Expect = 5.561e-25
Identity = 69/213 (32.39%), Postives = 104/213 (48.83%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKLST-------------ANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKG-FGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCF-SSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD F    S               +V +  FA Q+F+  P +       ++  D WK  K   PT  A+++ ++    ++V+  F    W FP GK+ E E    CA REV EE GFDI++ ID +  I    +      Y++ N+P++T+F P+T NEI+   WF I  LP +K D    + +   +  F   M  ++ +KKWV
Sbjct:   13 IELAHWFYLDFFCAPESGEDGETPKCVQRKLPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAILVSEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMIMPFVKRLKKWV 225          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Match: DCP2 (gene:FBgn0036534 transcript:FBtr0100528)

HSP 1 Score: 106.686 bits (265), Expect = 5.561e-25
Identity = 69/213 (32.39%), Postives = 104/213 (48.83%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKLST-------------ANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKG-FGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCF-SSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD F    S               +V +  FA Q+F+  P +       ++  D WK  K   PT  A+++ ++    ++V+  F    W FP GK+ E E    CA REV EE GFDI++ ID +  I    +      Y++ N+P++T+F P+T NEI+   WF I  LP +K D    + +   +  F   M  ++ +KKWV
Sbjct:   13 IELAHWFYLDFFCAPESGEDGETPKCVQRKLPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAILVSEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMIMPFVKRLKKWV 225          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Match: DCP2 (gene:FBgn0036534 transcript:FBtr0075538)

HSP 1 Score: 107.071 bits (266), Expect = 6.884e-25
Identity = 69/213 (32.39%), Postives = 104/213 (48.83%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKLST-------------ANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKG-FGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCF-SSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD F    S               +V +  FA Q+F+  P +       ++  D WK  K   PT  A+++ ++    ++V+  F    W FP GK+ E E    CA REV EE GFDI++ ID +  I    +      Y++ N+P++T+F P+T NEI+   WF I  LP +K D    + +   +  F   M  ++ +KKWV
Sbjct:  240 IELAHWFYLDFFCAPESGEDGETPKCVQRKLPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAILVSEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMIMPFVKRLKKWV 452          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Match: DCP2 (gene:FBgn0036534 transcript:FBtr0304975)

HSP 1 Score: 107.071 bits (266), Expect = 7.084e-25
Identity = 69/213 (32.39%), Postives = 104/213 (48.83%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKLST-------------ANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKG-FGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCF-SSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD F    S               +V +  FA Q+F+  P +       ++  D WK  K   PT  A+++ ++    ++V+  F    W FP GK+ E E    CA REV EE GFDI++ ID +  I    +      Y++ N+P++T+F P+T NEI+   WF I  LP +K D    + +   +  F   M  ++ +KKWV
Sbjct:  240 IELAHWFYLDFFCAPESGEDGETPKCVQRKLPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAILVSEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMIMPFVKRLKKWV 452          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Zebrafish
Match: dcp2 (decapping mRNA 2 [Source:ZFIN;Acc:ZDB-GENE-040426-851])

HSP 1 Score: 124.405 bits (311), Expect = 1.049e-31
Identity = 85/233 (36.48%), Postives = 118/233 (50.64%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKLSTA--NVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWVILLNKNNKVKALDLAMKQSNIEDGRSNKPR 884
            IE  HWFYLD F  + S       + DFA  VF   P ++P+    ++  + WK  K   PT  A+I+D+ L  V+MV+G+ +K  W FP GK+ E E+F  CA+REV EE GFDI ++I     I     D + R  YII  VP +TKF PKT  EI  I WFP++ LP  + D    S +      F   +  +R +K+W+      +     D A   S       +KPR
Sbjct:   39 IELAHWFYLD-FCMQNSPGLPQCGIRDFAKAVFSHCPFLLPQGEDVQKVLEQWKEYKMGVPTFGAIILDETLDNVLMVQGYLAKSGWGFPKGKVNEDEAFHDCAVREVLEETGFDIRDRICKKTYIEQRISDQLARL-YIIPGVPKDTKFNPKTRKEIRNIEWFPVEKLPCHRNDMTPKSKLGLAPNKFFMAIPFMRQLKEWIAKHKGESTSSDEDFASNGSTPCKPFRSKPR 269          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Xenopus
Match: dcp2 (decapping mRNA 2 [Source:NCBI gene;Acc:549617])

HSP 1 Score: 118.627 bits (296), Expect = 3.868e-29
Identity = 74/202 (36.63%), Postives = 110/202 (54.46%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +   +       + DFA  VF+  P ++P     +   + WK  K   PT  A+I+D++ + V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI +++ ++  I L+  D + R  YII  VP +TKF PKT  EI  I WFP++ LP  K D    S +      F   +  IR ++ W+
Sbjct:  105 IELAHWFYLDFWMQNIPGLPQCGIRDFAKAVFQHCPFLLPNGEDVQRVLNEWKEYKMGVPTYGAIILDESHENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVYEETGFDIKDRMCNNDYIELKINDQLARL-YIIPGVPKDTKFNPKTRREIRNIEWFPVEKLPCHKNDMTPKSKLGMAPNKFFMVIPFIRPLRDWL 305          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Xenopus
Match: dcp2 (decapping mRNA 2 [Source:NCBI gene;Acc:549617])

HSP 1 Score: 117.857 bits (294), Expect = 9.487e-29
Identity = 74/202 (36.63%), Postives = 110/202 (54.46%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +   +       + DFA  VF+  P ++P     +   + WK  K   PT  A+I+D++ + V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI +++ ++  I L+  D + R  YII  VP +TKF PKT  EI  I WFP++ LP  K D    S +      F   +  IR ++ W+
Sbjct:  105 IELAHWFYLDFWMQNIPGLPQCGIRDFAKAVFQHCPFLLPNGEDVQRVLNEWKEYKMGVPTYGAIILDESHENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVYEETGFDIKDRMCNNDYIELKINDQLARL-YIIPGVPKDTKFNPKTRREIRNIEWFPVEKLPCHKNDMTPKSKLGMAPNKFFMVIPFIRPLRDWL 305          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Xenopus
Match: dcp2 (decapping mRNA 2 [Source:NCBI gene;Acc:549617])

HSP 1 Score: 115.931 bits (289), Expect = 1.557e-28
Identity = 69/174 (39.66%), Postives = 100/174 (57.47%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD 713
            IE  HWFYLD +   +       + DFA  VF+  P ++P     +   + WK  K   PT  A+I+D++ + V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI +++ ++  I L+  D + R  YII  VP +TKF PKT  EI  I WFP++ LP  K D
Sbjct:   39 IELAHWFYLDFWMQNIPGLPQCGIRDFAKAVFQHCPFLLPNGEDVQRVLNEWKEYKMGVPTYGAIILDESHENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVYEETGFDIKDRMCNNDYIELKINDQLARL-YIIPGVPKDTKFNPKTRREIRNIEWFPVEKLPCHKND 211          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Xenopus
Match: dcp2 (decapping mRNA 2 [Source:NCBI gene;Acc:549617])

HSP 1 Score: 111.309 bits (277), Expect = 9.974e-27
Identity = 76/225 (33.78%), Postives = 119/225 (52.89%), Query Frame = 3
Query:  150 LYIRFL-----QDSEDFKNIFTTIEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            L++RF+     ++ ++   +   IE  HWFYLD +   +       + DFA    K  P ++P     +   + WK  K   PT  A+I+D++ + V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI +++ ++  I L+  D + R  YII  VP +TKF PKT  EI  I WFP++ LP  K D    S +      F   +  IR ++ W+
Sbjct:   14 LFLRFILHIPSEERDNAIRLCFQIELAHWFYLDFWMQNIPGLPQCGIRDFA----KHCPFLLPNGEDVQRVLNEWKEYKMGVPTYGAIILDESHENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVYEETGFDIKDRMCNNDYIELKINDQLARL-YIIPGVPKDTKFNPKTRREIRNIEWFPVEKLPCHKNDMTPKSKLGMAPNKFFMVIPFIRPLRDWL 233          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Xenopus
Match: dcp2 (decapping mRNA 2 [Source:NCBI gene;Acc:549617])

HSP 1 Score: 109.768 bits (273), Expect = 2.826e-26
Identity = 73/202 (36.14%), Postives = 108/202 (53.47%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +   +       + DFA    K  P ++P     +   + WK  K   PT  A+I+D++ + V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI +++ ++  I L+  D + R  YII  VP +TKF PKT  EI  I WFP++ LP  K D    S +      F   +  IR ++ W+
Sbjct:   24 IELAHWFYLDFWMQNIPGLPQCGIRDFA----KHCPFLLPNGEDVQRVLNEWKEYKMGVPTYGAIILDESHENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVYEETGFDIKDRMCNNDYIELKINDQLARL-YIIPGVPKDTKFNPKTRREIRNIEWFPVEKLPCHKNDMTPKSKLGMAPNKFFMVIPFIRPLRDWL 220          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Mouse
Match: Dcp2 (decapping mRNA 2 [Source:MGI Symbol;Acc:MGI:1917890])

HSP 1 Score: 119.783 bits (299), Expect = 8.544e-30
Identity = 78/202 (38.61%), Postives = 106/202 (52.48%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +           + DFA  VF   P ++P+    E+  D WK  K   PT  A+I+D+ L+ V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI + I  D  I L   D + R  YII  VP +TKF PKT  EI  I WF I+ LP  + D    S +      F   +  IR ++ W+
Sbjct:   39 IELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKILDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARL-YIIPGVPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWL 239          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5REQ8|DCP2_PONAB (m7GpppN-mRNA hydrolase OS=Pongo abelii OX=9601 GN=DCP2 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.789e-29
Identity = 77/202 (38.12%), Postives = 107/202 (52.97%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +       +   + DFA  VF   P ++P+    E+  D WK  K   PT  A+I+D+ L+ V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI + I  D  I L   D + R  YII  +P +TKF PKT  EI  I WF I+ LP  + D    S +      F   +  IR ++ W+
Sbjct:   39 IELAHWFYLDFYMQNTPGLSQCGIRDFAKAVFSHCPFLLPEGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARL-YIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWL 239          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IU60|DCP2_HUMAN (m7GpppN-mRNA hydrolase OS=Homo sapiens OX=9606 GN=DCP2 PE=1 SV=3)

HSP 1 Score: 119.783 bits (299), Expect = 4.582e-29
Identity = 77/202 (38.12%), Postives = 106/202 (52.48%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +           + DFA  VF   P ++P+    E+  D WK  K   PT  A+I+D+ L+ V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI + I  D  I L   D + R  YII  +P +TKF PKT  EI  I WF I+ LP  + D    S +      F   +  IR ++ W+
Sbjct:   39 IELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARL-YIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWL 239          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CYC6|DCP2_MOUSE (m7GpppN-mRNA hydrolase OS=Mus musculus OX=10090 GN=Dcp2 PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 5.977e-29
Identity = 78/202 (38.61%), Postives = 106/202 (52.48%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +           + DFA  VF   P ++P+    E+  D WK  K   PT  A+I+D+ L+ V++V+G+ +K  W FP GK+ + E+   CA REV EE GFDI + I  D  I L   D + R  YII  VP +TKF PKT  EI  I WF I+ LP  + D    S +      F   +  IR ++ W+
Sbjct:   39 IELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKILDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARL-YIIPGVPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWL 239          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|O13828|DCP2_SCHPO (mRNA decapping complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dcp2 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 5.689e-23
Identity = 63/170 (37.06%), Postives = 95/170 (55.88%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKLST---ANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGF-GSKRWTFPGGKMET-ESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLP 698
            IE+ HWFY D  F +       ++ L  F+ ++F   P +     V EE FD++   K++ P   A+++D ++Q  ++VKG+  S  W FP GK++  ES   CAIREV EE GFD S++I+ +  I +   G     YII  + L+T+F  +T  EI KI W  + DLP
Sbjct:   38 IEQAHWFYED--FIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWSKVHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHNLMDLP 205          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|P53550|DCP2_YEAST (m7GpppN-mRNA hydrolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCP2 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 9.565e-19
Identity = 63/196 (32.14%), Postives = 101/196 (51.53%), Query Frame = 3
Query:  150 LYIRFLQD--SEDFKNIFTTI---EEMHWFYLDQFFTKL---STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKF 710
            L +RF+ +  +ED  ++   +   EE  WFY D  F KL   +  ++ +  FA  + K  P +   D   +E    +   K   P   A I ++NL  +++V+G  S  W+FP GK+ + E+   C IREV EEIGFD+++ IDD+  I     G     ++I  V     F+P+  NEI+KI WF  K + ++ +
Sbjct:   22 LLVRFIINCPNEDLSSVERELFHFEEASWFYTD--FIKLMNPTLPSLKIKSFAQLIIKLCPLVWKWDIRVDEALQQFSKYKKSIPVRGAAIFNENLSKILLVQGTESDSWSFPRGKISKDENDIDCCIREVKEEIGFDLTDYIDDNQFIERNIQGKNYKIFLISGVSEVFNFKPQVRNEIDKIEWFDFKKISKTMY 215          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A504YJF1 (M7GpppN-mRNA hydrolase OS=Fasciola gigantica OX=46835 GN=FGIG_09477 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.239e-48
Identity = 87/222 (39.19%), Postives = 124/222 (55.86%), Query Frame = 3
Query:  150 LYIRFL---------QDSEDFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDC-FSSINAHAKDFIPTMNVIRII 782
            LY RFL         + S++F  +F  +E  HWFYLD +    S   VDL  FA Q+F  FP I+P+   W+E++  W+  + +T T SA+IID+  +M+++V+GF   RW+FPGGK+ E E   +CA REV EE G D+  +ID  L I     G  R  +II N+P  ++ +P T NEIE I+WF + DLP    D      +NA    F   +  IR +
Sbjct:   17 LYTRFLLNLPSEVKQESSKNFVRMFFELERAHWFYLDHYIEDPSVGGVDLFGFAKQMFTHFPEIVPRGLNWQEKYLEWRKYRGETETGSAIIIDEYFEMILLVQGFYGNRWSFPGGKVNENECLTECAAREVMEETGLDVEYRIDPSLYIDRSIGGTLRRAFIIENMPRISRLQPATKNEIEAITWFSVNDLPSHIHDKTPLEKLNARPNCFYLVVPFIRYV 238          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A5K3EMY5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.538e-46
Identity = 94/259 (36.29%), Postives = 147/259 (56.76%), Query Frame = 3
Query:  180 DFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDC-FSSINAHAKDFIPTMNVIRIIKKWVILLNKNNKVKALDL---AMKQSNIEDGRSNKPRSKSVSDVKEVNKNFQITNL 941
            +F  IF  +E  HWFYLD        A VD   F  Q+F+RF H+IPK   W+E+F  WK  +  T T SAVI+D+ L MV++V+GF + RWTFPGGK+ + E+ ++CAIREV EE G +I ++ID++L +       KR  YI+   P  T+ +P T NEIE I+WF + +LP +  DD   +++      F   +  +R ++++V L  ++    A  L   ++ + ++   R ++  S S     E  ++FQ+  L
Sbjct:   58 NFVRIFAELEWAHWFYLDNCLKDTQEAGVDFFGFCQQMFERFTHLIPKKTQWKEKFFEWKHYRGTTCTGSAVILDEYLSMVLLVQGFNNDRWTFPGGKVNQGETLQECAIREVMEETGLNIEHRIDENLFLETIVGETKRRAYIVEGFPRTTRLQPSTQNEIEAITWFSLANLPCNMQDDTPMTTMKLKPNIFYCIIPFVRQLREYVKLRQQDVPPAAALLRSASLTEHHVTATRLHQ--SASFPTASEALRDFQVGTL 314          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A183TRL7 (Nudix hydrolase domain-containing protein OS=Schistocephalus solidus OX=70667 PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.219e-46
Identity = 83/198 (41.92%), Postives = 118/198 (59.60%), Query Frame = 3
Query:  180 DFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCFSSINAHAKDFIPTMNV 770
            +F  IF  +E  HW+YLD      S   VD   F  Q+F RFPH+IPK   W+E+F  WK  +  T T SA+I+D+ L MV++V+GF + RWTFPGGK+ + E+ +QCAIREV EE G DI +++D++L I       KR  +I+   P  ++ +P T NEIE I+WF I +LP            AH +D  P +++
Sbjct:   41 NFVRIFAELELAHWYYLDNCLQDASVG-VDFFGFCQQLFSRFPHMIPKKTNWKEKFQEWKHYRGTTATGSAIILDEYLSMVLLVQGFNNDRWTFPGGKINQNETLQQCAIREVMEETGLDIEHRLDENLFIDAFLGETKRRAFIVEGFPRTSRLQPSTKNEIEAITWFNIANLP------------AHVQDEAPVLSM 225          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A3P7D7G3 (Nudix hydrolase domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS19115 PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.243e-46
Identity = 83/198 (41.92%), Postives = 118/198 (59.60%), Query Frame = 3
Query:  180 DFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCFSSINAHAKDFIPTMNV 770
            +F  IF  +E  HW+YLD      S   VD   F  Q+F RFPH+IPK   W+E+F  WK  +  T T SA+I+D+ L MV++V+GF + RWTFPGGK+ + E+ +QCAIREV EE G DI +++D++L I       KR  +I+   P  ++ +P T NEIE I+WF I +LP            AH +D  P +++
Sbjct:   41 NFVRIFAELELAHWYYLDNCLQDASVG-VDFFGFCQQLFSRFPHMIPKKTNWKEKFQEWKHYRGTTATGSAIILDEYLSMVLLVQGFNNDRWTFPGGKINQNETLQQCAIREVMEETGLDIEHRLDENLFIDAFLGETKRRAFIVEGFPRTSRLQPSTKNEIEAITWFNIANLP------------AHVQDEAPVLSM 225          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A0X3QE77 (Nudix hydrolase domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR147462 PE=3 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 3.320e-46
Identity = 83/198 (41.92%), Postives = 118/198 (59.60%), Query Frame = 3
Query:  180 DFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCFSSINAHAKDFIPTMNV 770
            +F  IF  +E  HW+YLD      S   VD   F  Q+F RFPH+IPK   W+E+F  WK  +  T T SA+I+D+ L MV++V+GF + RWTFPGGK+ + E+ +QCAIREV EE G DI +++D++L I       KR  +I+   P  ++ +P T NEIE I+WF I +LP            AH +D  P +++
Sbjct:   35 NFVRIFAELELAHWYYLDNCLQDASVG-VDFFGFCQQLFSRFPHMIPKKTNWKEKFQEWKHYRGTTATGSAIILDEYLSMVLLVQGFNNDRWTFPGGKINQNETLQQCAIREVMEETGLDIEHRLDENLFIDAFLGETKRRAFIVEGFPRTSRLQPSTKNEIEAITWFNIANLP------------AHVQDEAPVLSM 219          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Cavefish
Match: dcp2 (decapping mRNA 2 [Source:NCBI gene;Acc:103047414])

HSP 1 Score: 118.242 bits (295), Expect = 1.402e-29
Identity = 75/202 (37.13%), Postives = 105/202 (51.98%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +           + DFA  VF   P ++P     ++  + WK  K   PT  A+I+D+ L   ++V+G+ +K  W FP GK+ E E+   CA+REV EE GFDI ++I  D  I  +  D + R  YII  VP +TKF PKT  EI  I WF I  LP  + D    S +      F   +  +R +K+W+
Sbjct:   39 IELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFNHCPFLLPHGEDVQKVLEQWKEYKMGVPTYGAIILDETLDNALLVQGYLAKSGWGFPKGKVNEDEAPHDCAVREVLEETGFDIRDRICKDTYIEQKITDQLARL-YIIPGVPKDTKFNPKTRKEIRNIEWFSIDKLPCHRNDMTPKSKLGLAPNKFFMAIPFMRQLKEWI 239          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Cavefish
Match: dcp2 (decapping mRNA 2 [Source:NCBI gene;Acc:103047414])

HSP 1 Score: 117.857 bits (294), Expect = 1.781e-29
Identity = 75/202 (37.13%), Postives = 105/202 (51.98%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKL-STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD +           + DFA  VF   P ++P     ++  + WK  K   PT  A+I+D+ L   ++V+G+ +K  W FP GK+ E E+   CA+REV EE GFDI ++I  D  I  +  D + R  YII  VP +TKF PKT  EI  I WF I  LP  + D    S +      F   +  +R +K+W+
Sbjct:   39 IELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFNHCPFLLPHGEDVQKVLEQWKEYKMGVPTYGAIILDETLDNALLVQGYLAKSGWGFPKGKVNEDEAPHDCAVREVLEETGFDIRDRICKDTYIEQKITDQLARL-YIIPGVPKDTKFNPKTRKEIRNIEWFSIDKLPCHRNDMTPKSKLGLAPNKFFMAIPFMRQLKEWI 239          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Yeast
Match: DCP2 (Catalytic subunit of Dcp1p-Dcp2p decapping enzyme complex; removes 5' cap structure from mRNAs prior to their degradation; also enters nucleus and positively regulates transcription initiation; nudix hydrolase family member; forms cytoplasmic foci upon DNA replication stress; human homolog DCP2 complements yeast dcp2 thermosensitive mutant [Source:SGD;Acc:S000005062])

HSP 1 Score: 91.6633 bits (226), Expect = 1.377e-20
Identity = 63/196 (32.14%), Postives = 101/196 (51.53%), Query Frame = 3
Query:  150 LYIRFLQD--SEDFKNIFTTI---EEMHWFYLDQFFTKL---STANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKF 710
            L +RF+ +  +ED  ++   +   EE  WFY D  F KL   +  ++ +  FA  + K  P +   D   +E    +   K   P   A I ++NL  +++V+G  S  W+FP GK+ + E+   C IREV EEIGFD+++ IDD+  I     G     ++I  V     F+P+  NEI+KI WF  K + ++ +
Sbjct:   22 LLVRFIINCPNEDLSSVERELFHFEEASWFYTD--FIKLMNPTLPSLKIKSFAQLIIKLCPLVWKWDIRVDEALQQFSKYKKSIPVRGAAIFNENLSKILLVQGTESDSWSFPRGKISKDENDIDCCIREVKEEIGFDLTDYIDDNQFIERNIQGKNYKIFLISGVSEVFNFKPQVRNEIDKIEWFDFKKISKTMY 215          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Medaka
Match: dcp2 (decapping mRNA 2 [Source:NCBI gene;Acc:101159655])

HSP 1 Score: 119.013 bits (297), Expect = 5.109e-30
Identity = 76/202 (37.62%), Postives = 108/202 (53.47%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKLSTA-NVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD        A +  + DFA  VF   P ++P     ++  + WK  K   PT  A+I+D++L+ V++V+G+ +K  W FP GK+ E E+   CA+REV EE GFDI  +I  D+ I  +  D + R  YII  V  +TKF PKT  EI  I WF I+ LP  + D    S +      F   +  IR ++ W+
Sbjct:   39 IELAHWFYLDFCLQNTPGAPHCGIRDFAKAVFHHCPFLLPHGEEVQKVLEQWKEYKMGVPTYGAIILDESLENVLLVQGYLAKSGWGFPKGKVNEGEAPHDCAVREVLEETGFDIKKRICKDVYIEQKITDQLVRL-YIIPGVSKDTKFNPKTRKEIRNIEWFSIEKLPSHRNDMTPKSKLGLAPNRFFMAIPFIRPLRDWI 239          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Medaka
Match: dcp2 (decapping mRNA 2 [Source:NCBI gene;Acc:101159655])

HSP 1 Score: 119.398 bits (298), Expect = 8.483e-30
Identity = 76/202 (37.62%), Postives = 108/202 (53.47%), Query Frame = 3
Query:  204 IEEMHWFYLDQFFTKLSTA-NVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKR-WTFPGGKM-ETESFKQCAIREVDEEIGFDISNKIDDDLCITLE-KDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFD-DCFSSINAHAKDFIPTMNVIRIIKKWV 794
            IE  HWFYLD        A +  + DFA  VF   P ++P     ++  + WK  K   PT  A+I+D++L+ V++V+G+ +K  W FP GK+ E E+   CA+REV EE GFDI  +I  D+ I  +  D + R  YII  V  +TKF PKT  EI  I WF I+ LP  + D    S +      F   +  IR ++ W+
Sbjct:  101 IELAHWFYLDFCLQNTPGAPHCGIRDFAKAVFHHCPFLLPHGEEVQKVLEQWKEYKMGVPTYGAIILDESLENVLLVQGYLAKSGWGFPKGKVNEGEAPHDCAVREVLEETGFDIKKRICKDVYIEQKITDQLVRL-YIIPGVSKDTKFNPKTRKEIRNIEWFSIEKLPSHRNDMTPKSKLGLAPNRFFMAIPFIRPLRDWI 301          
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000028236.1 (SMESG000028236.1)

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 302/306 (98.69%), Postives = 303/306 (99.02%), Query Frame = 3
Query:  150 LYIRFLQDSEDFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKMETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCFSSINAHAKDFIPTMNVIRIIKKWVILLNKNNKVKALDLAMKQSNIEDGRSNKPRSKSVSDVKEVNKNFQITNLSTTKNKMLLVPSGKPKNLDSIWLGIQFNKEEFLSDLHRNLWH 1067
            LYIRFLQDSEDFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGK ETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCFSSINAHAKDFIPTMNVIRIIKKWVILLNKNNKVKALDLAMKQSNIEDGRSNK RSKSVSDVKEVNKNFQI NLSTTKNKMLLVPSGKPKN+DSIWLGIQFNKEEFLSDLHRNLWH
Sbjct:   12 LYIRFLQDSEDFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKRETESFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDDCFSSINAHAKDFIPTMNVIRIIKKWVILLNKNNKVKALDLAMKQSNIEDGRSNKLRSKSVSDVKEVNKNFQIPNLSTTKNKMLLVPSGKPKNIDSIWLGIQFNKEEFLSDLHRNLWH 317          
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000077374.1 (SMESG000077374.1)

HSP 1 Score: 119.013 bits (297), Expect = 2.322e-31
Identity = 61/189 (32.28%), Postives = 102/189 (53.97%), Query Frame = 3
Query:  150 LYIRFLQD----SEDFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKMETE--SFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLP 698
            L++RF  D      D +  F  +E+M+W+YL    +    + + +  F  ++      I+P +   ++EF+NW L +   P    +++D+  + V++ KG  +    FPGGK+E    S  + AIRE  EEIG DI+N ID+ L   + + GVK  +++I N  +N   +P   NE+E I WFP+ D+P
Sbjct:   10 LFVRFFTDVTLYCTDMRRCFWQLEKMYWYYLGLTKSSQKPSKIGMKTFLEEIKSYLCEILPDEINVDKEFENWMLSRKTIPRVKVILLDRTCKNVVLTKGVYNNYLIFPGGKVEETDISLAEAAIRETYEEIGVDITNYIDESLYFDMTQWGVKNRYFVIPNFDMNIYMQPNVVNEVEYIKWFPLLDIP 198          
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000062384.1 (SMESG000062384.1)

HSP 1 Score: 118.627 bits (296), Expect = 4.024e-31
Identity = 61/189 (32.28%), Postives = 101/189 (53.44%), Query Frame = 3
Query:  150 LYIRFLQD----SEDFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKMETE--SFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLP 698
            L++RF  D      D +  F  +E+M+W+YL    +    + + +  F  ++      I+P +   + EF+NW L +   P    +++D+  + V++ KG  +    FPGGK+E    S  + AIRE  EEIG DI+N ID+ L   + + G+K  ++II N  +N   +P   NE+E I WFP+ D+P
Sbjct:   10 LFVRFFTDVTLYCTDMRRCFWQLEKMYWYYLGLTKSSQKPSKIGMKKFLEEIKSYLFEILPDEINVDNEFENWMLSRKTIPRVKVILLDRTCKNVVLTKGVYNNYLIFPGGKVEETDISLAEAAIRETYEEIGVDITNYIDESLYFDMTQWGIKNRYFIIPNFDMNIYMQPNVVNEVEYIKWFPLVDIP 198          
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000077341.1 (SMESG000077341.1)

HSP 1 Score: 117.857 bits (294), Expect = 6.971e-31
Identity = 61/189 (32.28%), Postives = 102/189 (53.97%), Query Frame = 3
Query:  150 LYIRFLQD----SEDFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKMETE--SFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLP 698
            L++RF  D      D +  F  +E+M+W+YL    +    + + +  F  ++      I+P +   ++EF+NW L +   P    +++D+  + V++ KG  +    FPGGK+E    S  + AIRE  EEIG DI+N ID+ L   + + GVK  +++I N  +N   +P   NE+E I WFP+ D+P
Sbjct:   10 LFVRFFTDVTLYCTDMRRCFWQLEKMYWYYLGLTKSSQKPSKIGMKTFLEEIKSYLCEILPDEINVDKEFENWMLSRKTIPRVKVILLDRTCKNVVLTKGVYNNYLIFPGGKVEETDISLAEAAIRETYEEIGVDITNYIDELLYFDMTQWGVKNRYFVIPNFDMNIYMQPNVVNEVEYIKWFPLLDIP 198          
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000077319.1 (SMESG000077319.1)

HSP 1 Score: 117.857 bits (294), Expect = 6.971e-31
Identity = 61/189 (32.28%), Postives = 102/189 (53.97%), Query Frame = 3
Query:  150 LYIRFLQD----SEDFKNIFTTIEEMHWFYLDQFFTKLSTANVDLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQMVIMVKGFGSKRWTFPGGKMETE--SFKQCAIREVDEEIGFDISNKIDDDLCITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLP 698
            L++RF  D      D +  F  +E+M+W+YL    +    + + +  F  ++      I+P +   ++EF+NW L +   P    +++D+  + V++ KG  +    FPGGK+E    S  + AIRE  EEIG DI+N ID+ L   + + GVK  +++I N  +N   +P   NE+E I WFP+ D+P
Sbjct:   10 LFVRFFTDVTLYCTDMRRCFWQLEKMYWYYLGLTKSSQKPSKIGMKTFLEEIKSYLCEILPDEINVDKEFENWMLSRKTIPRVKVILLDRTCKNVVLTKGVYNNYLIFPGGKVEETDISLAEAAIRETYEEIGVDITNYIDELLYFDMTQWGVKNRYFVIPNFDMNIYMQPNVVNEVEYIKWFPLLDIP 198          
The following BLAST results are available for this feature:
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DCP28.181e-3038.12decapping mRNA 2 [Source:HGNC Symbol;Acc:HGNC:2445... [more]
DCP29.541e-3038.12decapping mRNA 2 [Source:HGNC Symbol;Acc:HGNC:2445... [more]
DCP24.235e-1439.23decapping mRNA 2 [Source:HGNC Symbol;Acc:HGNC:2445... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dcap-24.240e-1831.19mRNA-decapping enzyme 2 [Source:UniProtKB/Swiss-P... [more]
dcap-25.236e-1831.19mRNA-decapping enzyme 2 [Source:UniProtKB/Swiss-P... [more]
dcap-25.335e-1831.19mRNA-decapping enzyme 2 [Source:UniProtKB/Swiss-P... [more]
dcap-24.705e-1530.94mRNA-decapping enzyme 2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DCP25.561e-2532.39gene:FBgn0036534 transcript:FBtr0075539[more]
DCP25.561e-2532.39gene:FBgn0036534 transcript:FBtr0100528[more]
DCP26.884e-2532.39gene:FBgn0036534 transcript:FBtr0075538[more]
DCP27.084e-2532.39gene:FBgn0036534 transcript:FBtr0304975[more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dcp21.049e-3136.48decapping mRNA 2 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcp23.868e-2936.63decapping mRNA 2 [Source:NCBI gene;Acc:549617][more]
dcp29.487e-2936.63decapping mRNA 2 [Source:NCBI gene;Acc:549617][more]
dcp21.557e-2839.66decapping mRNA 2 [Source:NCBI gene;Acc:549617][more]
dcp29.974e-2733.78decapping mRNA 2 [Source:NCBI gene;Acc:549617][more]
dcp22.826e-2636.14decapping mRNA 2 [Source:NCBI gene;Acc:549617][more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Dcp28.544e-3038.61decapping mRNA 2 [Source:MGI Symbol;Acc:MGI:191789... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5REQ8|DCP2_PONAB2.789e-2938.12m7GpppN-mRNA hydrolase OS=Pongo abelii OX=9601 GN=... [more]
sp|Q8IU60|DCP2_HUMAN4.582e-2938.12m7GpppN-mRNA hydrolase OS=Homo sapiens OX=9606 GN=... [more]
sp|Q9CYC6|DCP2_MOUSE5.977e-2938.61m7GpppN-mRNA hydrolase OS=Mus musculus OX=10090 GN... [more]
sp|O13828|DCP2_SCHPO5.689e-2337.06mRNA decapping complex subunit 2 OS=Schizosaccharo... [more]
sp|P53550|DCP2_YEAST9.565e-1932.14m7GpppN-mRNA hydrolase OS=Saccharomyces cerevisiae... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YJF11.239e-4839.19M7GpppN-mRNA hydrolase OS=Fasciola gigantica OX=46... [more]
A0A5K3EMY51.538e-4636.29Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183TRL72.219e-4641.92Nudix hydrolase domain-containing protein OS=Schis... [more]
A0A3P7D7G32.243e-4641.92Nudix hydrolase domain-containing protein OS=Schis... [more]
A0A0X3QE773.320e-4641.92Nudix hydrolase domain-containing protein OS=Schis... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dcp21.402e-2937.13decapping mRNA 2 [Source:NCBI gene;Acc:103047414][more]
dcp21.781e-2937.13decapping mRNA 2 [Source:NCBI gene;Acc:103047414][more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DCP21.377e-2032.14Catalytic subunit of Dcp1p-Dcp2p decapping enzyme ... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dcp25.109e-3037.62decapping mRNA 2 [Source:NCBI gene;Acc:101159655][more]
dcp28.483e-3037.62decapping mRNA 2 [Source:NCBI gene;Acc:101159655][more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028236.10.000e+098.69SMESG000028236.1[more]
SMESG000077374.12.322e-3132.28SMESG000077374.1[more]
SMESG000062384.14.024e-3132.28SMESG000062384.1[more]
SMESG000077341.16.971e-3132.28SMESG000077341.1[more]
SMESG000077319.16.971e-3132.28SMESG000077319.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004436 ID=SMED30004436|Name=Nudix hydrolase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1108bp
GGACTGTTTAAATTATTTTTTTAGAAATATTTTAAAATCATTTTGAACGA
ATTTTAGTTTTGAATAGCTCATAATTTATTTTTAAATATTTACTGAATCT
GCAGACATTTTACAATATGGAAATTATATCAGAAGAAATAATGAATGAGC
TATACATTCGATTTCTCCAAGATTCCGAAGATTTTAAAAATATATTTACT
ACAATTGAAGAAATGCATTGGTTTTATCTAGATCAATTCTTTACAAAACT
TTCAACAGCTAACGTAGATTTAATTGATTTTGCAACACAAGTTTTCAAAA
GGTTTCCCCATATAATTCCAAAAGATTGCGTTTGGGAAGAAGAATTTGAT
AATTGGAAATTGAAAAAATCTAAAACTCCTACATCCAGTGCCGTAATAAT
TGATCAAAATTTACAAATGGTTATAATGGTTAAAGGATTTGGATCGAAGC
GTTGGACATTTCCTGGCGGTAAAATGGAAACAGAAAGTTTTAAACAATGC
GCTATTAGAGAGGTTGATGAAGAAATTGGGTTTGACATATCCAATAAAAT
CGATGATGATTTATGTATTACACTGGAGAAAGACGGTGTAAAAAGATGCC
ATTATATCATCTGTAATGTTCCGTTAAATACCAAATTTCGACCGAAAACA
AATAATGAAATCGAGAAAATTTCCTGGTTTCCCATAAAGGATTTACCAGA
GTCTAAATTTGACGACTGTTTTTCATCAATTAATGCCCATGCTAAAGATT
TTATTCCAACAATGAACGTAATAAGAATCATTAAAAAATGGGTGATTTTA
TTGAACAAAAATAATAAAGTTAAAGCGTTGGATTTAGCAATGAAACAATC
TAATATTGAGGACGGCAGATCGAATAAACCGAGATCAAAAAGCGTTTCTG
ATGTCAAAGAAGTCAACAAAAATTTTCAAATCACTAATTTGTCAACTACT
AAAAATAAAATGCTATTGGTTCCTTCCGGGAAACCCAAAAATTTAGATTC
TATTTGGTTAGGAATTCAGTTCAACAAAGAAGAATTTTTATCTGATCTTC
ATCGTAATCTTTGGCATTAGAATGCTTTCTTATGTTATCATTATGCTTGT
AATAGTAG
back to top

protein sequence of SMED30004436-orf-1

>SMED30004436-orf-1 ID=SMED30004436-orf-1|Name=SMED30004436-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=318bp
MEIISEEIMNELYIRFLQDSEDFKNIFTTIEEMHWFYLDQFFTKLSTANV
DLIDFATQVFKRFPHIIPKDCVWEEEFDNWKLKKSKTPTSSAVIIDQNLQ
MVIMVKGFGSKRWTFPGGKMETESFKQCAIREVDEEIGFDISNKIDDDLC
ITLEKDGVKRCHYIICNVPLNTKFRPKTNNEIEKISWFPIKDLPESKFDD
CFSSINAHAKDFIPTMNVIRIIKKWVILLNKNNKVKALDLAMKQSNIEDG
RSNKPRSKSVSDVKEVNKNFQITNLSTTKNKMLLVPSGKPKNLDSIWLGI
QFNKEEFLSDLHRNLWH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036189DCP2_BoxA_sf
IPR007722DCP2_BoxA
IPR015797NUDIX_hydrolase-like_dom_sf
IPR000086NUDIX_hydrolase_dom
IPR020084NUDIX_hydrolase_CS
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0030145manganese ion binding
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007722mRNA decapping protein 2, Box A domainSMARTSM01125DCP2_2coord: 6..84
e-value: 0.0055
score: 3.5
IPR007722mRNA decapping protein 2, Box A domainPFAMPF05026DCP2coord: 7..81
e-value: 1.5E-7
score: 31.6
IPR036189mRNA decapping protein 2, Box A domain superfamilyGENE3DG3DSA:1.10.10.1050coord: 9..85
e-value: 2.0E-46
score: 160.1
IPR036189mRNA decapping protein 2, Box A domain superfamilySUPERFAMILYSSF140586Dcp2 domain-likecoord: 4..81
NoneNo IPR availableGENE3DG3DSA:3.90.79.10coord: 86..226
e-value: 2.0E-46
score: 160.1
NoneNo IPR availablePANTHERPTHR23114FAMILY NOT NAMEDcoord: 4..260
IPR000086NUDIX hydrolase domainPFAMPF00293NUDIXcoord: 88..196
e-value: 1.2E-12
score: 48.0
IPR000086NUDIX hydrolase domainPROSITEPS51462NUDIXcoord: 85..214
score: 12.821
IPR020084NUDIX hydrolase, conserved sitePROSITEPS00893NUDIX_BOXcoord: 117..138
IPR015797NUDIX hydrolase-like domain superfamilySUPERFAMILYSSF55811Nudixcoord: 79..200