SLIT-ROBO Rho GTPase activating protein 1

Overview
NameSLIT-ROBO Rho GTPase activating protein 1
Smed IDSMED30004435
Length (bp)3855
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SLIT-ROBO Rho GTPase activating protein 1 (SMED30004435) t-SNE clustered cells

Violin plots show distribution of expression levels for SLIT-ROBO Rho GTPase activating protein 1 (SMED30004435) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SLIT-ROBO Rho GTPase activating protein 1 (SMED30004435) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SLIT-ROBO Rho GTPase activating protein 1 (SMED30004435) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004435

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004435SMESG000046904.1 dd_Smed_v4_2264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004435SMESG000046904.1 dd_Smed_v4_2264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004435SMESG000046904.1 dd_Smed_v4_2264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004435SMESG000046904.1 dd_Smed_v4_2264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004435SMESG000046904.1 dd_Smed_v4_2264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004435SMESG000046904.1 Contig51329newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004435SMESG000046904.1 Contig51329uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004435SMESG000046904.1 Contig44179newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004435SMESG000046904.1 Contig44179uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30004435SMESG000046904.1 dd_Smed_v6_2264_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004435SMESG000046904.1 dd_Smed_v4_2264_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Human
Match: SRGAP3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:HGNC Symbol;Acc:HGNC:19744])

HSP 1 Score: 306.99 bits (785), Expect = 1.973e-86
Identity = 234/905 (25.86%), Postives = 427/905 (47.18%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS--------------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNY---NDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSP 2675
            I+  +E QI++   Q  +Q KCL+ +      +L ++ + ++R+A IE EYS +L KL+   S +  S   +   +KK+    SP+     ++  T+  ++ H  L+DI+   +  RL  + ED IRL +KS +I  + H E+++  N+L    K Y     +S +   + ++   +   Q +K       ++R +D+ +      +I+K++E+   R  ++   +   T ARN Y+++L +   +I  +Y +++  ++ C + GFH +L R    + S E  L T      ++    ++ +D+ +D    ++             F P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST + +   S     ++       + N +E     E  YF   + Y+N     +N+ +KL++   +LK  ++ + +      +   +T    +  K               KLF G +  + K++ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +    D+N  A +LKLYFR L+ P+F +E F ++++     N ++R     V+ ++ I++ L       ++YL +F++HL+++S EN MD  NLAI FGP LM IP+ +       Q  +N V + +I +H+ +F   R+ EGPVY++      +        + P S+     + +   GT+                                   ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  ++  S + D    S  +         DL SP
Sbjct:   13 IIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSS--REHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGDLSMNLLRHEDRPQRRSSVKKIEKMKEK---RQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAAS--ETYMSKINIAKRRANQQE----TEMFYFTKFKEYVNG----SNLITKLQAKHDLLKQ-TLGEGER-----AECGTTRPPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVDDQ-NERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIKLENPAER-----VHQIQQILVTLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMHIPDGQDP--VSCQAHINEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEY------CDSPHSEPGAIDEVDHDNGTEP----------------------------------HTSDEEVEQIEAIAKFDYMGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSP 838          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Human
Match: SRGAP1 (SLIT-ROBO Rho GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:17382])

HSP 1 Score: 305.834 bits (782), Expect = 4.473e-86
Identity = 235/895 (26.26%), Postives = 430/895 (48.04%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEV---------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSI---------HSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE-----LSTNVESVENDDSV---KSNYMDLSSP 2675
            I+  +E+Q+++   Q  +Q KCL+ +  +   +L ++ D ++++A IE EYS NL KL+     +  S    +  +KK+    SP+     L+   +  +K H  LSDIY   +  R + + ED  R+ +KS +I  + H ++++ LN+L    K Y     E+  A  +   A  Q +K++         IR +++ +      +I+K++E+   R  ++   +  S  ARN+Y++ L +   S+  +Y ++L  ++ C + G+H +L R    + S E  L T      ++    ++ ++  +D + F+E             F    GD V Q+   Q+PVQ +L   +Q+  + + ++  + EE K   ++  +++ D +   DYDV +  +   ST + + T S     ++       + N +E     E  YF  +  YL      +N+ +KL++   +L+  ++ +     Y  +           H  +       +KLF GDL  + K++ +++PL+V+SCIR I+LYG+++ G+FRV GSQ++V   K+ FE G +PL   + +++D+N  A +LKLYFR L+ P+F +E FN++++        + ++   ++ ++L L       ++YL +F++HL+++S EN MD  NLAI FGP LMP+PE +       Q  VN + + +I +H+T+F   ++ +GPVY+                      K    DD       E              + +   V  + G E      + D   P   +A   FDY  +S +E+SFKK   L+L  R +E WW G       H     ++GL+P  +  +   ++     LS   +S  +   V   KS+  D++SP
Sbjct:   13 IIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFMAKTRSTKDHQ-QYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSVKKIEKMKEK---RQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQV-SAQQPVQAELMLRYQQLQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVS--ETYLSKPSIAKRRANQQE----TEQFYFMKLREYLEG----SNLITKLQAKHDLLQR-TLGEGHRAEYMTTRPPNVPPKPQKHRKSRPRSQYNTKLFNGDLETFVKDSGQVIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGENPLADDQ-SNHDINSVAGVLKLYFRGLENPLFPKERFNDLISCIRIDNLYERAL--HIRKLLLTLPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPVPEIQDQ--VSCQAHVNEIIKTIIIHHETIFPDAKELDGPVYE----------------------KCMAGDDYCDSPYSE--------------HGTLEEVDQDAGTEP---HTSEDECEPIEAIAK--FDYVGRSARELSFKKGASLLLYHRASEDWWEG------RHNG---IDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSP 836          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Human
Match: SRGAP3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:HGNC Symbol;Acc:HGNC:19744])

HSP 1 Score: 299.671 bits (766), Expect = 5.826e-84
Identity = 233/895 (26.03%), Postives = 425/895 (47.49%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVD---YIRGIESTSAKEKTTSLPR-NIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNY---NDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSP 2675
            I+  +E QI++   Q  +Q KCL+ +      +L ++ + ++R+A IE EYS +L KL+   S +  S   +   +KK+    SP+     ++  T+  ++ H  L+DI+   +  RL  + ED IRL +KS +I  + H E+++  N+L    K Y     +S +   + ++   +   Q +K       ++R +D+ +      +I+K++E+   R  ++   +   T ARN Y+++L +   +I  +Y +++  ++ C + GFH +L R    + S E  L T      ++    ++ +D+ +D    ++             F P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D   + R  ES  +    T + + NI         + N +E     E  YF   + Y+N     +N+ +KL++   +LK  ++ + +    C      TT      +++         ++++ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +    D+N  A +LKLYFR L+ P+F +E F ++++     N ++R     V+ ++ I++ L       ++YL +F++HL+++S EN MD  NLAI FGP LM IP+ +       Q  +N V + +I +H+ +F   R+ EGPVY++      +        + P S+     + +   GT+                                   ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  ++  S + D    S  +         DL SP
Sbjct:   13 IIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSS--REHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGDLSMNLLRHEDRPQRRSSVKKIEKMKEK---RQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYMSKINIA------KRRANQQE----TEMFYFTKFKEYVNG----SNLITKLQAKHDLLKQ-TLGEGERA-EC-----GTTRGRRNARTR---------NQDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVDDQ-NERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIKLENPAER-----VHQIQQILVTLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMHIPDGQDP--VSCQAHINEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEY------CDSPHSEPGAIDEVDHDNGTEP----------------------------------HTSDEEVEQIEAIAKFDYMGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSP 814          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Human
Match: ARHGAP4 (Rho GTPase activating protein 4 [Source:HGNC Symbol;Acc:HGNC:674])

HSP 1 Score: 288.886 bits (738), Expect = 4.323e-81
Identity = 225/876 (25.68%), Postives = 406/876 (46.35%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPN--WKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQD------------KKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQE------PVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS----KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKG-TSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDS--EGPVYQR--EPKNSNDTHNHNVKS----NEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE 2603
            +   +ETQ+++   Q ++Q++CL+ +  +   +L  + +  +RRA +E EYS  L KL+   S R       R +  ++K     SPL     L+  T+  ++    LS++    + QRL  + ED  RL +KS D+ Q+   E++  +++L   +K Y     E+  A  +   A  Q +K   R               +K  L K  R+ +      +R  +F   +   T ARN+Y++ L S+  ++  +Y +++  ++ C + GFH  L ++  ++ + E               E +E +D   D    LE +           + P  GD V +I    E      P   ++++   R + E + + NK  +  LQ      +L + +   D DV+D  +   ST + + T+S P      S     ++  ++   + E  Y   ++ YL+    +  + +K + ++  L+    ++ + +   ++      +      S    +LFGGD+ K+ + + + VPLVV+SCIR I+L G+++ G+FRV G+Q+ V   +  FE G DPL  ++G T++D++  A +LKLYFR L+PP+F  ++F E++ + ++ + T E  V  +  ++ +L  P    L+YL +F++HLA++S EN MD  NLA+ FGP L+P+P  +       Q  VN + Q LI     VF   +   GPVY++   P +++   +  ++S    NEPE +      ++              DL+ +                               V AVA F Y  ++ QE+SF++ D+L L +R +  WW G      EH     + GLIP  + T+ +  E
Sbjct:   13 LQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVELEYSRGLEKLAERFSSRGGRLGSSREHQSFRKEPSLLSPLHCWAVLLQHTRQQSRESAALSEVLAGPLAQRLSHIAEDVGRLVKKSRDLEQQLQDELLEVVSELQTAKKTYQAYHMESVNAEAKLREAERQEEKRAGRSVPTTTAGATEAGPLRKSSLKKGGRLVE------KRQAKFMEHKLKCTKARNEYLLSLASVNAAVSNYYLHDVLDLMDCCDTGFHLALGQVLRSYTAAESRTQASQVQGLGSLEEAVEALDPPGDKAKVLEVHATVFCPPLRFDYHPHDGDEVAEICVEMELRDEILPRAQNIQSRLDRQTIETEEV-NKTLKATLQ------ALLEVVASDDGDVLDSFQTSPSTESLKSTSSDP-----GSRQAGRRRGQQQ---ETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSWTQYTQRKFQKSRQPRPSSQYNQRLFGGDMEKFIQSSGQPVPLVVESCIRFINLNGLQHEGIFRVSGAQLRVSEIRDAFERGEDPL--VEGCTAHDLDSVAGVLKLYFRSLEPPLFPPDLFGELLAS-SELEATAER-VEHVSRLLWRLPAPVLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCFGPTLLPVPAGQDP--VALQGRVNQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNEPELEAEMPAQED--------------DLEGV-------------------------------VEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRG------EHNG---MRGLIPHKYITLPAGTE 807          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Human
Match: SRGAP2 (SLIT-ROBO Rho GTPase activating protein 2 [Source:HGNC Symbol;Acc:HGNC:19751])

HSP 1 Score: 285.419 bits (729), Expect = 5.229e-81
Identity = 225/862 (26.10%), Postives = 406/862 (47.10%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKEV----------------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNL--AASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTI 2588
            I+  ++TQ+++   Q T+Q+KCLD +  +   +L ++ D ++++A IE +YS NL KL+     +  S   K   +KK+    SP+   N L+   +  ++ H  LSDIY   +  R + + ED  RL +KS ++ Q+   ++++ LN+L    K Y      S +   + ++   +   Q+ K V                +R ++K        +I+K++E+   R  ++   +  +  ARN+Y++ L +   S+  +Y ++L  ++ C + G+H +L R      S E  L        +     +E +DA +D +  +E             F P  GD  +Q+   Q+PVQ++L    Q+  + + ++  + EE K  +++  +++ D +   D+DV D  +   S  + + T S     ++       + N +E     E  YF  M+ YL       N+ +KL++   +L+  ++ +SQ T    +   ST                    +++ + +PLVV+SCIR IS +G+++ G+FRV GSQ++V   K+ FE G DP   L G  ND ++   A +LKLYFR L+ P+F +++F++++         + ++   ++ ++L L       ++YL +F++HL++FS EN MD  NLAI FGP LM +PE         Q  VN + + +I  H+ +F   R+ EGPVY R                        + +D   C +        P  +     +ST+ V +            SD E    + A+A FDY  ++ +E+SFKK   L+L +R ++ WW G       H     ++GLIP  +  +
Sbjct:   13 IIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRS--TKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEK---RQAKYTENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCA-QQPVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMESVKSTVS--ETFMSKPSIAKRRANQQE----TEQFYFTKMKEYLEGR----NLITKLQAKHDLLQK-TLGESQRTDCSLARRSSTVR-----------------KQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDP---LAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQERAL--HIRKVLLVLPKTTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQ--VSCQAHVNELIKTIIIQHENIFPSPRELEGPVYSR----------------------GGSMED--YCDS--------PHGETTSVEDSTQDVTAE--------HHTSDDE-CEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGR------HNG---IDGLIPHQYIVV 783          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Celegans
Match: srgp-1 (Slit-Robo GAP homolog [Source:UniProtKB/TrEMBL;Acc:D3YT53])

HSP 1 Score: 247.669 bits (631), Expect = 3.277e-67
Identity = 211/722 (29.22%), Postives = 345/722 (47.78%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQ-DKKKELDKNP-------RIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVH--DSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVD-YIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENS----YFEAMESYLNNEINMTNMSSKLKSVETVL-KNISI----DDSQNTLYCFSSIHSTTAVIIGI---------KSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQR 2162
            I+   E   ++F  + +DQ+KCL  +  V  S LS + D +++R  IE EY+  L KLS +I+Q++ SE  +R  W ++ S  TV + L+  T+   K  ++L ++YGKQMT  +    ED  +++++  +I    H E+ R L +L    K Y   +             M  ++++    + D K+  D NP       R + L + +  R  +F++ +   T ARN+Y++ + +   ++  F++ +L  ++ C + G    L  L +     E    T H  DS+++L T     +D + D + F EAN     L +   F P  GD++ ++   Q    + L+   Q        I  ++E  + ++D + KSL      S+  ++  Y    +  + K +          + L+ + Q   K+ +    N       EA  + +   +    +S K  SV +   +N S       SQN  +      S    I GI         + KLFGG L +Y + T E +PL+VQS I  +S Y +RN G+FRV GSQ ++  ++  +E G D  + L   S D N AA +LKLYFREL  PIF   MF +  +       T+   V   + ++ KL       L++L +F+SHL EF+ EN M+  NLAI FGP L+PIPE K  Q+F +   VN + + LI +   VF RD  GPVY +
Sbjct:   47 IVHDLECAAKEFRTKMSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREGWPQHTSS-TVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYSHNELNRVLTELQTAMKTYQLCY-----------AEMCGIERKKRSAEEDVKRYEDSNPGKYEGSRRHRSLVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGMDFWLRAL-LEKVIDERKKITQHEMDSLASLST-LRSSVDVKADKQKFFEANHQLFMLPKQFEFRPQLGDDIMEVSAEQSLSSDLLQRQLQ--------IEKRLEGLQFEVDEVWKSLE----ASEKQLLQLYNTQFDGEAGKWR----------NDLHVTYQYYLKKFEHFLLNGNLMERLEARSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNH-HLLEERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRFREAYERGEDLFQYLDDGS-DANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTE--FVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKD-QVF-YHNYVNELVRNLIIHADDVFPRDLAGPVYDK 726          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Celegans
Match: srgp-1 (Slit-Robo GAP homolog [Source:UniProtKB/TrEMBL;Acc:D3YT53])

HSP 1 Score: 244.588 bits (623), Expect = 2.889e-66
Identity = 209/714 (29.27%), Postives = 342/714 (47.90%), Query Frame = 3
Query:  108 IRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQ-DKKKELDKNP-------RIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVH--DSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVD-YIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENS----YFEAMESYLNNEINMTNMSSKLKSVETVL-KNISI----DDSQNTLYCFSSIHSTTAVIIGI---------KSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQR 2162
             ++F  + +DQ+KCL  +  V  S LS + D +++R  IE EY+  L KLS +I+Q++ SE  +R  W ++ S  TV + L+  T+   K  ++L ++YGKQMT  +    ED  +++++  +I    H E+ R L +L    K Y   +             M  ++++    + D K+  D NP       R + L + +  R  +F++ +   T ARN+Y++ + +   ++  F++ +L  ++ C + G    L  L +     E    T H  DS+++L T     +D + D + F EAN     L +   F P  GD++ ++   Q    + L+   Q        I  ++E  + ++D + KSL      S+  ++  Y    +  + K +          + L+ + Q   K+ +    N       EA  + +   +    +S K  SV +   +N S       SQN  +      S    I GI         + KLFGG L +Y + T E +PL+VQS I  +S Y +RN G+FRV GSQ ++  ++  +E G D  + L   S D N AA +LKLYFREL  PIF   MF +  +       T+   V   + ++ KL       L++L +F+SHL EF+ EN M+  NLAI FGP L+PIPE K  Q+F +   VN + + LI +   VF RD  GPVY +
Sbjct:   19 FQEFRTKMSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREGWPQHTSS-TVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYSHNELNRVLTELQTAMKTYQLCY-----------AEMCGIERKKRSAEEDVKRYEDSNPGKYEGSRRHRSLVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGMDFWLRAL-LEKVIDERKKITQHEMDSLASLST-LRSSVDVKADKQKFFEANHQLFMLPKQFEFRPQLGDDIMEVSAEQSLSSDLLQRQLQ--------IEKRLEGLQFEVDEVWKSLE----ASEKQLLQLYNTQFDGEAGKWR----------NDLHVTYQYYLKKFEHFLLNGNLMERLEARSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNH-HLLEERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRFREAYERGEDLFQYLDDGS-DANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTE--FVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKD-QVF-YHNYVNELVRNLIIHADDVFPRDLAGPVYDK 690          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Celegans
Match: srgp-1 (Slit-Robo GAP homolog [Source:UniProtKB/TrEMBL;Acc:D3YT53])

HSP 1 Score: 241.121 bits (614), Expect = 2.868e-65
Identity = 208/707 (29.42%), Postives = 338/707 (47.81%), Query Frame = 3
Query:  129 FTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQ-DKKKELDKNP-------RIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVH--DSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVD-YIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENS----YFEAMESYLNNEINMTNMSSKLKSVETVL-KNISI----DDSQNTLYCFSSIHSTTAVIIGI---------KSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQR 2162
             +DQ+KCL  +  V  S LS + D +++R  IE EY+  L KLS +I+Q++ SE  +R  W ++ S  TV + L+  T+   K  ++L ++YGKQMT  +    ED  +++++  +I    H E+ R L +L    K Y   +             M  ++++    + D K+  D NP       R + L + +  R  +F++ +   T ARN+Y++ + +   ++  F++ +L  ++ C + G    L  L +     E    T H  DS+++L T     +D + D + F EAN     L +   F P  GD++ ++   Q    + L+   Q        I  ++E  + ++D + KSL      S+  ++  Y    +  + K +          + L+ + Q   K+ +    N       EA  + +   +    +S K  SV +   +N S       SQN  +      S    I GI         + KLFGG L +Y + T E +PL+VQS I  +S Y +RN G+FRV GSQ ++  ++  +E G D  + L   S D N AA +LKLYFREL  PIF   MF +  +       T+   V   + ++ KL       L++L +F+SHL EF+ EN M+  NLAI FGP L+PIPE K  Q+F +   VN + + LI +   VF RD  GPVY +
Sbjct:    1 MSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREGWPQHTSS-TVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYSHNELNRVLTELQTAMKTYQLCY-----------AEMCGIERKKRSAEEDVKRYEDSNPGKYEGSRRHRSLVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGMDFWLRAL-LEKVIDERKKITQHEMDSLASLST-LRSSVDVKADKQKFFEANHQLFMLPKQFEFRPQLGDDIMEVSAEQSLSSDLLQRQLQ--------IEKRLEGLQFEVDEVWKSLE----ASEKQLLQLYNTQFDGEAGKWR----------NDLHVTYQYYLKKFEHFLLNGNLMERLEARSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNH-HLLEERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRFREAYERGEDLFQYLDDGS-DANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTE--FVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKD-QVF-YHNYVNELVRNLIIHADDVFPRDLAGPVYDK 665          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Celegans
Match: srgp-1 (Slit-Robo GAP homolog [Source:UniProtKB/TrEMBL;Acc:D3YT53])

HSP 1 Score: 148.673 bits (374), Expect = 9.322e-37
Identity = 90/211 (42.65%), Postives = 124/211 (58.77%), Query Frame = 3
Query: 1530 KSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQR 2162
            + KLFGG L +Y + T E +PL+VQS I  +S Y +RN G+FRV GSQ ++  ++  +E G D  + L   S D N AA +LKLYFREL  PIF   MF +  +       T+   V   + ++ KL       L++L +F+SHL EF+ EN M+  NLAI FGP L+PIPE K  Q+F +   VN + + LI +   VF RD  GPVY +
Sbjct:   73 RPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRFREAYERGEDLFQYLDDGS-DANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTE--FVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKD-QVF-YHNYVNELVRNLIIHADDVFPRDLAGPVYDK 278          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Celegans
Match: pac-1 (GTPase-activating protein pac-1 [Source:UniProtKB/Swiss-Prot;Acc:P34288])

HSP 1 Score: 93.2041 bits (230), Expect = 1.047e-18
Identity = 49/160 (30.63%), Postives = 94/160 (58.75%), Query Frame = 3
Query: 1578 KEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFE-LGTDP-----LKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKR--TDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLM 2033
            ++ VP++VQ+C+ +I  YGM  +G++R+PG+   V + K      G D      ++SL     DVN+ +S+LK++ R+L  P+  ++++   +    D+ R  T  + ++ L+ ++ KL  P Y TL++L+  +S + + S  N M+  NLA++FGP ++
Sbjct: 1072 EDHVPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWRDVNVVSSLLKMFLRKLPEPLLTDKLYPFFI----DANRISTHHNRLHKLRNLLRKLPRPHYDTLRFLIVHLSEITKHSDVNKMECRNLALMFGPSIV 1227          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0300966)

HSP 1 Score: 87.4261 bits (215), Expect = 8.236e-17
Identity = 55/205 (26.83%), Postives = 100/205 (48.78%), Query Frame = 3
Query: 1524 GI-KSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLM--PIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF 2129
            GI + ++F  DL ++   + + +P+V++SC   I  YG+ + G++R+ G   ++Q  +  F+    P         D++  +S+LK+YFREL  P+   ++++  V          +  +  +K  +LKL PP Y TLKYL   +  +++      M   NLAI++ P L+  P  E       +   +   V + LI N   +F
Sbjct:  415 GIYRERVFNCDLSEHLLNSGQDIPMVLRSCAEFIENYGVID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIF 618          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0332179)

HSP 1 Score: 87.4261 bits (215), Expect = 8.238e-17
Identity = 55/205 (26.83%), Postives = 100/205 (48.78%), Query Frame = 3
Query: 1524 GI-KSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLM--PIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF 2129
            GI + ++F  DL ++   + + +P+V++SC   I  YG+ + G++R+ G   ++Q  +  F+    P         D++  +S+LK+YFREL  P+   ++++  V          +  +  +K  +LKL PP Y TLKYL   +  +++      M   NLAI++ P L+  P  E       +   +   V + LI N   +F
Sbjct:  415 GIYRERVFNCDLSEHLLNSGQDIPMVLRSCAEFIENYGVID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIF 618          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0081318)

HSP 1 Score: 87.4261 bits (215), Expect = 8.238e-17
Identity = 55/205 (26.83%), Postives = 100/205 (48.78%), Query Frame = 3
Query: 1524 GI-KSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLM--PIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF 2129
            GI + ++F  DL ++   + + +P+V++SC   I  YG+ + G++R+ G   ++Q  +  F+    P         D++  +S+LK+YFREL  P+   ++++  V          +  +  +K  +LKL PP Y TLKYL   +  +++      M   NLAI++ P L+  P  E       +   +   V + LI N   +F
Sbjct:  415 GIYRERVFNCDLSEHLLNSGQDIPMVLRSCAEFIENYGVID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIF 618          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0300967)

HSP 1 Score: 87.4261 bits (215), Expect = 8.589e-17
Identity = 55/205 (26.83%), Postives = 100/205 (48.78%), Query Frame = 3
Query: 1524 GI-KSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLM--PIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF 2129
            GI + ++F  DL ++   + + +P+V++SC   I  YG+ + G++R+ G   ++Q  +  F+    P         D++  +S+LK+YFREL  P+   ++++  V          +  +  +K  +LKL PP Y TLKYL   +  +++      M   NLAI++ P L+  P  E       +   +   V + LI N   +F
Sbjct:  415 GIYRERVFNCDLSEHLLNSGQDIPMVLRSCAEFIENYGVID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIF 618          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Fly
Match: RhoGAPp190 (gene:FBgn0026375 transcript:FBtr0333660)

HSP 1 Score: 78.1814 bits (191), Expect = 4.364e-14
Identity = 55/193 (28.50%), Postives = 92/193 (47.67%), Query Frame = 3
Query: 1587 VPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEI--------VNN--YNDSKRTDESI-VNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT 2132
            +P+ +  C+  I   G+ + G++RVPGS+  V     +FE  T+    +      VN  A+ LK +F +  PP+F++++  E+        V N   N   +TD S  +  LK ++ KL P  +  LKY+     H+++ S  N MD  NLAI + P L+PI         Q +  +  + Q +I     +F 
Sbjct: 1381 IPIFLNKCVEFIEKEGLDSEGIYRVPGSRAHVDMLFQRFEEDTN--TEIDALDIPVNAVATALKDFFSKRLPPLFSKDIIKELEEIAGSRGVGNSKLNVEVKTDRSCRLIALKSLLQKLPPINFAILKYIFQHFVHVSDNSKLNSMDSKNLAICWWPTLIPIDFTDMGHFEQLRPYLEDIVQTMIDQFPYLFC 1571          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Zebrafish
Match: srgap1b (SLIT-ROBO Rho GTPase activating protein 1b [Source:ZFIN;Acc:ZDB-GENE-041210-103])

HSP 1 Score: 315.464 bits (807), Expect = 7.039e-90
Identity = 240/881 (27.24%), Postives = 424/881 (48.13%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKE--------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE----LSTNVESVENDDSVKSNYMDLSSP 2675
            I+  +E+Q+++   Q  +Q KCL+ +  +   +L ++ D ++++A IE EYS NL KL+     +  S       +KK+    SP+     L+   +  +K H  LSD+Y   +  R   + ED +RL +KS +I+ +   ++++ LN+L    K Y     E   A  +   A  Q +++         +R +D+ +  +   +I+K++E+   R  ++   +     ARN+Y++ L +   S+  +Y ++L  +  C + G+H  L+R    + S E +L T      ++    +E +D  ND + F+E +  + T      F P  GD V+QI    + VQ +L   FQ+  + + ++  + EE K   ++   ++ D +N  DYDV +  +   ST + + + S     ++       + N +E     E  YF  ++ YL      +N+ +KL++   +LK  SI +        + I +T   I       F   L  ++   K  +PL+V+SCIR I+LYG+++ G+FRV GSQ++V   K+ FE G DPL   +  ++D+N  A +LK+YFR LD PIF +E FN+++         + ++   ++ I+  +  P    ++YL +F++HL+++S EN MD  NLAI FGP LMP P+         Q  VN + + +I +H+T+F  T++ EGPVY+   K  ++T       +EP +     F++                                 GE++      +  E    V A+A FDY  +S +E++FKK   L+L +R +E WW G       H      +GLIP  + T+    +    L   V    +D+    N ++ SSP
Sbjct:   13 IITEYESQVKEIRSQLVEQQKCLEQQTDMRVQLLQDLQDFFRKKAEIESEYSRNLEKLAERFMAKTRSTK-DHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDLYLNNVITRFTHVSEDNMRLLKKSKEIIFQLQEDLMKILNELYTVMKTYHMYHTETLSAENKLKEAERQGERQGRGGEAVFSLRTEDRHQRRNAARKIQKMKEK---RQAKYSENKLKVMKARNEYLLTLEATNASLFKYYIHDLSHLTDCCDLGYHAGLSRALRTYLSAEYSLETSRHEGLDILEGAVEGLDPGNDRQRFMETHPTSFTPPTRFTFQPHMGDQVSQITALPQ-VQAELLLRFQQLQSRLSTLKIENEEVKKTSEATLSTIQDMVNMEDYDVSESFQHSRSTESVKSSVS--DTYLSKPSLAKRRANQQE----TELFYFTKLKEYLEG----SNLIAKLQAKHDMLKR-SIAEGYR-----ADIMTTRYSISNHPCLTFFNALFTFTDSGK-AIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGNDPLTD-EENNHDINSVAGVLKMYFRNLDNPIFPKEKFNDLIACVRTESLYERALS--IRKILTTMPRPTLVLMRYLFAFLNHLSQYSDENMMDPGNLAICFGPTLMPTPD--LLDQVSCQAHVNEIVKTIIIHHETIFPDTKELEGPVYE---KCMSNTEYCESPYSEPGA-----FEE---------------------------------GEQDGGTETQTSEEEGEPVEAIAKFDYVGRSGRELTFKKGSTLLLFQRASEDWWEG------RHNG---TDGLIPHQYVTLQEHRKRTEALLRRVPGRLSDNHCHGNGLERSSP 816          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Zebrafish
Match: srgap1b (SLIT-ROBO Rho GTPase activating protein 1b [Source:ZFIN;Acc:ZDB-GENE-041210-103])

HSP 1 Score: 309.686 bits (792), Expect = 1.121e-87
Identity = 236/892 (26.46%), Postives = 427/892 (47.87%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKE--------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYS----KETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELS------TNVESVENDDSVKSNYMDLSSPESQRL 2690
            I+  +E+Q+++   Q  +Q KCL+ +  +   +L ++ D ++++A IE EYS NL KL+     +  S       +KK+    SP+     L+   +  +K H  LSD+Y   +  R   + ED +RL +KS +I+ +   ++++ LN+L    K Y     E   A  +   A  Q +++         +R +D+ +  +   +I+K++E+   +  + K+K      ARN+Y++ L +   S+  +Y ++L  +  C + G+H  L+R    + S E +L T      ++    +E +D  ND + F+E +  + T      F P  GD V+QI    + VQ +L   FQ+  + + ++  + EE K   ++   ++ D +N  DYDV +  +   ST + +  +S+    ++       + N +E     E  YF  ++ YL      +N+ +KL++   +LK                     ++  G ++ +      + S    +++ + +PL+V+SCIR I+LYG+++ G+FRV GSQ++V   K+ FE G DPL   +  ++D+N  A +LK+YFR LD PIF +E FN+++         + ++   ++ I+  +  P    ++YL +F++HL+++S EN MD  NLAI FGP LMP P+         Q  VN + + +I +H+T+F  T++ EGPVY+   K  ++T       +EP +     F++                                 GE++      +  E    V A+A FDY  +S +E++FKK   L+L +R +E WW G       H      +GLIP  + T+     +S      T+ E+        S+   L+SP   R+
Sbjct:   13 IITEYESQVKEIRSQLVEQQKCLEQQTDMRVQLLQDLQDFFRKKAEIESEYSRNLEKLAERFMAKTRSTK-DHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDLYLNNVITRFTHVSEDNMRLLKKSKEIIFQLQEDLMKILNELYTVMKTYHMYHTETLSAENKLKEAERQGERQGRGGEAVFSLRTEDRHQRRNAARKIQKMKEKRQAKYSENKLKVMK---ARNEYLLTLEATNASLFKYYIHDLSHLTDCCDLGYHAGLSRALRTYLSAEYSLETSRHEGLDILEGAVEGLDPGNDRQRFMETHPTSFTPPTRFTFQPHMGDQVSQITALPQ-VQAELLLRFQQLQSRLSTLKIENEEVKKTSEATLSTIQDMVNMEDYDVSESFQHSRSTESVK--SSVSDTYLSKPSLAKRRANQQE----TELFYFTKLKEYLEG----SNLIAKLQAKHDMLKR--------------------SIAEGYRADIMTTSRRRNSHSRNQDSGKAIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGNDPLTD-EENNHDINSVAGVLKMYFRNLDNPIFPKEKFNDLIACVRTESLYERALS--IRKILTTMPRPTLVLMRYLFAFLNHLSQYSDENMMDPGNLAICFGPTLMPTPD--LLDQVSCQAHVNEIVKTIIIHHETIFPDTKELEGPVYE---KCMSNTEYCESPYSEPGA-----FEE---------------------------------GEQDGGTETQTSEEEGEPVEAIAKFDYVGRSGRELTFKKGSTLLLFQRASEDWWEG------RHNG---TDGLIPHQYVTLQEDEAMSDTLSQKTDSEASTTPSDEVSSRRSLTSPTEPRI 814          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Zebrafish
Match: srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:ZFIN;Acc:ZDB-GENE-060524-4])

HSP 1 Score: 303.138 bits (775), Expect = 2.827e-85
Identity = 233/901 (25.86%), Postives = 430/901 (47.72%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNY-SPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKEL-KFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS--------------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSP 2675
            I+  +ETQ+++   Q  +Q KCL+ +      +L ++ + ++R+A I+ EYS +L KL+   S +     ++ P  +++  S +     ++  T+  ++ H  L+DIY   +  RL  + ED IRL +KS +I  + H E+++  N+L    K Y    T+S +   + +    +   Q  K       ++R +D+ +      +I+K++E+   R  ++   +   T ARN Y+++L +    +  +Y +++  ++ C + G+H +L R    + S E  L T      ++    ++ +D  +D    ++             F+P  GD V Q+   Q+PVQ +L   F +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST +        +++ ++S  + L    +   + + E  YF   + YLN     +N+  KL++   +LK  ++ + +      +   +T    +  K               KLF G++  + K++ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   + + +D+N  A +LKLYFR L+ P+F +E F ++++        + +  + ++ II+ L       L+YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +++ +F   R+ +GPVY++      +        + P S+   T D+   C        ++P                            SD E    + A+A FDY  ++ +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  ++  S + D    S  +         DL SP
Sbjct:   13 IIAEYETQVKEIRNQLVEQFKCLEQQSEARIQLLQDLQEFFRRKAEIQLEYSRSLEKLAERFSSK-----IRGPRKEQHLLSSVNCWYLVLNQTRRESRDHATLNDIYINNVIVRLAQISEDVIRLFKKSKEIGIQMHEELVKVTNELYTVMKTYHMYHTESISAESKLKDAEKQEEKQFSKSGDLNVNLLRHEDRPQRRSSVRKIEKMKEK---RQAKYSENKLKCTKARNDYLLNLAATNAVVAKYYIHDVSDMIDCCDLGYHASLARTLRTYLSAEYNLETSRHEGLDIIENAVDNLDPRSDKHKIMDMYNQVFCPPMRFEFLPHMGDEVCQV-SAQQPVQTELLMRFHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESI-------KSVASESYMSKLNIAKRRANQQETEVFYFTKFKEYLNG----SNLIIKLQAKHDLLKQ-TLGEGER-----AECGTTRPPTLPPKPQKLRKPRPRSVYNHKLFNGNMESFIKDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVDDQ-SDHDINSVAGVLKLYFRGLENPLFPKERFLDMISTVKLESSAERA--HHIQQIIVTLPRTVIIVLRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VACQAHVNEVIKTIIMHNEIIFPSPRELDGPVYEKCMTGGEEY------CDSPHSEPG-TIDEADNC--------TEP--------------------------HTSDDEV-EQIEAIAKFDYMGRTPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQDLDDAFSDSLSQKADSEASSGPLLDDKASSKNDLHSP 831          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Zebrafish
Match: srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:ZFIN;Acc:ZDB-GENE-060524-4])

HSP 1 Score: 293.893 bits (751), Expect = 3.115e-82
Identity = 229/887 (25.82%), Postives = 425/887 (47.91%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNY-SPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKEL-KFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSP 2675
            I+  +ETQ+++   Q  +Q KCL+ +      +L ++ + ++R+A I+ EYS +L KL+   S +     ++ P  +++  S +     ++  T+  ++ H  L+DIY   +  RL  + ED IRL +KS +I  + H E+++  N+L    K Y    T+S +   + +    +   Q  K       ++R +D+ +      +I+K++E+   R  ++   +   T ARN Y+++L +    +  +Y +++  ++ C + G+H +L R    + S E  L T      ++    ++ +D  +D    ++             F+P  GD V Q+   Q+PVQ +L   F +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST +        +++ ++S  + L    +   + + E  YF   + YLN     +N+  KL++   +LK  ++ + +    C      TT      +++         ++++ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   + + +D+N  A +LKLYFR L+ P+F +E F ++++        + +  + ++ II+ L       L+YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +++ +F   R+ +GPVY++      +        + P S+   T D+   C        ++P                            SD E    + A+A FDY  ++ +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  ++  S + D    S  +         DL SP
Sbjct:   13 IIAEYETQVKEIRNQLVEQFKCLEQQSEARIQLLQDLQEFFRRKAEIQLEYSRSLEKLAERFSSK-----IRGPRKEQHLLSSVNCWYLVLNQTRRESRDHATLNDIYINNVIVRLAQISEDVIRLFKKSKEIGIQMHEELVKVTNELYTVMKTYHMYHTESISAESKLKDAEKQEEKQFSKSGDLNVNLLRHEDRPQRRSSVRKIEKMKEK---RQAKYSENKLKCTKARNDYLLNLAATNAVVAKYYIHDVSDMIDCCDLGYHASLARTLRTYLSAEYNLETSRHEGLDIIENAVDNLDPRSDKHKIMDMYNQVFCPPMRFEFLPHMGDEVCQV-SAQQPVQTELLMRFHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESI-------KSVASESYMSKLNIAKRRANQQETEVFYFTKFKEYLNG----SNLIIKLQAKHDLLKQ-TLGEGERA-EC-----GTTRGRRNARTR---------NQDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVDDQ-SDHDINSVAGVLKLYFRGLENPLFPKERFLDMISTVKLESSAERA--HHIQQIIVTLPRTVIIVLRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VACQAHVNEVIKTIIMHNEIIFPSPRELDGPVYEKCMTGGEEY------CDSPHSEPG-TIDEADNC--------TEP--------------------------HTSDDEV-EQIEAIAKFDYMGRTPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQDLDDAFSDSLSQKADSEASSGPLLDDKASSKNDLHSP 807          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Zebrafish
Match: srgap2 (SLIT-ROBO Rho GTPase activating protein 2 [Source:NCBI gene;Acc:556198])

HSP 1 Score: 284.648 bits (727), Expect = 4.650e-79
Identity = 223/865 (25.78%), Postives = 409/865 (47.28%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKEV----------------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNL--AASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQR--EPKNSNDT-HNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTI 2588
            I+  +ETQ+++   Q  +Q+KCLD +  +   +L ++ D ++++A IE +YS NL KL+     +  +   K P +KK     SP+   N L+A  +  ++ H  LSD+Y   +  R   + ED  RL +KS ++  +   ++++ LN+L    K Y      S N   + ++   +   Q+ + V                I+ +DK        +I+K++E+   R  ++   +  +  ARN+Y++ L +    +  +Y ++L  ++ C + G+H +L R    + S E  + T             E ++A +D +  +E             F    GD V  +   Q+PVQ +L    Q+  + + +++ + EE K  +++  +++ D +   D+DV D      S  + + T S   + ++       + N +E     E  YF  ++ +L       N+ +KL++   +++  ++ +SQ T YC +S    + V                 +E  +++PL+V+SCIR IS +G+ + G+FRV GSQ++V   K+ FE G DP   L G  ND ++   A +LKLYFR L+  +F +E+F+++++  +     + ++   ++ ++L L       ++YL +F++HL+++S +N MD  NLAI FGP LM +PE         Q  VN + + +I +H+++F   R+ EGPVY R   P+   D+ H      +EP  D      +     +D+V  KS P    L  +ES                          + A+A FDY  ++++E+SFKK   L+L  R ++ WW G       H       GL+P  +  +
Sbjct:   13 IIAEYETQVKEIRAQLVEQLKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAK--TRYTKDPQFKKEQNILSPVNCWNLLLAQVKRESRDHATLSDLYLNNIIPRFAQISEDSGRLFKKSKEVGLQLQEDLMKVLNELYTVMKTYHMYNMDSINAESKLKEAEKQEEKQMSRSVRHEEKQTPRSPDSLTNIKIEDKHVRRSSVKKIEKMKEK---RQAKYTENKLKAIKARNEYLLALEATNSCVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEFNVETSKHGGLETIENAAENLEANSDKQRLMETYNNVFCPPMRFDFQSHMGDMVGHLCA-QQPVQGELIQRCQQLQSRLSTLNIENEEVKKTMEATLQTIQDMVTIEDFDVTDCFHHSNSMESVKSTVS--ESFMSKPSLAKRRANQQE----TEQFYFTKLKEFLEGR----NLITKLQAKHDLIQK-TLGESQKTDYCLASGRRDSTV---------------RKQEAIQIIPLMVESCIRFISRHGLHHEGIFRVSGSQVEVNDIKNAFERGEDP---LAGDQNDHDMDSIAGVLKLYFRGLENALFPKEVFHDLMSCVSIESLQERAV--HIRKVLLSLPSNILVIMRYLFAFLNHLSQYSDDNMMDPYNLAICFGPTLMSVPEGHDQ--VSCQAHVNELIKTIIIHHESIFPGPRELEGPVYDRGGAPEEYCDSPHIEPPLVDEPAPDTVSVIHN-----SDDV--KSGP----LTVSES------------------------DPIEAIARFDYSGRTNRELSFKKGASLLLYSRASDDWWEG------RHNG---TEGLVPHQYIVV 794          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Xenopus
Match: bves (blood vessel epicardial substance [Source:Xenbase;Acc:XB-GENE-484277])

HSP 1 Score: 316.235 bits (809), Expect = 1.124e-89
Identity = 241/889 (27.11%), Postives = 430/889 (48.37%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKEL---DKNPR---IKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISID------DSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE-----LSTNVESVENDDSV---KSNYMDLSSP 2675
            I+  +E+Q+++   Q  +Q KCL+ +  +   +L ++ D ++++A IE EYS NL KL+     +  S       +KK+    SP+     L+   +  +K H  LSDIY   +  R + + ED  R+ +KS +I  + H ++++ LN+L    K Y     E+  A  +   A  Q +K++ R  D    L   DK+ R   +KK+ +   +R  ++   +  S  ARN+Y++ L +   S+  +Y ++L  ++ C + G+H +L R    + S E  L T      ++    ++ ++  ND + F+E             F P  GD V  ++  Q+P+Q +L   +Q+  + + ++  + EE K   ++  +++ D +   DYDV +  +   ST + + T S     ++       + N +E     E  YF     +L      +N+ +KL++   +L+    D      D    +                 +KLF GDL  + KE+ +++PL+V+SCIR I+LYG+++ G+FRV GSQ++V   K+ FE G DPL   +  ++D+N  A +LKLYFR L+ P+F +E FN++++        + +I    + I+L L       ++YL +F++HL+++S EN MD  NLAI FGP LMP+P+ +       Q  VN + + +I +H+T+F   ++ EGPVY++    + D +      + P S+   T D+                            V  + G E      ++  +    + A+A FDY  +S +E+SFKK   L+L  R ++ WW G       H     ++GL+P  +  +   ++     LS   +S  + + V   KS+  DL+SP
Sbjct:   13 IIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFMAKTRSTK-DHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESLSAECKLKEAEKQEEKQIGRSADPVFHLRLEDKHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDNLEPRNDKQRFMEMYPTAFCPPMKFEFQPHLGDEVC-MVSAQQPLQGELILRYQQLQSRLATLKIENEEIKKTTEATQQTIQDMVTIEDYDVSECFQHSRSTESVKSTVS--ETYLSKPSIAKRRANQQE----TEQFYFMKFREHLEG----SNLITKLQAKHDLLQRTLGDGRGKEQDRPPHVPPKPQKQKKPRPQSQYITKLFNGDLESFIKESGQIIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNAFERGEDPLTDDQN-NHDINSVAGVLKLYFRGLENPLFPKERFNDLISCIRIENLYERAIQT--RKILLTLPRTVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPVPDIQDQ--VSCQAHVNEIVKTIIIHHETIFPDAKELEGPVYEK--CMAGDDY-----CDSPYSEHG-TLDE----------------------------VDQDAGNET-----HTSEDECEPIEAIAKFDYIGRSARELSFKKGASLLLYHRASQDWWEG------RHNG---IDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSEPVTEDKSSSKDLTSP 834          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Xenopus
Match: bves (blood vessel epicardial substance [Source:Xenbase;Acc:XB-GENE-484277])

HSP 1 Score: 315.079 bits (806), Expect = 3.004e-89
Identity = 241/894 (26.96%), Postives = 434/894 (48.55%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKEL---DKNPR---IKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIK-----------SKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE-----LSTNVESVENDDSV---KSNYMDLSSP 2675
            I+  +E+Q+++   Q  +Q KCL+ +  +   +L ++ D ++++A IE EYS NL KL+     +  S       +KK+    SP+     L+   +  +K H  LSDIY   +  R + + ED  R+ +KS +I  + H ++++ LN+L    K Y     E+  A  +   A  Q +K++ R  D    L   DK+ R   +KK+ +   +R  ++   +  S  ARN+Y++ L +   S+  +Y ++L  ++ C + G+H +L R    + S E  L T      ++    ++ ++  ND + F+E             F P  GD V  ++  Q+P+Q +L   +Q+  + + ++  + EE K   ++  +++ D +   DYDV +  +   ST + + T S     ++       + N +E     E  YF     +L      +N+ +KL++   +L+  ++ D +     + +           K           +KLF GDL  + KE+ +++PL+V+SCIR I+LYG+++ G+FRV GSQ++V   K+ FE G DPL   +  ++D+N  A +LKLYFR L+ P+F +E FN++++        + +I    + I+L L       ++YL +F++HL+++S EN MD  NLAI FGP LMP+P+ +       Q  VN + + +I +H+T+F   ++ EGPVY++    + D +      + P S+   T D+                            V  + G E      ++  +    + A+A FDY  +S +E+SFKK   L+L  R ++ WW G       H     ++GL+P  +  +   ++     LS   +S  + + V   KS+  DL+SP
Sbjct:   13 IIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFMAKTRSTK-DHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESLSAECKLKEAEKQEEKQIGRSADPVFHLRLEDKHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDNLEPRNDKQRFMEMYPTAFCPPMKFEFQPHLGDEVC-MVSAQQPLQGELILRYQQLQSRLATLKIENEEIKKTTEATQQTIQDMVTIEDYDVSECFQHSRSTESVKSTVS--ETYLSKPSIAKRRANQQE----TEQFYFMKFREHLEG----SNLITKLQAKHDLLQR-TLGDGRGHRAEYMTTRPPHVPPKPQKQKKPRPQSQYITKLFNGDLESFIKESGQIIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNAFERGEDPLTDDQN-NHDINSVAGVLKLYFRGLENPLFPKERFNDLISCIRIENLYERAIQT--RKILLTLPRTVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPVPDIQDQ--VSCQAHVNEIVKTIIIHHETIFPDAKELEGPVYEK--CMAGDDY-----CDSPYSEHG-TLDE----------------------------VDQDAGNET-----HTSEDECEPIEAIAKFDYIGRSARELSFKKGASLLLYHRASQDWWEG------RHNG---IDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSEPVTEDKSSSKDLTSP 838          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Xenopus
Match: rab39a (RAB39A, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-1011717])

HSP 1 Score: 312.768 bits (800), Expect = 1.349e-88
Identity = 229/859 (26.66%), Postives = 417/859 (48.54%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKEV------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS---------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTI 2588
            I+  +E Q+++   Q  +Q+KCL+ +     ++L ++ + ++R+A IE EYS +L KL+   S +  S   ++ ++KK+    SP+     ++  T+  +K H  L+DI+   +  RL  + ED +RL +KS +I  + H E+ +  N+L    K Y     +S +   + +    +   Q  K V      +R +++ +      +I+K++E+   R  ++   +   T ARN+Y+++L +    I  +Y +++  ++ C++ GFH +L R    + S E  L T      ++    ++ +DA +D    ++             + P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST   E   S         L  S ++  ++   + E+ YF   + YLN     +N+ +KL++   +LK  ++ + +   Y  +   S       ++          KLF G++  + K++ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL     +  D+N  A +LKLYFR L+ P+F +E F ++++        +   V+ ++ I++ L       ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +H+++F   R+ EGPVY++      D        + P S+             DE    ++P                           ++  E    + A+A FDY  ++ +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +
Sbjct:   10 IIADYENQVKEIRSQLVEQLKCLEQQSESRLALLQDLQEFFRRKAEIELEYSRSLDKLAERFSSKLRSAR-EQHHFKKDQHLLSPVNCWYLVLTQTRRESKDHATLNDIFLNNVIVRLSHISEDVMRLFKKSKEIGLQMHEELAKVTNELYTVMKTYHMYHAESISAESKLKDAEKQEEKQFSKVVELTSNALRLEERPQRRSSVKKIEKMKEK---RQAKYSENKLKCTKARNEYLLNLAATNGCISKYYIHDVSDLIDCSDLGFHASLARTFRTYLSAEYNLETSRHEGLDIIENAVDNLDARSDKHKIMDLYNQVFCPPLKFDYQPHMGDEVCQV-SAQQPVQMELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRST---ESIKSAASETYMSKLNISKRRANQQ---ETESFYFSKFKEYLNG----SNLITKLQAKHDLLKQ-TLGEGERADYGTTRPPSLPPKPQKMRKPRPRSSYNLKLFNGNMELFIKDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVE-DHSERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIKIENCLER--VHHIRQILITLPRSVLVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VSCQAHVNEVIKTIIISHESIFPSHRELEGPVYEKCMTGGEDY------CDSPHSEPG---------AIDEGDNGTEP---------------------------HTSDEEVEQIEAIARFDYVGRTPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVV 796          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Xenopus
Match: rab39a (RAB39A, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-1011717])

HSP 1 Score: 309.301 bits (791), Expect = 1.464e-88
Identity = 231/854 (27.05%), Postives = 411/854 (48.13%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKEV------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKN-ISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNN---YNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTI 2588
            I+  +E Q+++   Q  +Q+KCL+ +     ++L ++ + ++R+A IE EYS +L KL+   S +  S   ++ ++KK+    SP+     ++  T+  +K H  L+DI+   +  RL  + ED +RL +KS +I  + H E+ +  N+L    K Y     +S +   + +    +   Q  K V      +R +++ +      +I+K++E+   R  ++   +   T ARN+Y+++L +    I  +Y +++  ++ C++ GFH +L R    + S E  L T      ++    ++ +DA +D    ++             + P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST   E   S         L  S ++  ++   + E+ YF   + YLN     +N+ +KL++   +LK  +   +  N   C S +            +L G D       + + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL     +  D+N  A +LKLYFR L+ P+F +E F ++++    YN  +      V+ ++ I++ L       ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +H+++F   R+ EGPVY++      D        + P S+             DE    ++P                           ++  E    + A+A FDY  ++ +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  I
Sbjct:   10 IIADYENQVKEIRSQLVEQLKCLEQQSESRLALLQDLQEFFRRKAEIELEYSRSLDKLAERFSSKLRSAR-EQHHFKKDQHLLSPVNCWYLVLTQTRRESKDHATLNDIFLNNVIVRLSHISEDVMRLFKKSKEIGLQMHEELAKVTNELYTVMKTYHMYHAESISAESKLKDAEKQEEKQFSKVVELTSNALRLEERPQRRSSVKKIEKMKEK---RQAKYSENKLKCTKARNEYLLNLAATNGCISKYYIHDVSDLIDCSDLGFHASLARTFRTYLSAEYNLETSRHEGLDIIENAVDNLDARSDKHKIMDLYNQVFCPPLKFDYQPHMGDEVCQV-SAQQPVQMELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRST---ESIKSAASETYMSKLNISKRRANQQ---ETESFYFSKFKEYLNG----SNLITKLQAKHDLLKQTLGEGEPLNRKTCISLL------------RLHGQD-------SGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVE-DHSERDINSVAGVLKLYFRGLENPLFPKERFQDLISTISEYNYER------VHHIRQILITLPRSVLVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VSCQAHVNEVIKTIIISHESIFPSHRELEGPVYEKCMTGGEDY------CDSPHSEPG---------AIDEGDNGTEP---------------------------HTSDEEVEQIEAIARFDYVGRTPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIDI 769          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Xenopus
Match: rab39a (RAB39A, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-1011717])

HSP 1 Score: 312.768 bits (800), Expect = 2.282e-88
Identity = 229/859 (26.66%), Postives = 417/859 (48.54%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKEV------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS---------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTI 2588
            I+  +E Q+++   Q  +Q+KCL+ +     ++L ++ + ++R+A IE EYS +L KL+   S +  S   ++ ++KK+    SP+     ++  T+  +K H  L+DI+   +  RL  + ED +RL +KS +I  + H E+ +  N+L    K Y     +S +   + +    +   Q  K V      +R +++ +      +I+K++E+   R  ++   +   T ARN+Y+++L +    I  +Y +++  ++ C++ GFH +L R    + S E  L T      ++    ++ +DA +D    ++             + P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST   E   S         L  S ++  ++   + E+ YF   + YLN     +N+ +KL++   +LK  ++ + +   Y  +   S       ++          KLF G++  + K++ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL     +  D+N  A +LKLYFR L+ P+F +E F ++++        +   V+ ++ I++ L       ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +H+++F   R+ EGPVY++      D        + P S+             DE    ++P                           ++  E    + A+A FDY  ++ +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +
Sbjct:   10 IIADYENQVKEIRSQLVEQLKCLEQQSESRLALLQDLQEFFRRKAEIELEYSRSLDKLAERFSSKLRSAR-EQHHFKKDQHLLSPVNCWYLVLTQTRRESKDHATLNDIFLNNVIVRLSHISEDVMRLFKKSKEIGLQMHEELAKVTNELYTVMKTYHMYHAESISAESKLKDAEKQEEKQFSKVVELTSNALRLEERPQRRSSVKKIEKMKEK---RQAKYSENKLKCTKARNEYLLNLAATNGCISKYYIHDVSDLIDCSDLGFHASLARTFRTYLSAEYNLETSRHEGLDIIENAVDNLDARSDKHKIMDLYNQVFCPPLKFDYQPHMGDEVCQV-SAQQPVQMELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRST---ESIKSAASETYMSKLNISKRRANQQ---ETESFYFSKFKEYLNG----SNLITKLQAKHDLLKQ-TLGEGERADYGTTRPPSLPPKPQKMRKPRPRSSYNLKLFNGNMELFIKDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVE-DHSERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIKIENCLER--VHHIRQILITLPRSVLVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VSCQAHVNEVIKTIIISHESIFPSHRELEGPVYEKCMTGGEDY------CDSPHSEPG---------AIDEGDNGTEP---------------------------HTSDEEVEQIEAIARFDYVGRTPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVV 796          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Mouse
Match: Srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:MGI Symbol;Acc:MGI:2152938])

HSP 1 Score: 309.301 bits (791), Expect = 2.769e-87
Identity = 234/902 (25.94%), Postives = 424/902 (47.01%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS--------------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSP 2675
            I+  +E QI++   Q  +Q KCL+ +      +L ++ + ++R+A IE EYS +L KL+   S +  S   +   +KK+    SP+     ++  T+  ++ H  L+DI+   +  RL  + ED IRL +KS +I  + H E+++  N+L    K Y     +S +   + ++   +   Q +K       ++R +D+ +      +I+K++E+   R  ++   +   T ARN Y+++L +   +I  +Y +++  ++ C + GFH +L R    + S E  L T      ++    ++ +D+ +D    ++             F P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST + +   S     ++       + N +E     E  YF   + Y+N     +N+ +KL++   +LK  ++ + +      +   +T    +  K               KLF G +  + K++ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +    D+N  A +LKLYFR L+ P+F +E F ++++        D   V+ ++ I++ L       ++YL +F++HL+++S EN MD  NLAI FGP LM IP+ +       Q  VN V + +I +H+ +F   R+ EGPVY++      +        + P S+     + +   GT+                                   ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  ++  S + D    S  +         DL SP
Sbjct:   13 IIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSS--REHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGELSMNLLRHEDRPQRRSSVKKIEKMKEK---RQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCSQVFCPPLKFEFQPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESIKSAAS--ETYMSKINIAKRRANQQE----TEMFYFTKFKEYVNG----SNLITKLQAKHDLLKQ-TLGEGER-----AECGTTRPPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVVESCIRFINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVDDQ-NERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIKLENPADR--VHPIQQILITLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMHIPDGQDP--VSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEY------CDSPHSEPGTIDEVDHDNGTEP----------------------------------HTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSP 838          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Mouse
Match: Srgap1 (SLIT-ROBO Rho GTPase activating protein 1 [Source:MGI Symbol;Acc:MGI:2152936])

HSP 1 Score: 301.597 bits (771), Expect = 8.990e-85
Identity = 231/895 (25.81%), Postives = 431/895 (48.16%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEV---------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSI---------HSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE-----LSTNVESVENDDSV---KSNYMDLSSP 2675
            I+  +E+Q+++   Q  +Q KCL+ +  +   +L ++ D ++++A IE EYS NL KL+     +  S    +  +KK+    SP+     L+   +  +K H  LSDIY   +  R + + ED  R+ +KS +I  + H ++++ LN+L    K Y    +E+  A  +   A  Q +K++         IR +++ +      +I+K++E+   R  ++   +  S  ARN+Y++ L +   S+  +Y ++L  ++ C + G+H +L R    + S E  L T      ++    ++ ++  +D + F+E             F    GD V Q+   Q+PVQ +L    Q+  + + ++  + EE K   ++  +++ D +   DYDV +  +   ST + + T S     ++       + N +E     E  YF  +  +L      +N+ +KL++   +L+  ++ +     Y  +           H  +       +KLF GDL  + K++ +++PL+V+SCIR I+LYG+++ G+FRV GSQ++V   K+ FE G +PL S + +++D+N  A +LKLYFR L+ P+F +E F ++++        + ++   ++ ++L L       ++YL +F++HL+++S EN MD  NLAI FGP LMP+PE +       Q  VN + + +I +H+T+F   ++ +GPVY++     +         + P S+     + +   GT+                                   + D   P   +A   FDY  +S +E+SFKK   L+L  R +E WW G       H     ++GL+P  +  +   ++     LS   +S  +   V   KS+  D++SP
Sbjct:   13 IIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFMAKTRSTKDHQ-QFKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHSESISAESKLKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSVKKIEKMKEK---RQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQV-SAQQPVQAELMLRNQQLQSRLATLKIESEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVS--ETYLSKPSIAKRRANQQE----TEQFYFMKLREFLEG----SNLITKLQAKHDLLQR-TLGEGHRAEYMTTRPPNVPPKPQKHRKSRPRSQYNAKLFNGDLETFVKDSGQVIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGENPL-SDEQSNHDINSVAGVLKLYFRGLENPLFPKERFTDLISCIRIDNLYERAL--HIRKLLLTLPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPVPEIQDQ--VSCQAHVNEIVKTIIIHHETIFPDAKELDGPVYEKCMAGGD-------YCDSPYSEHGTLEEVDQDAGTEP--------------------------------HTSEDECEPIEAIAK--FDYVGRSARELSFKKGASLLLYHRASEDWWEG------RHNG---IDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSP 836          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Mouse
Match: Srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:MGI Symbol;Acc:MGI:2152938])

HSP 1 Score: 300.827 bits (769), Expect = 1.385e-84
Identity = 234/892 (26.23%), Postives = 421/892 (47.20%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIEST----SAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSP 2675
            I+  +E QI++   Q  +Q KCL+ +      +L ++ + ++R+A IE EYS +L KL+   S +  S   +   +KK+    SP+     ++  T+  ++ H  L+DI+   +  RL  + ED IRL +KS +I  + H E+++  N+L    K Y     +S +   + ++   +   Q +K       ++R +D+ +      +I+K++E+   R  ++   +   T ARN Y+++L +   +I  +Y +++  ++ C + GFH +L R    + S E  L T      ++    ++ +D+ +D    ++             F P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST    SA  +T     NI         + N +E     E  YF   + Y+N     +N+ +KL++   +LK  ++ + +    C      TT      +++         ++++ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +    D+N  A +LKLYFR L+ P+F +E F ++++        D   V+ ++ I++ L       ++YL +F++HL+++S EN MD  NLAI FGP LM IP+ +       Q  VN V + +I +H+ +F   R+ EGPVY++      +        + P S+     + +   GT+                                   ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  ++  S + D    S  +         DL SP
Sbjct:   13 IIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSS--REHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGELSMNLLRHEDRPQRRSSVKKIEKMKEK---RQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCSQVFCPPLKFEFQPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESIKSAASETYMSKINIA------KRRANQQE----TEMFYFTKFKEYVNG----SNLITKLQAKHDLLKQ-TLGEGERA-EC-----GTTRGRRNARTR---------NQDSGQAIPLVVESCIRFINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVDDQ-NERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIKLENPADR--VHPIQQILITLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMHIPDGQDP--VSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEY------CDSPHSEPGTIDEVDHDNGTEP----------------------------------HTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSP 814          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Mouse
Match: Srgap2 (SLIT-ROBO Rho GTPase activating protein 2 [Source:MGI Symbol;Acc:MGI:109605])

HSP 1 Score: 288.886 bits (738), Expect = 7.086e-82
Identity = 230/904 (25.44%), Postives = 420/904 (46.46%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKEV----------------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIV-QCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNL--AASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSS 2711
            I+  ++TQ+++   Q T+Q+KCLD +  +   +L ++ D ++++A IE +YS NL KL+     +  S   K   +KK+    SP+   N L+   +  ++ H  LSDIY   +  R + + ED  RL +KS ++ Q+   ++++ LN+L    K Y      S +   + ++   +   Q+ K V                +R ++K        +I+K++E+   R  ++   +  +  ARN+Y++ L +   S+  +Y ++L  I+ QC + G+H +L R      S E  L        +     +E +DA +D +  +E             F P  GD  +Q+   Q+PVQ++L    Q+  + + ++  + EE K  +++  +++ D +   D+DV D  +   S  + + T S     ++       + N +E     E  YF  M+ YL       N+ +KL++   +L+  ++ +SQ T    +   ST                    +++ + +PLVV+SCIR IS +G+++ G+FRV GSQ++V   K+ FE G DP   L G  ND ++   A +LKLYFR L+ P+F +++F++++         + ++   ++ ++L L  P    ++YL +F++HL++FS EN MD  NLAI FGP LM +PE         Q  VN + + +I  H+ +F   R+ EGP+Y R                                        S  D  +    E+T    S    +++    ++  +    + A+A FDY  ++ +E+SFKK   L+L +R ++ WW G       H     ++GLIP  +  +          + V    S KS    +S P  ++++ +  +S
Sbjct:   13 IIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRS--TKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEK---RQAKYTENKLKAIKARNEYLLALEATNASVFKYYIHDLSDIIDQCCDLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCA-QQPVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMESVKSTVS--ETFMSKPSIAKRRANQQE----TEQFYFTKMKEYLEGR----NLITKLQAKHDLLQK-TLGESQRTDCSLARRSSTVR-----------------KQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDP---LAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLIACVTMDNLQERAV--HIRKVLLVLPKPTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQ--VSCQAHVNELIKTIIIQHENIFPNPRELEGPIYSR--------------------------------------GGSMEDYCDSTHGETTSAEDST---QDVTAEHHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGR------HNG---IDGLIPHQYIVVQDTE------DGVVERSSPKSEIEVMSEPPEEKVTARTGAS 819          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Mouse
Match: Arhgap4 (Rho GTPase activating protein 4 [Source:MGI Symbol;Acc:MGI:2159577])

HSP 1 Score: 284.263 bits (726), Expect = 2.173e-80
Identity = 228/880 (25.91%), Postives = 411/880 (46.70%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNN---SENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQ----------------------DKKKELDKNPR-IKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDD-----SQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKG-TSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDS--EGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSER--PSNVL-AVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE 2603
            +   ++ Q+++   Q ++Q+ CL+ +  +   +L  + +  +RRA +E EYS  L KL+   + R+      + ++ +++K     SPL     L+  T+  ++    LS++    + QRL  + ED  R+ +KS D++Q+  AE++  +++L   +K+Y    +E+  A  +   A  Q +K   R                         +K  L K  R ++K + +YLE     K+K    T ARN+Y++ L S+  +I  +Y +++  ++ C + GFH  L +   ++ + E    T          E +E +D   D    LE +           + P + D V ++L   E + +++    Q   + +   + + EE    + +  K+L + +   D D++D ++   ST + + T+S P      +  T  ++N ++   + E  Y   ++ YL+    ++ + +K + ++  ++  + +      +Q T   F   H           +LFGGDL K+ + + + VPLVV+SCIR I+L G+++ G+FRV G+Q  +   +  FE G DPL+  KG T +D++  A +LKLYFR L+PP+F  +MFNE++ +       +   V  +  ++ KL  P    L+YL +F++HLA++S EN MD  NLA+ FGP L+P+P  +       Q  VN + Q LI     +F   +   GP+Y+              K   P S          +C  D  L+                   S +GE  L ++  + ++      VL AVA F Y  ++ QE++F++ D+L L  R +  WW G      EH     V GLIP  + T+   +E
Sbjct:   13 LQPEYDAQVKEMRWQLSEQLHCLELQGELRRDLLQELAEFMRRRAEVELEYSRGLDKLAERFTSRSGRLGGSSQEQQSFRKEPTLLSPLHCWAVLLEHTRQQSRESAALSEVLAGPLAQRLSHISEDVGRIVKKSKDLVQQLQAELLEVVSELQTTKKMYHVYHSESMNAETKLREAERQEEKRSGRSALSTTTTTSATTTTTTTTVETGPHRKSSLKKGGRLVEKRQAKYLEH----KLK---CTKARNEYLLSLASVNAAISNYYLHDILDLMDCCDTGFHLALEQALRSYTAAESRTQTSQMQGLGSLEEALEALDPPGDKAKVLEVHAMAFCPPLRFEYQPHEDDEVAEVLIEME-LWDEILPRAQNIQSRLDQKTIETEEVNKTLKATLKALLEAVASEDGDILDSLQASPSTESLKSTSSDP-----GTRQTGRRRNQQQ---ETETFYITKLQEYLSGRSILSKLQAKHEKLQEAIQQGNKEKQETSRTQCTERKFHKSHPPHPRF-QYNQRLFGGDLEKFIQSSGQPVPLVVESCIRFINLNGLQHEGIFRVSGAQARISEIRDAFERGEDPLE--KGCTVHDLDSVAGVLKLYFRSLEPPLFPLDMFNELLASAELEVVGER--VEPVSHLLFKLPRPVLVVLRYLFTFLNHLAQYSDENMMDSYNLAVCFGPTLLPVPAGQDP--VALQGRVNQLVQTLILQPARIFPPPAMLPGPIYE--------------KCMAPPSA---------SCLGDGQLE-------------------SLIGEPELELKTGTTAQEDDQEGVLEAVACFAYTGRTAQELTFQRGDVLRLYARASSDWWRG------EHAG---VQGLIPHKYITLCEGDE 818          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. UniProt/SwissProt
Match: sp|Q7Z6B7|SRGP1_HUMAN (SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 2.148e-85
Identity = 235/895 (26.26%), Postives = 430/895 (48.04%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEV---------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSI---------HSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE-----LSTNVESVENDDSV---KSNYMDLSSP 2675
            I+  +E+Q+++   Q  +Q KCL+ +  +   +L ++ D ++++A IE EYS NL KL+     +  S    +  +KK+    SP+     L+   +  +K H  LSDIY   +  R + + ED  R+ +KS +I  + H ++++ LN+L    K Y     E+  A  +   A  Q +K++         IR +++ +      +I+K++E+   R  ++   +  S  ARN+Y++ L +   S+  +Y ++L  ++ C + G+H +L R    + S E  L T      ++    ++ ++  +D + F+E             F    GD V Q+   Q+PVQ +L   +Q+  + + ++  + EE K   ++  +++ D +   DYDV +  +   ST + + T S     ++       + N +E     E  YF  +  YL      +N+ +KL++   +L+  ++ +     Y  +           H  +       +KLF GDL  + K++ +++PL+V+SCIR I+LYG+++ G+FRV GSQ++V   K+ FE G +PL   + +++D+N  A +LKLYFR L+ P+F +E FN++++        + ++   ++ ++L L       ++YL +F++HL+++S EN MD  NLAI FGP LMP+PE +       Q  VN + + +I +H+T+F   ++ +GPVY+                      K    DD       E              + +   V  + G E      + D   P   +A   FDY  +S +E+SFKK   L+L  R +E WW G       H     ++GL+P  +  +   ++     LS   +S  +   V   KS+  D++SP
Sbjct:   13 IIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFMAKTRSTKDHQ-QYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSVKKIEKMKEK---RQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQV-SAQQPVQAELMLRYQQLQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVS--ETYLSKPSIAKRRANQQE----TEQFYFMKLREYLEG----SNLITKLQAKHDLLQR-TLGEGHRAEYMTTRPPNVPPKPQKHRKSRPRSQYNTKLFNGDLETFVKDSGQVIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGENPLADDQ-SNHDINSVAGVLKLYFRGLENPLFPKERFNDLISCIRIDNLYERAL--HIRKLLLTLPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPVPEIQDQ--VSCQAHVNEIIKTIIIHHETIFPDAKELDGPVYE----------------------KCMAGDDYCDSPYSE--------------HGTLEEVDQDAGTEP---HTSEDECEPIEAIAK--FDYVGRSARELSFKKGASLLLYHRASEDWWEG------RHNG---IDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSP 836          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. UniProt/SwissProt
Match: sp|O43295|SRGP3_HUMAN (SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3)

HSP 1 Score: 305.834 bits (782), Expect = 2.617e-85
Identity = 234/905 (25.86%), Postives = 427/905 (47.18%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS--------------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNY---NDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSP 2675
            I+  +E QI++   Q  +Q KCL+ +      +L ++ + ++R+A IE EYS +L KL+   S +  S   +   +KK+    SP+     ++  T+  ++ H  L+DI+   +  RL  + ED IRL +KS +I  + H E+++  N+L    K Y     +S +   + ++   +   Q +K       ++R +D+ +      +I+K++E+   R  ++   +   T ARN Y+++L +   +I  +Y +++  ++ C + GFH +L R    + S E  L T      ++    ++ +D+ +D    ++             F P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST + +   S     ++       + N +E     E  YF   + Y+N     +N+ +KL++   +LK  ++ + +      +   +T    +  K               KLF G +  + K++ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +    D+N  A +LKLYFR L+ P+F +E F ++++     N ++R     V+ ++ I++ L       ++YL +F++HL+++S EN MD  NLAI FGP LM IP+ +       Q  +N V + +I +H+ +F   R+ EGPVY++      +        + P S+     + +   GT+                                   ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  ++  S + D    S  +         DL SP
Sbjct:   13 IIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSS--REHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGDLSMNLLRHEDRPQRRSSVKKIEKMKEK---RQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAAS--ETYMSKINIAKRRANQQE----TEMFYFTKFKEYVNG----SNLITKLQAKHDLLKQ-TLGEGER-----AECGTTRPPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVDDQ-NERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIKLENPAER-----VHQIQQILVTLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMHIPDGQDP--VSCQAHINEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEY------CDSPHSEPGAIDEVDHDNGTEP----------------------------------HTSDEEVEQIEAIAKFDYMGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSP 838          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. UniProt/SwissProt
Match: sp|Q812A2|SRGP3_MOUSE (SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Srgap3 PE=1 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 3.717e-85
Identity = 233/902 (25.83%), Postives = 423/902 (46.90%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS--------------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSP 2675
            I+  +E QI++   Q  +Q KCL+ +      +L ++ + ++R+A IE EYS +L KL+   S +  S   +   +KK+    SP+     ++  T+  ++ H  L+DI+   +  RL  + ED IRL +KS +I  + H E+++  N+L    K Y     +S +   + ++   +   Q +K       ++R +D+ +      +I+K++E+   R  ++   +   T ARN Y+++L +   +I  +Y +++  ++ C + GFH +L R    + S E  L T      ++    ++ +D+ +D    ++             F P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST + +   S     ++       + N +E     E  YF   + Y+N     +N+ +KL++   +LK  ++ + +      +   +T    +  K               KLF G +  + K++ + +PLV +SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +    D+N  A +LKLYFR L+ P+F +E F ++++        D   V+ ++ I++ L       ++YL +F++HL+++S EN MD  NLAI FGP LM IP+ +       Q  VN V + +I +H+ +F   R+ EGPVY++      +        + P S+     + +   GT+                                   ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  ++  S + D    S  +         DL SP
Sbjct:   13 IIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSS--REHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGELSMNLLRHEDRPQRRSSVKKIEKMKEK---RQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCSQVFCPPLKFEFQPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESIKSAAS--ETYMSKINIAKRRANQQE----TEMFYFTKFKEYVNG----SNLITKLQAKHDLLKQ-TLGEGER-----AECGTTRPPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVAESCIRFINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVDDQ-NERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIKLENPADR--VHPIQQILITLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMHIPDGQDP--VSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEY------CDSPHSEPGTIDEVDHDNGTEP----------------------------------HTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSP 838          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. UniProt/SwissProt
Match: sp|P98171|RHG04_HUMAN (Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2)

HSP 1 Score: 288.886 bits (738), Expect = 2.076e-80
Identity = 225/876 (25.68%), Postives = 406/876 (46.35%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPN--WKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQD------------KKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQE------PVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS----KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKG-TSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDS--EGPVYQR--EPKNSNDTHNHNVKS----NEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE 2603
            +   +ETQ+++   Q ++Q++CL+ +  +   +L  + +  +RRA +E EYS  L KL+   S R       R +  ++K     SPL     L+  T+  ++    LS++    + QRL  + ED  RL +KS D+ Q+   E++  +++L   +K Y     E+  A  +   A  Q +K   R               +K  L K  R+ +      +R  +F   +   T ARN+Y++ L S+  ++  +Y +++  ++ C + GFH  L ++  ++ + E               E +E +D   D    LE +           + P  GD V +I    E      P   ++++   R + E + + NK  +  LQ      +L + +   D DV+D  +   ST + + T+S P      S     ++  ++   + E  Y   ++ YL+    +  + +K + ++  L+    ++ + +   ++      +      S    +LFGGD+ K+ + + + VPLVV+SCIR I+L G+++ G+FRV G+Q+ V   +  FE G DPL  ++G T++D++  A +LKLYFR L+PP+F  ++F E++ + ++ + T E  V  +  ++ +L  P    L+YL +F++HLA++S EN MD  NLA+ FGP L+P+P  +       Q  VN + Q LI     VF   +   GPVY++   P +++   +  ++S    NEPE +      ++              DL+ +                               V AVA F Y  ++ QE+SF++ D+L L +R +  WW G      EH     + GLIP  + T+ +  E
Sbjct:   13 LQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVELEYSRGLEKLAERFSSRGGRLGSSREHQSFRKEPSLLSPLHCWAVLLQHTRQQSRESAALSEVLAGPLAQRLSHIAEDVGRLVKKSRDLEQQLQDELLEVVSELQTAKKTYQAYHMESVNAEAKLREAERQEEKRAGRSVPTTTAGATEAGPLRKSSLKKGGRLVE------KRQAKFMEHKLKCTKARNEYLLSLASVNAAVSNYYLHDVLDLMDCCDTGFHLALGQVLRSYTAAESRTQASQVQGLGSLEEAVEALDPPGDKAKVLEVHATVFCPPLRFDYHPHDGDEVAEICVEMELRDEILPRAQNIQSRLDRQTIETEEV-NKTLKATLQ------ALLEVVASDDGDVLDSFQTSPSTESLKSTSSDP-----GSRQAGRRRGQQQ---ETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSWTQYTQRKFQKSRQPRPSSQYNQRLFGGDMEKFIQSSGQPVPLVVESCIRFINLNGLQHEGIFRVSGAQLRVSEIRDAFERGEDPL--VEGCTAHDLDSVAGVLKLYFRSLEPPLFPPDLFGELLAS-SELEATAER-VEHVSRLLWRLPAPVLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCFGPTLLPVPAGQDP--VALQGRVNQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNEPELEAEMPAQED--------------DLEGV-------------------------------VEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRG------EHNG---MRGLIPHKYITLPAGTE 807          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. UniProt/SwissProt
Match: sp|Q91Z67|SRGP2_MOUSE (SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Srgap2 PE=1 SV=2)

HSP 1 Score: 288.115 bits (736), Expect = 1.861e-79
Identity = 230/904 (25.44%), Postives = 420/904 (46.46%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKEV----------------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIV-QCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNL--AASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSS 2711
            I+  ++TQ+++   Q T+Q+KCLD +  +   +L ++ D ++++A IE +YS NL KL+     +  S   K   +KK+    SP+   N L+   +  ++ H  LSDIY   +  R + + ED  RL +KS ++ Q+   ++++ LN+L    K Y      S +   + ++   +   Q+ K V                +R ++K        +I+K++E+   R  ++   +  +  ARN+Y++ L +   S+  +Y ++L  I+ QC + G+H +L R      S E  L        +     +E +DA +D +  +E             F P  GD  +Q+   Q+PVQ++L    Q+  + + ++  + EE K  +++  +++ D +   D+DV D  +   S  + + T S     ++       + N +E     E  YF  M+ YL       N+ +KL++   +L+  ++ +SQ T    +   ST                    +++ + +PLVV+SCIR IS +G+++ G+FRV GSQ++V   K+ FE G DP   L G  ND ++   A +LKLYFR L+ P+F +++F++++         + ++   ++ ++L L  P    ++YL +F++HL++FS EN MD  NLAI FGP LM +PE         Q  VN + + +I  H+ +F   R+ EGP+Y R                                        S  D  +    E+T    S    +++    ++  +    + A+A FDY  ++ +E+SFKK   L+L +R ++ WW G       H     ++GLIP  +  +          + V    S KS    +S P  ++++ +  +S
Sbjct:   13 IIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRS--TKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEK---RQAKYTENKLKAIKARNEYLLALEATNASVFKYYIHDLSDIIDQCCDLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCA-QQPVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMESVKSTVS--ETFMSKPSIAKRRANQQE----TEQFYFTKMKEYLEGR----NLITKLQAKHDLLQK-TLGESQRTDCSLARRSSTV-----------------RKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDP---LAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLIACVTMDNLQERAV--HIRKVLLVLPKPTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQ--VSCQAHVNELIKTIIIQHENIFPNPRELEGPIYSR--------------------------------------GGSMEDYCDSTHGETTSAEDST---QDVTAEHHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGR------HNG---IDGLIPHQYIVVQDTE------DGVVERSSPKSEIEVMSEPPEEKVTARTGAS 819          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. TrEMBL
Match: A0A224Z8Q0 (SLIT-ROBO Rho GTPase activating protein OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.066e-92
Identity = 235/870 (27.01%), Postives = 422/870 (48.51%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQK---IYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFS---------SIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVN-NYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQR--EPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAF--FTIHSQNELSTNVESVENDDS 2642
            ++  FE Q++D  QQ  +Q+KCLD ++    +++S + D ++RRA +E EYS  L K++  I+ R+ SE  +R  W   +S       L+ + +  ++ H  L+++YG  +  +L  + ED  R+ RK   I  + H E+++ L++L    K   +Y  S  +A    +       +L+  V R     ++L+++ R + + +E  +R  + +  +     ARN+Y++ L +   +   +++ +L  +V C ++GFH  L+R      + EE L            + I  +D+  D + FLE +     +     F P + D   Q +  + P++ +LE    + +  + S+  + +E    +++   SL D +   + D     R +   S   +    P     ++L   L+ + +E     E+ Y E   +Y         + +K + +   L+   +D    TL   S            +  A   G + +LF G L +Y + T + VPL+++SC+R+I+LYG+ + GVFRV GSQ+++  ++  FE G DPL  +   S D+N  A +LKLY REL  P+F    F++++  +  +SK   E  V  L+ ++     P +  L+YL +F++HL+EFS EN MD  NLAI FGP L+PIPE+K     Q+Q +VN + + LI + + +F  D  G VY++    +   DT    V   EP  + A       +  +DE    S+PD+        + + RS+V E                  A A +D+ A+S++E+SF++ D LVL  +V+  WW GH   +         +GL+P  +   +I   +   T +++V + D+
Sbjct:   14 LLGLFEQQVKDIRQQLGEQLKCLDVRLETQLALVSEMQDYFRRRAEVELEYSRTLDKMARAIAVRHRSERPRRELWPL-FSSHGCWEQLVNNARRQSRDHAALAEVYGATLVAQLAHLLEDVQRIYRKCRGIGAQQHEELLKVLHELQTAMKTYHVYCTSEEQARAKMELVAGQKRRLEAVVAR-----EKLERSKRFRVVAKELAKRAAKHRETRLQCLKARNEYLLALGAANAAAHKYFAEDLSDLVDCMDFGFHMCLSRALRTSCNAEECLQRSLQQGCQALAQRIADLDSRADKQRFLEGHHNAFMVPRRFAFQPHRADAEPQQVSLEHPMEEELEQRLGQLNKRLTSLCTENDEVWKTLETAESSLLDMMAAREIDC----RPLFEESPAARPPPQP-----ETLALKLRADKQE----TEDFYLEKFRTYSLGCSVAARLEAKAELLRAALQREGLDTKTQTLRPHSRPAARKKRIGRQAALAARHGGQPRLFEGSLEEYLEATNQEVPLIIRSCVRVINLYGLHHQGVFRVSGSQVEINHFRDCFERGEDPLADVSDAS-DINSVAGVLKLYLRELREPLFPIFYFDQLMEISQLESK---EEFVAKLRDVVQSFPRPVFVVLRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLIPIPEDKDQ--VQYQNLVNELVKGLIVHQEQIFPNDG-GLVYEKYISAEAPEDTDELPV---EPVVEPAGA-----SQSSDEDALSSEPDI--------SLFGRSDVLE------------------ATAQYDFVARSERELSFRRGDRLVLYSQVSADWWRGHFDGK---------DGLVPDKYILLSIRDDDAPPTAMDAVASLDA 814          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. TrEMBL
Match: A0A131YYC2 (SLIT-ROBO Rho GTPase activating protein OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.780e-92
Identity = 234/870 (26.90%), Postives = 422/870 (48.51%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQK---IYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFS---------SIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVN-NYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQR--EPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAF--FTIHSQNELSTNVESVENDDS 2642
            ++  FE Q++D  QQ  +Q+KCLD ++    +++S + D ++RRA +E EYS  L K++  I+ R+ SE  +R  W   +S       L+ + +  ++ H  L+++YG  +  +L  + ED  R+ RK   I  + H E+++ L++L    K   +Y  S  +A    +       +L+  V R     ++L+++ R + + +E  +R  + +  +     ARN+Y++ L +   +   +++ +L  +V C ++GFH  L+R      + EE L            + I  +D+  D + FLE +     +     F P + D   Q +  + P++ +LE    + +  + S+  + +E    +++   SL D +   + D     R +   S   +    P     ++L   L+ + +E     E+ Y E   +Y         + +K + +   L+   +D    TL   S            +  A   G + +LF G L +Y + T + VPL+++SC+R+I+LYG+ + GVFRV GSQ+++  ++  FE G DPL  +   S D+N  A +LKLY REL  P+F    F++++  +  +SK   E  V  ++ ++     P +  L+YL +F++HL+EFS EN MD  NLAI FGP L+PIPE+K     Q+Q +VN + + LI + + +F  D  G VY++    +   DT    V   EP  + A       +  +DE    S+PD+        + + RS+V E                  A A +D+ A+S++E+SF++ D LVL  +V+  WW GH   +         +GL+P  +   +I   +   T +++V + D+
Sbjct:   14 LLGLFEQQVKDIRQQLGEQLKCLDVRLETQLALVSEMQDYFRRRAEVELEYSRTLDKMARAIAVRHRSERPRRELWPL-FSSHGCWEQLVNNARRQSRDHAALAEVYGATLVAQLAHLLEDVQRIYRKCRGIGAQQHEELLKVLHELQTAMKTYHVYCTSEEQARAKMELVAGQKRRLEAVVAR-----EKLERSKRFRVVAKELAKRAAKHRETRLQCLKARNEYLLALGAANAAAHKYFAEDLSDLVDCMDFGFHMCLSRALRTSCNAEECLQRSLQQGCQALAQRIADLDSRADKQRFLEGHHNAFMVPRRFAFQPHRADAEPQQVSLEHPMEEELEQRLGQLNKRLTSLCTENDEVWKTLETAESSLLDMMAAREIDC----RPVFEESPAARPPPQP-----ETLALKLRADKQE----TEDFYLEKFRTYSLGCSVAARLEAKAELLRAALQREGLDTKTQTLRPHSRPAARKKRIGRQAALAARHGGQPRLFEGSLEEYLEATNQEVPLIIRSCVRVINLYGLHHQGVFRVSGSQVEINHFRDCFERGEDPLADVSDAS-DINSVAGVLKLYLRELREPLFPIFYFDQLMEISQLESK---EEFVAKVRDVVQSFPRPVFVVLRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLIPIPEDKDQ--VQYQNLVNELVKGLIVHQEQIFPNDG-GLVYEKYISAEAPEDTDELPV---EPVVEPAGA-----SQSSDEDALSSEPDI--------SLFGRSDVLE------------------ATAQYDFVARSERELSFRRGDRLVLYSQVSADWWRGHFDGK---------DGLVPDKYILLSIRDDDAPPTAMDAVASLDA 814          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. TrEMBL
Match: A0A3B3B8R8 (Uncharacterized protein OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 5.378e-91
Identity = 247/911 (27.11%), Postives = 443/911 (48.63%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNN---LIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKEL-----DKNPR----IKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS---------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESI--VNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE-LSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVS 2738
            I+  +ETQ+++   Q  +Q +CL+ +      +L ++ +  +R+A ++ EYS  L KL+   S +  +   +  ++KK+ + L+ +N    ++  T+  ++ H  LSDIY   +  RL  + ED +RL +KS DI  + H E+++  N+L    K Y    NE+  A  +   A  Q +K + +  D    L     D+ P+    ++K+ +   +R  ++   +   T ARN Y+++L +    +  +Y +++  ++ C + G+H +L R    + S E +L T      +L    +E +D   D   F++ +           + P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE K  +D+  ++L D +   D+DV D  +  +ST + +  +S   + ++ +     + N +E     E  YF   + YLN     +N+  KL++   +LK  ++ + +   Y  +   +       I+          KLF G++  + +E+ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ F+ G DPL   +   +D+N  A +LKLYFREL+ PIF +E F ++++    S + D  +   + ++ II+ L  P    ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+E+       Q  VN V + +I +H+ +F   R+ EGPVY++      +          P S+      D+   GT                                    N+  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  S +++  +++ S    + D +S  S+R S  +  S  R   +V 
Sbjct:   13 IIAEYETQVKEIRNQLVEQFRCLEQQSESRLQLLQDLQEFLRRKAELQLEYSKGLDKLAERYSAKIRTSR-EHQHFKKDQNLLSTVNCWYLVLDQTRRESRDHATLSDIYNNNVIVRLAHVGEDVLRLFKKSKDIGVQMHEELVKVTNELYTVMKTYHMYHNESLSAENKLKEAEKQEEKHIGKGNDISVGLLRHAHDERPQRRSSVRKMEKLKEKRQAKYSENKLKCTKARNDYLLNLTATNALVAKYYIHDVSDMIDCCDLGYHASLGRTMRTYLSAEYSLETSRHEGLDLLEGAVESLDIRGDKLKFMDTHSQMFCPPARFDYQPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVKKTLDATMQTLQDMLTVEDFDVSDAFQHSQSTESVKSASS--DSYMSKANIAKRRANQQE----TEGFYFTKYKEYLNG----SNLIVKLQAKHDLLKQ-TLGEGERAEYGTTRPPTLPPKPQRIRKPRPQSIFNHKLFNGNMEAFIQESGQPIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNAFQRGEDPLLDDQA-DHDINSVAGVLKLYFRELENPIFPKERFIDLIS----STKLDSGVERAHHIQQIIVTLPRPVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDEQDP--VACQAHVNEVIKTIIIHHEAIFPAQRELEGPVYEKCMAGVEEY------CESPHSEPGAL--DDIDNGTGP----------------------------------NTSDEEMEPIEAIAKFDYVGRSQRELSFKKGASLLLYMRASEDWWEG------RHNG---VDGLIPHQYIVVQDLDDAFSDSIQRSDSEMSTGPRHDDRTSSRSERQSACEHRSENRFGPAVG 852          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. TrEMBL
Match: A0A553P9V5 (Uncharacterized protein (Fragment) OS=Tigriopus californicus OX=6832 GN=TCAL_08310 PE=4 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.238e-90
Identity = 247/888 (27.82%), Postives = 445/888 (50.11%), Query Frame = 3
Query:  126 QFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKI---YTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLR---EEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTR-LSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKN-----ISIDDSQNTLYCFSSIHSTTAVIIGIKS-------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYN-DSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQR----EPKNSNDT--HNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVEND-DSVKSNYMDLSSPESQRLSNKDRS 2708
            Q ++Q KCLD ++    SI++ I D+++RRA IE  YS  L KL+ +IS RN  +  KR  W   +S   +   ++  T+ T+K H+  ++IYG  + QR   + ED  R++R+  +I  + H E+++ L++L    K    Y   F ++E   +  +R   +L++ V         ++K  + +K R   +E+ +R  +F   +  +T ARN+Y++ + +   SI  ++ ++L  ++ C ++GFH +LTR +SM+ ++ E+   ++   I  L  + +  +D+  D + F+E+N  T                      F  P + +L    QR  A IK+ S ++ ++   +DS  K+L+D +   DYD   +         +E   SL    ++DS+    + +    + + E+ Y      Y+ N   +  + +K  ++   L +      S  +++  L      +      IG  S       KLFGG L +Y +ET + +P+VV+SC+R+I+LYG+ + G+FRV GSQ+++ +++  FE G DPL  +   S D+N  A ++KLY REL  P+F  + F+  +     +SK      V  ++ ++     P +  ++Y+ +F++HL+EFS EN MD  NLAI FGP L+PIPEE+     Q+Q +VN + +  I  H  +F     GP+Y++    EP+   D+   + N   N+ +S+ A+  D  F+  ++                      R  +G+ ++ +   S++     + A+A++D++A+S +E++F K D + L K+V+  WW G V  +          GLIP  +  +  + E  +N  SV +  DS +S  +D    E Q  S +DRS
Sbjct:   26 QLSEQFKCLDGRLETQQSIVTEIQDVFRRRAEIETNYSKELDKLAKSISHRNKEQRQKRDAWAI-HSSTQIWETVLVHTKRTSKDHKATAEIYGNHVVQRCHQINEDLQRIHRRCREIGYEIHEEVLKVLHELHTTMKTHHAYQSEFRQSENKLQMVERQKVKLEQSV--------PIEKRAKHRKFRILEKEFQKRRLKFDEARLAATKARNEYLLAMDAANASIQKYFVDDLSDLIDCLDFGFHQSLTRAVSMHTSAMEQQKKSLQKQIDKL-NKVMSGMDSRLDKQKFIESNNTT----------------------FMIPKKFELAQARQRL-ALIKAESEEIWKS---MDSAEKTLSDIVGCKDYDTTRFF-------VEEDRASL---RISDSIVMKQKAD----RLETEDFYINKFREYVLNSNRIARLQAKYDNLRHTLGDKSNSHASAANAEGMLTLTRRPNVARRRRIGNNSRQGGGQPKLFGGSLEEYLEETNQELPIVVRSCVRVINLYGLHHHGIFRVSGSQLEINNFRDAFERGDDPLADMTDAS-DINSVAGVMKLYLRELREPVFPIQYFDHFMELAQLESK---HEFVLKVQGVVQNWPRPVFIVMRYIFAFLNHLSEFSDENMMDPYNLAICFGPTLVPIPEERDQ--VQYQNLVNELIKNFIIFHDDIFPSSVPGPIYEKYITNEPEEMGDSPPDSQNQDENDDDSEMAEEADSVFSAESE----------------------RDGLGDISMELFGRSEA-----LEALAVYDFKARSSREVTFHKGDTIQLFKQVSNDWWRGRVKGQ---------EGLIPDKYIILKIRGEEDSN--SVRDRLDSARS--VD----EGQLASLRDRS 813          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. TrEMBL
Match: A0A437DDN9 (Uncharacterized protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00047310 PE=4 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 3.369e-90
Identity = 245/911 (26.89%), Postives = 443/911 (48.63%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNN---LIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKEL-----DKNPR----IKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS---------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESI--VNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNE-LSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVS 2738
            I+  +ETQ+++   Q  +Q +CL+ +      +L ++ +  +R+A ++ EYS  L KL+   S +  +   +  ++KK+ + L+ +N    ++  T+  ++ H  LSDIY   +  RL  + ED +RL +KS DI  + H E+++  N+L    K Y    NE+  A  +   A  Q +K + +  D    L     D+ P+    ++K+ +   +R  ++   +   T ARN Y+++L +    +  +Y +++  ++ C + G+H +L R    + S E +L T      +L    +E +D   D   F++ +           + P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE K  +D+  ++L D +   D+DV D  +  +ST + +  +S   + ++ +     + N +E     E  YF   + YLN     +N+  KL++   +LK  ++ + +   Y  +   +       I+          KLF G++  + +E+ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ F+ G DPL   +   +D+N  A +LKLYFREL+ PIF +E F ++++    S + D  +   + ++ II+ L  P    ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+E+       Q  VN V + +I +H+ +F   R+ EGPVY++      +          P S+      D+   GT                                    N+  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  S +++  +++ S    + D ++  ++R S  +  S  R   +V 
Sbjct:   13 IIAEYETQVKEIRNQLVEQFRCLEQQSESRLQLLQDLQEFLRRKAELQLEYSKGLDKLAERYSAKIRTSR-EHQHFKKDQNLLSTVNCWYLVLDQTRRESRDHATLSDIYNNNVIVRLAHVGEDVLRLFKKSKDIGVQMHEELVKVTNELYTVMKTYHMYHNESLSAENKLKEAEKQEEKHIGKGNDISAGLLRHAHDERPQRRSSVRKMEKLKEKRQAKYSENKLKCTKARNDYLLNLAATNSLVAKYYIHDVSDMIDCCDLGYHASLGRTMRTYLSAEYSLETSRHEGLDLLEGAVESLDIRGDKLKFMDTHSQMFCPPARFDYQPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVKKTLDATMQTLQDMLTVEDFDVSDAFQHSQSTESVKSASS--DSYMSKANIAKRRANQQE----TEGFYFTKYKEYLNG----SNLIVKLQAKHDLLKQ-TLGEGERAEYGTTRPPTLPPKPQRIRKPRPQSIFNHKLFNGNMEAFIQESGQPIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNAFQRGEDPLLDDQA-DHDINSVAGVLKLYFRELENPIFPKERFIDLIS----STKLDSGVERAHHIQQIIVTLPRPVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDEQDP--VACQAHVNEVIKTIIIHHEAIFPSQRELEGPVYEKCMAGVEEY------CESPHSEPGAL--DDIDNGTGP----------------------------------NTSDEEMEPIEAIAKFDYVGRSQRELSFKKGASLLLYMRASEDWWEG------RHNG---VDGLIPHQYIVVQDLDDAFSDSIQRSDSEISGGPRHDDRTATRNERQSPCEHRSENRFGPAVG 852          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Cavefish
Match: srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:ZFIN;Acc:ZDB-GENE-060524-4])

HSP 1 Score: 281.952 bits (720), Expect = 2.429e-78
Identity = 229/895 (25.59%), Postives = 421/895 (47.04%), Query Frame = 3
Query:   72 ITLFIMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNN---LIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSPESQ 2684
            + L I   F ++IR+   Q  +Q KCL+ +      +L ++ + ++R+A I+ EYS +L KL+   S +  S   +   +KK+   L+ +N    ++  T+  ++ H  L+DIY   +  RL  + +D IRL +KS +I  + H E+++  N+L    K Y    T+S +   + +    +   Q  K       ++R +++ +      +I+K++E+   R  ++   +   T ARN Y+++L +    +  +Y +++  ++ C + G+H +L R    + S E  L T      +L    ++ +D+ +D    ++             ++P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST   E   S+        L  + ++  ++   + E  YF   + YLN     +N+  KL++   +LK  ++ + +      +     T +                ++++ + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   + + +D+N  A +LKLYFR L+ P+F +E F + ++        +   V+ ++ +I+ L       ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +++ +F   R+ EGPVY++      +        + P S+             DE    ++P                            SD E    + A+A FDY  ++ +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  ++  S + D    S  +         DL SP  Q
Sbjct:    1 MCLHICVCFVSEIRN---QLVEQFKCLEQQSESRIQLLQDLQEFFRRKAEIQLEYSRSLEKLAERFSSKIRSSR-EHQQFKKDQHLLSSVNCWYLVLNQTRRESRDHAALNDIYINNVIVRLAQISDDVIRLFKKSKEIGIQMHEELVKVTNELYTVMKTYHMYHTESISAESKLKDAEKQEEKQFSKSGDLNVNLLRHEERAQRRSSVRKIEKMKEK---RQAKYSENKLKCTKARNDYLLNLAATNAVVAKYYIHDVSDMIDCCDLGYHASLARTFRTYLSAEYNLETSRHEGLDLIENAVDNLDSRSDKHKIMDMYNQVFCPPMRFEYLPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRST---ESIKSVASEGYMSKLNIAKRRANQQ---ETEVFYFTKFKEYLNG----SNLIVKLQAKHDLLKQ-TLGEGERAECGTTRGRRNTRI---------------RNQDSGQPIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLIDDQ-SDHDINSVAGVLKLYFRGLENPLFPKERFLDFISTIKLESSAER--VHHIQQMIVTLPRTIIIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VACQAHVNEVIKTIIIHNEAIFPSHRELEGPVYEKCMTGGEEY------CDSPHSEPGT---------IDEADNGTEP--------------------------HTSDDEV-EQIEAIAKFDYVGRTPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQDLDDAFSDSLSQKADSEASSGPLLDDKASSKNDLHSPCEQ 805          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Cavefish
Match: srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:ZFIN;Acc:ZDB-GENE-060524-4])

HSP 1 Score: 278.485 bits (711), Expect = 2.525e-77
Identity = 229/895 (25.59%), Postives = 412/895 (46.03%), Query Frame = 3
Query:   72 ITLFIMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNN---LIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSPESQ 2684
            + L I   F ++IR+   Q  +Q KCL+ +      +L ++ + ++R+A I+ EYS +L KL+   S +  S   +   +KK+   L+ +N    ++  T+  ++ H  L+DIY   +  RL  + +D IRL +KS +I  + H E+++  N+L    K Y    T+S +   + +    +   Q  K       ++R +++ +      +I+K++E+   R  ++   +   T ARN Y+++L +    +  +Y +++  ++ C + G+H +L R    + S E  L T      +L    ++ +D+ +D    ++             ++P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST   E   S+        L  + ++  ++   + E  YF   + YLN     +N+  KL++                                        DL+K +    + +PLVV+SCIR I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   + + +D+N  A +LKLYFR L+ P+F +E F + ++        +   V+ ++ +I+ L       ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +++ +F   R+ EGPVY++      +        + P S+             DE    ++P                            SD E    + A+A FDY  ++ +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +   ++  ++  S + D    S  +         DL SP  Q
Sbjct:    1 MCLHICVCFVSEIRN---QLVEQFKCLEQQSESRIQLLQDLQEFFRRKAEIQLEYSRSLEKLAERFSSKIRSSR-EHQQFKKDQHLLSSVNCWYLVLNQTRRESRDHAALNDIYINNVIVRLAQISDDVIRLFKKSKEIGIQMHEELVKVTNELYTVMKTYHMYHTESISAESKLKDAEKQEEKQFSKSGDLNVNLLRHEERAQRRSSVRKIEKMKEK---RQAKYSENKLKCTKARNDYLLNLAATNAVVAKYYIHDVSDMIDCCDLGYHASLARTFRTYLSAEYNLETSRHEGLDLIENAVDNLDSRSDKHKIMDMYNQVFCPPMRFEYLPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRST---ESIKSVASEGYMSKLNIAKRRANQQ---ETEVFYFTKFKEYLNG----SNLIVKLQAKH--------------------------------------DLLKQTLGEGQPIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLIDDQ-SDHDINSVAGVLKLYFRGLENPLFPKERFLDFISTIKLESSAER--VHHIQQMIVTLPRTIIIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VACQAHVNEVIKTIIIHNEAIFPSHRELEGPVYEKCMTGGEEY------CDSPHSEPGT---------IDEADNGTEP--------------------------HTSDDEV-EQIEAIAKFDYVGRTPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQDLDDAFSDSLSQKADSEASSGPLLDDKASSKNDLHSPCEQ 783          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Cavefish
Match: srgap1a (SLIT-ROBO Rho GTPase activating protein 1 [Source:NCBI gene;Acc:103045357])

HSP 1 Score: 273.863 bits (699), Expect = 1.800e-75
Identity = 195/718 (27.16%), Postives = 362/718 (50.42%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE-----VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYC-----------FSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQR 2162
            I+  +E+Q+++   Q  +Q KCL+ +  +   +L ++ D +++++ IE EYS NL KL+     +  S    +  +KK+    SP+     L+   +  +K H  LSDIY   +  R + + ED  RL +KS +I  +   ++++ LN+L    K Y    T+S +   + ++   +   Q+ +       +R ++K +      +I+K++E+   R  ++   +  S  ARN+Y++ L +   S+  +Y ++L  ++ C + G+H +L R    + S E  L T      ++    ++ +D  +D + F+E             F    GD V QI   Q PVQ +L   FQ+  + + ++  + EE K   ++   ++ D +   DYDV +      ST + + T S     ++       + N +E     E  YF     +L      +N+ +KL++   +LK  ++ +     Y            +S+       +  +K  LF G+L  + K++ + +P VV+S IR I+LYG+++ G+FRV GSQ++V   K+ FE G DPL      ++D+N  A +LKLYFR L+ P+F +E FN++++        + ++  +++ I+L +       ++YL +F++HL+++S EN MD  NLAI FGP LMP P+ +       Q  VN V + +I +H+T+F   ++ +GPVY++
Sbjct:   14 IIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKSEIEMEYSRNLEKLAERFMAKTRSTKDHQ-QYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRLLKKSKEIAFQLQEDLMKVLNELYTVMKTYHMYHTESISAESKLKEFEKQEERQIGRSGEPVFSMRMEEKHQRRSSVKKIEKMKEK---RQAKYSENKLKSIKARNEYLLTLEATNSSVFKYYIHDLPDLIDCCDLGYHFSLNRALRTYLSAEYNLETSRHEGLDIIENAVDSLDPRSDRQRFMEMYPTAFCPPVKFDFQSHMGDEVCQITA-QPPVQAELVLRFQQLQSRLTTLKIENEEIKKTSEATLTTIQDMVTIEDYDVSECFHHSRSTESVKSTVS--ETYLSKPSIAKRRANQQE----TEQFYFMKFREFLEG----SNLIAKLQAKHDLLKR-ALGEGHRAEYMTTRPPNLPPKPYSTRRPRPRSVFSVK--LFNGNLEAFIKDSGQAIPRVVESSIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGNDPLTD-DENNHDINSVAGVLKLYFRGLENPLFPKERFNDLISCVRIDNLYERAL--YIRKILLSVPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPTPDIQDQ--VSCQAHVNEVIKTIIIHHETIFPDAKELDGPVYEK 708          

HSP 2 Score: 52.373 bits (124), Expect = 3.365e-6
Identity = 34/113 (30.09%), Postives = 54/113 (47.79%), Query Frame = 3
Query: 2406 AVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNY--------MDLSSPESQRLSNKDRSSGKR 2720
            A+A FDY  +S +E+SFKK   L+L +R +E WW G       H     ++GL+P  +  +   ++  ++  S + D    S +         DL SP + RL +   SS  R
Sbjct:  749 AIAKFDYVGRSTRELSFKKGASLLLYQRASEDWWEG------RHNG---LDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGHGGDEKCSSRDLGSP-TDRLPDAYISSRHR 851          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Cavefish
Match: srgap2 (SLIT-ROBO Rho GTPase activating protein 2 [Source:NCBI gene;Acc:556198])

HSP 1 Score: 264.233 bits (674), Expect = 3.741e-74
Identity = 213/862 (24.71%), Postives = 385/862 (44.66%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKEV----------------IRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNL--AASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTI 2588
            I+  +ETQ+++   Q  +Q+KCLD +  +   +L ++ D ++++A IE +YS NL KL+     +  S   K   +KK     SP+   N L+   +  ++ H  LSD+Y   +  R   + ED  RL +KS ++  +   ++++ LN+L    K Y    T S N   + ++   +   Q+ +                  IR +DK        +I+K++E+   R  ++   +  +  ARN+Y++ L +    +  +Y ++L  ++ C + G+H +L R    + S E  + T             E ++A  D +  +E             F    GD +  +   Q P+Q++L    Q+  + + +++ + EE K  +++  +++ D +   D+DV D      S S +   +++  + ++       + N +E     E  YF  ++ +L     +T + +K   +E  L      +SQ T  C                            E+ +++PL+V+SCIR IS +G+ + G+FRV GSQ++V   K+ FE G DP   L G  ND ++   A +LKLYFR L+  +F +E+F+++++    S    +     +  ++L L       ++YL +F++HL+++S +N MD  NLAI FGP LM +PE         Q  VN + + +I +H+++F   R+ EGP+Y+                  PE       D               PD                V E    I  + D   P  + A+A FDY  ++++E+SFKK   L+L  R ++ WW G       H       GL+P  +  +
Sbjct:   13 IIAEYETQVKEIRAQLVEQLKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLTKTRS--TKDHQFKKEQNILSPVNCWNLLLTQVKRESRDHATLSDLYLNNIIPRFAQISEDSGRLFKKSKEVGLQLQEDLMKVLNELYTVMKTYHMYNTDSINAESKLKEAEKQEEKQMGRSARQEDRQTPRSPDSLTSIRLEDKPVRRSSVKKIEKMKEK---RQAKYTENRLKAIKARNEYLLALEATNCCVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEFNVETSKHGGLETIENAAENLEANADKQRLMETYNNIFCPPMRFDFQSHMGDQMGYMCA-QVPLQSELLQRCQQLQSRLSTLTIENEEVKKTMEATLQTIQDMVTIEDFDVTDCFH--HSNSMESVKSTMSESFMSKPSLAKRRANQQE----TEQFYFTKLKEFLEGRNLITKLQAKQDLIEKTL-----GESQKTDCCL---------------------------ESSQVIPLMVESCIRFISRHGLHHEGIFRVSGSQVEVNDIKNAFERGEDP---LAGDQNDHDMDSIAGVLKLYFRGLEHALFPKEVFHDLMSCV--SMENLQERATHIHKVLLTLPTNTLVVMRYLFAFLNHLSQYSEDNMMDPYNLAICFGPTLMSVPEGHDQ--VSCQAHVNELIKTIIIHHESIFPGPRELEGPIYEH--------------GGAPEEYSPPLVD------------APAPD---------------TVSE----IHNSDDESDP--IEAIARFDYSGRTNRELSFKKGASLLLYHRASDDWWEG------RHNG---AEGLVPHQYIVV 767          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Cavefish
Match: srgap1a (SLIT-ROBO Rho GTPase activating protein 1 [Source:NCBI gene;Acc:103045357])

HSP 1 Score: 268.47 bits (685), Expect = 5.068e-74
Identity = 225/869 (25.89%), Postives = 408/869 (46.95%), Query Frame = 3
Query:  180 ILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKN---YSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE-----VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF--TRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNY--------MDLSSPESQRLSNKDRSSGKR 2720
            +L ++ D +++++ IE EYS NL KL+     +  S       +KK+    SP+     L+   +  +K H  LSDIY   +  R + + ED  RL +KS +I  +   ++++ LN+L    K Y    T+S +   + ++   +   Q+ +       +R ++K +      +I+K++E+   R  ++   +  S  ARN+Y++ L +   S+  +Y ++L  ++ C + G+H +L R    + S E  L T      ++    ++ +D  +D + F+E             F    GD V QI   Q PVQ +L   FQ+  + + ++  + EE K   ++   ++ D +   DYDV +      ST + + T S     ++       + N +E     E  YF     +L      +N+ +KL++   +LK    + +  T+  ++ ++S +A++                K++ + +P VV+S IR I+LYG+++ G+FRV GSQ++V   K+ FE G DPL      ++D+N  A +LKLYFR L+ P+F +E FN++++        + ++  +++ I+L +       ++YL +F++HL+++S EN MD  NLAI FGP LMP P+ +       Q  VN V + +I +H+T+F   ++ +GPVY++     +           P S+               VL++                V  + G E      + D   P   +A   FDY  +S +E+SFKK   L+L +R +E WW G       H     ++GL+P  +  +   ++  ++  S + D    S +         DL SP + RL +   SS  R
Sbjct:   16 LLQDLQDFFRKKSEIEMEYSRNLEKLAERFMAKTRSTK-DHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRLLKKSKEIAFQLQEDLMKVLNELYTVMKTYHMYHTESISAESKLKEFEKQEERQIGRSGEPVFSMRMEEKHQRRSSVKKIEKMKEK---RQAKYSENKLKSIKARNEYLLTLEATNSSVFKYYIHDLPDLIDCCDLGYHFSLNRALRTYLSAEYNLETSRHEGLDIIENAVDSLDPRSDRQRFMEMYPTAFCPPVKFDFQSHMGDEVCQITA-QPPVQAELVLRFQQLQSRLTTLKIENEEIKKTSEATLTTIQDMVTIEDYDVSECFHHSRSTESVKSTVS--ETYLSKPSIAKRRANQQE----TEQFYFMKFREFLEG----SNLIAKLQAKHDLLKRALGEGNHLTIQIYT-LYSLSALL----------------KDSGQAIPRVVESSIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGNDPLTD-DENNHDINSVAGVLKLYFRGLENPLFPKERFNDLISCVRIDNLYERAL--YIRKILLSVPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPTPDIQDQ--VSCQAHVNEVIKTIIIHHETIFPDAKELDGPVYEKCMAGGD-------YCESPYSEHG-------------VLEE----------------VDHDGGAET---HTSEDEGEPIEAIAK--FDYVGRSTRELSFKKGASLLLYQRASEDWWEG------RHNG---LDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGHGGDEKCSSRDLGSP-TDRLPDAYISSRHR 796          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002614.1 (pep scaffold:Pmarinus_7.0:GL476653:52136:136508:1 gene:ENSPMAG00000002353.1 transcript:ENSPMAT00000002614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.817 bits (621), Expect = 7.432e-67
Identity = 186/697 (26.69%), Postives = 332/697 (47.63%), Query Frame = 3
Query:  666 IKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS----KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIV------NNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYM---------DLSSPESQRLS 2693
            ++K+ +   +R  ++   +  S  ARN+Y++ L ++  S+  +Y +++  ++ C + G+H +L R    + S E  L +      ++    ++ +D  +D   FLE             F P  GD V+Q+   Q+PVQ +L + +Q+  + + ++  + EE K  +++  ++L D +   D+D+ D  +   ST + +  TS     ++       + N +E     E+ YF   + ++N    +T + +K   +   L   +  D  +    F      +A     +S    KLF G+L  + ++T +++PLVV+SC+R I+LYG+++ G+FRV GSQ++V   K+ FE G DPL   +  S+D+N  A +LKLYFR L+  +F +E F+++V      N Y  +          ++ IIL L       ++YLL+F++HL++FS EN MD  NLAI FGP LMP+PE         Q  VN V + +I +H+ +F   ++ EGP+Y++                               C T E      P  +     E+ +    + G E      + D   P  + AVA +DY  +S +E+SFKK   L+L  R ++ WW G       H      +GL+P  +  +   ++  ++  S + D    S  +         D++SP ++RL+
Sbjct:   53 VRKMEKMKEKRQAKYSENKLKSIKARNEYLLTLEAINCSVHKYYIHDISDLIDCCDLGYHASLNRALRTYLSAEYNLESSRHEGLDVIENAVDGLDPRSDKLRFLETYHTFFCPPTKFEFQPHMGDEVSQV-SAQQPVQLELVSRYQQLQSRLATLRIENEEVKKTMEATLQTLQDMVTIEDFDMSDSFQHSRSTESVKSATS--ETYMSRPNVAKRRANQQE----TESFYFMKFKEFMNGSNLITKLQAKHDLINKALGESAKGDFNSFRPPFFPTKPPSAKRHRPRSQFTDKLFNGNLETFIQDTGQVIPLVVESCVRFINLYGLQHQGIFRVSGSQVEVNDIKNAFERGEDPLVEDE-DSHDINSVAGVLKLYFRGLENSLFPKEKFHDLVMCVKMENLYERAAH--------IRKIILTLPRSTIVVMRYLLAFLNHLSQFSDENMMDPYNLAICFGPTLMPVPE--GHDQVSVQAHVNEVIKTIIIHHEGIFPGFKELEGPIYEK-------------------------------CMTGEEEYCDSPHSEPGTMEEADQ----DTGTEP---HTSEDECEP--IEAVAKYDYTGRSARELSFKKGASLLLYHRASDDWWEG------RHNG---ADGLVPHQYIVVQDADDTFSDSLSQKADSEASSGVLLDDKVSSKNDVASP-TERLA 681          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001421.1 (pep scaffold:Pmarinus_7.0:GL477135:481099:531889:1 gene:ENSPMAG00000001263.1 transcript:ENSPMAT00000001421.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 214.542 bits (545), Expect = 4.636e-57
Identity = 165/686 (24.05%), Postives = 327/686 (47.67%), Query Frame = 3
Query:  126 QFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNN---LIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRL-NRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE---------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKE--TKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTV 2126
            Q  +Q+KCL+ +  +   +L +  D ++RR+ +E EY+  L +L+     R  +     P  ++  S L+ +N    L+  T+  ++ H  +SDIY   +  R   + ED  RL  +KS +I Q+   E+++    +    K Y    T+S + A + R+   +   Q+ K          + R  ++        +I+KL+E+  ++  + K+K   +T ARN+Y++HL +   ++  +Y  +L  ++      +H+ L R    + S E  L     +        +E +D  +D    +E+            F P  GD  +QI   Q P+Q +L    Q+    + ++  + EE K   ++  ++L D +   DYDV +  +  +ST +       P          + ++  ++   + E+ YF   + Y++     +++ +KL++   +L+   +D+S+    C ++                GG     S++  + + +P+VV+SCIR I+LYG+++ G+FRVPGSQ++V   K+ FE G DPL+  + +S D+N  A +LKLYFR +  P+F +E F+++++       ++ +    ++ +I  L PP    ++YL +F++H++  S +     +++ + F P +M  P          +     + Q L+ +H+TV
Sbjct:    5 QLVEQLKCLEQQTELRQQLLQDFQDFFRRRSELELEYARGLDRLAERFLGRARAAR-DHPQLRREQSVLSPVNCWYLLLNQTRRESRDHSAISDIYLNNLVLRFSQIGEDSTRLLKKKSREIGQQVQEEVLKVFTDVSTAMKTYHMYNTESMSAAGKLREAERQEEKQMGKTGDTGAVGLGLARPDERGARRSSVRKIEKLKEKRQQKYAECKLK---ATKARNEYLLHLEATNSALHKYYVYDLSDLIDICAAKYHSPLGRALKTYVSAELGLEASRHTGLGAVERAVEALDPRSDKARLMESYDTLFCRPLRFDFQPHMGDETSQICA-QSPLQFELLQRCQQLKCRLATLQIEKEEIKKTQEATLQALMDMLTAEDYDVSEAFKHGQSTESLRAPA--PSEAYMCKFNVAKRRANQQ---ETESFYFSKFKEYMDR----SSLINKLQTKHDLLQK-GLDESEKA-ECMNT----------------GGKRSFRSRQQDSGQAIPIVVESCIRFINLYGLQHQGIFRVPGSQVEVNEIKASFESGDDPLED-EQSSRDINSVAGVLKLYFRGMKTPLFPKEKFHDLISCVQIESSSERAAG--IRKVIQTLPPPVVVVMRYLFAFLNHVSHLSVQTFKSYLHILMFFHPAMMTHPAHH-PHFSCLEIQHRAIGQPLLISHETV 654          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 92.4337 bits (228), Expect = 3.581e-21
Identity = 59/201 (29.35%), Postives = 99/201 (49.25%), Query Frame = 3
Query: 1536 KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIV--NNYNDSKRTDESIVNFLKVIILKLRPPA-YCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF 2129
            K++  DL    K      P+VV  CI+ I + G+R+ G++RV G    ++  K  F+   +       + +D+N+    LKLYFR+L  P+   + + + +  +   D+    E I   L+++     PPA Y +L+YL++ +  +  +S EN M   NLAI+FGP LM  PE+              V + LI N + +F
Sbjct:   28 KVYSCDLTTLVKAHNRKRPMVVDMCIKEIEMRGLRSEGLYRVSGFSEHIEDVKMAFDRDGEKADISANSYDDINIITGALKLYFRDLPIPLITYDAYPKFIEASKLMDADERLEGIHEALRLL-----PPAHYESLRYLMAHLKRVTLYSKENLMSAENLAIVFGPTLMRPPEQDVLATLNDIRYQRLVIETLINNEEILF 223          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Sea Lamprey
Match: arhgap21b (Rho GTPase activating protein 21b [Source:ZFIN;Acc:ZDB-GENE-030131-4944])

HSP 1 Score: 91.2781 bits (225), Expect = 1.106e-18
Identity = 58/190 (30.53%), Postives = 103/190 (54.21%), Query Frame = 3
Query: 1581 EMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESI--VNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSE 2144
            + +PL+V+ C  L+   G+ + G++RVPG+   V S + +   G   + +      D+N+ +S+LK +FR+L  P+F +E + E +    D+ R +  +  +  LK +I +L    + TLK+L   +  +AE S +N M+  NLAI+FGP L+   E+ +T +         + + LI ++   FT DSE
Sbjct: 1020 KFLPLIVEVCCGLVEERGLESTGIYRVPGNNAAVCSLQEELNRGVTEIDTNDDKWRDLNVISSLLKSFFRKLPEPLFTDEKYYEFI----DANRMENGVERLKALKKLIHELPEHHFHTLKFLSMHLKTIAENSPKNKMEPRNLAIVFGPTLVRTSED-NTDMVTHMPDQYKIVETLIQHYDWFFTDDSE 1204          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Sea Lamprey
Match: si:ch211-247j9.1 (si:ch211-247j9.1 [Source:ZFIN;Acc:ZDB-GENE-091204-212])

HSP 1 Score: 85.1149 bits (209), Expect = 3.762e-17
Identity = 55/184 (29.89%), Postives = 91/184 (49.46%), Query Frame = 3
Query: 1596 VVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGP-CLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSE 2144
            +V  C+  I   G+   G+FR+PG    V+  +  F+ G  P+    G + DV+  AS++KLY REL  P+    +++E ++  +   +     V  L  ++  L    +  LKY+ SF+  +   +S N M + NLA +FGP  L P  E+ +T +    T V ++   LI  H  +F R  E
Sbjct:    1 LVTQCVNFIRCQGLAEEGLFRLPGQTNLVRELQEAFDCGERPI--FDGDT-DVHTVASLVKLYLRELPEPVVPFSLYSEFLSCASLLAKNQSEGVKELTQLVNSLPLANFNLLKYICSFLYEVQSHASINKMSIQNLATVFGPNILRPKVEDPATIMEAGATTVQHLMSTLIEQHAVLFARGPE 181          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 68.9366 bits (167), Expect = 3.494e-12
Identity = 51/189 (26.98%), Postives = 89/189 (47.09%), Query Frame = 3
Query: 1536 KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDP------LKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPI-PEEKSTQLFQFQTI 2081
            K FG  L    +  ++MVP +V+ CI +I  +G+   G++R   + +DV   K   E+  DP      L S   + +D+ L  S+LK +F  L   +  + + +EI         T     NF+  +I  L    Y TL+ L+  +  +    ++N M++  L II+GP + P  P++ +   FQ   +
Sbjct:  468 KTFGVPLESLIEFEQDMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKE--EIDKDPANISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPTTRK--NFMHGLIYNLPDAQYWTLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTIAPANPDDANDVNFQIMAM 652          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Yeast
Match: BEM2 (Rho GTPase activating protein (RhoGAP); involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence; potential GAP for Rho4p [Source:SGD;Acc:S000000957])

HSP 1 Score: 67.3958 bits (163), Expect = 1.584e-11
Identity = 51/192 (26.56%), Postives = 89/192 (46.35%), Query Frame = 3
Query: 1536 KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQF--ELGTDPLKSLKGTSN-DVNLAASILKLYFRELDPPIFNEEMFNEIVN---NYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLM---PIPEEKSTQLFQFQTIV 2084
            K+FG  L    +    ++P +V   +  I L G+  +G++R+PGS   + + K+ F  E  TD   +L+     +VN  A   K+Y REL   +F+  M N+  +    Y      +E     +  ++ KL    Y TLK ++  ++ + +    N MD  NLAI+F    +    +     ++L   QTI+
Sbjct: 1963 KIFGVPLEDVCERENTLIPTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNAIAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRMMNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFINQEDLANSMGSRLGAVQTIL 2154          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 58.5362 bits (140), Expect = 5.514e-9
Identity = 50/193 (25.91%), Postives = 86/193 (44.56%), Query Frame = 3
Query: 1533 SKLFGGDLIKYSKETKEMVPLVVQSCIRLISL--YGMRNIGVFRVPGSQIDVQSYKSQF-----ELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYN-----------------DSKRTDE--SIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLM 2033
            S L+G  L+         +P+++  CI  I      MR+ G++R  GSQ+ ++  + QF     +  T+    L  T  D+N+   +LK Y R+L  PIF  +++  ++                     ++K +D   S  + LK I+  L    Y  L+ L   I  +  +S  N M + NLA++F P L+
Sbjct:  786 SNLYGSSLVARCNYENNEIPMILSVCIDFIESDEENMRSEGIYRKSGSQLVIEEIEKQFSAWKVQQNTETPNIL--TEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGLI 976          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Yeast
Match: BEM3 (Rho GTPase activating protein (RhoGAP); involved in control of the cytoskeleton organization; targets the essential Rho-GTPase Cdc42p, which controls establishment and maintenance of cell polarity, including bud-site assembly [Source:SGD;Acc:S000006036])

HSP 1 Score: 49.2914 bits (116), Expect = 4.598e-6
Identity = 51/173 (29.48%), Postives = 85/173 (49.13%), Query Frame = 3
Query: 1587 VPLVVQSCIRLISLYGMRNI---GVFRVPGSQIDVQSYKSQF--ELGTDPLK---SLKGTSND--------VNLAASILKLYFRELDPPIFNEEM---FNEIVN-NYNDSKRTDESIVNFLKVIILKLRPPAYCTLKY-LLSFISHLAEFSSENCMDVVNLAIIFGPCL-MPI 2039
            +P VV  C+    LY  R I   G+FR+ GS   +++ + +F  E   D  +   S++   ++        VN  + +LKLY R+L   +F +E    F  +V+ N+N+  +     + F ++I   L P A  +L Y L   +  + E S  N M++ NL I+F P L +PI
Sbjct:  926 LPSVVYRCLEY--LYKNRGIQEEGIFRLSGSSTVIKTLQERFDKEYDVDLCRYNESIEAKDDEASPSLYIGVNTVSGLLKLYLRKLPHLLFGDEQFLSFKRVVDENHNNPVQIS---LGFKELIESGLVPHANLSLMYALFELLVRINENSKFNKMNLRNLCIVFSPTLNIPI 1093          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Nematostella
Match: EDO46865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI7])

HSP 1 Score: 184.882 bits (468), Expect = 2.094e-48
Identity = 167/688 (24.27%), Postives = 314/688 (45.64%), Query Frame = 3
Query:  108 IRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCE--EALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKR--TDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTR---DSEGP 2150
            I +  Q  ++Q+K  DA+       L+++ +  K+ + +E EYS NL +LS     R   +  K     K  + + V + L+  T+  AK  ++ SD     +  R + M +D  R+++K  +       E+ +++++L  K + Y   F E++ A         +L    I     ++   KN ++ K +E++ +R  + K K   S  A+N+Y++ L S    + Y+Y+N L  +V   ++ FH++  R    +   E   +  T+H    N+  E    I+ + D + F E N     +     ++P   +   QI     P Q D+ +        +K I  + +E    +++ + +L +   Q D ++              K  +   ++VT  +     KN+ +     E  Y   +  Y+        M+S LK +    +N ++  +   L     + +  +  + IK            + T   +P VV+SC+R I  +G+ + G+FR+ GS  D+   K  FE G DPL  L     D+N  A +L++YFREL+ P+F    + + +    ++ R  T+E ++  +  +I +L       +KYL  F+  ++E S +N MD  NLA++FGP L+ IP E+   +  +Q+ VN + + +I N+  VF +   D++GP
Sbjct:    6 ITEIRQLLSEQLKGYDARTEGKVLFLADLQEYCKKMSEVETEYSKNLDRLSDRFLDR--LQKFKAQRCFKRSTTMDVWHKLLVETKNRAKQRQSFSDNLANNIANRFMSMSDDYQRISKKCREAGLILQDELCKTVHELQRKLRKYHTMFGESKTAES-------KLKSTEIALSKSEESGRKNEKMTKQKEKHQQRYSENKRK---SVKAKNEYVLALKSTNSFLQYYYTNCLGDLVDGFDFNFHDSFERAIAAYTQAETNASAATIHSM--NVVQEAKLTINPDLDKKYFFEDNLSIFAIPFKFQYLPYSEEESCQIT----PQQIDIVDFHCELFERLKQIKAETDEIHKTVEATADALKEMYKQWDLEM-------------NKMANGETDMVTGVMNCQSIKNSSD---DLEMYYVTKLREYI--------MTSSLK-IRIAAENQTLVKTLGEL-----VDTANSFQLSIK------------QITGREIPEVVESCVRFIKRFGLDHPGIFRLSGSSTDINDMKQLFECGRDPLAGLNHW-KDINAVAGLLRVYFRELEDPLFPSSHYQQFI----EASRFPTNEDVIRQVTCVINELPDSVNRVMKYLFKFLKQVSEHSEQNKMDAHNLAVVFGPTLLRIPSEQD--MITYQSHVNGMMEVIIKNYDQVFPQNDFDTDGP 626          

HSP 2 Score: 52.7582 bits (125), Expect = 8.391e-7
Identity = 23/62 (37.10%), Postives = 36/62 (58.06%), Query Frame = 3
Query: 2406 AVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIH 2591
            A AL+DY A+S +E+SFKK DI+ + KR N+ WW G +            +G +P+++  I 
Sbjct:  657 AAALYDYSARSSKELSFKKGDIIRVFKRFNDDWWDGTLGDS---------DGFVPASYIKIQ 709          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Nematostella
Match: EDO31406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY14])

HSP 1 Score: 82.0333 bits (201), Expect = 6.367e-16
Identity = 50/192 (26.04%), Postives = 101/192 (52.60%), Query Frame = 3
Query: 1590 PLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLM-PIPEEKSTQLFQFQT-------IVNYVAQCLITNHQTVFTRDS 2141
            PLV++ C  +I  +G+ + G++R+ GS   +Q  +  F+    P    +    DV+  +S+LK+YFREL  P+    ++++ V+    +   +  +   +  ++ +L PP Y TL+YLL  ++ +A  + +  M   NLAI++ P L+ P  + + T ++++ +       +   + + LI N   +F RD+
Sbjct:  293 PLVLEKCAAVIEEHGIVD-GIYRLSGSSSIIQKLRFLFDGDEPPELDDEYYLRDVHCISSLLKMYFRELPNPLLTYSLYDKFVSAIQITDEKERKVA--IHHVVQQLPPPHYRTLEYLLQHLAKVASHAGQTAMHAKNLAIVWAPNLLKPRSQVRITIIYEYGSTALLEINVQAIIVEYLIRNAAELFDRDA 481          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Nematostella
Match: EDO47441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM51])

HSP 1 Score: 80.8777 bits (198), Expect = 2.577e-15
Identity = 60/233 (25.75%), Postives = 113/233 (48.50%), Query Frame = 3
Query: 1539 LFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNY--NDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGP-CLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQREP---KNSNDTHNHNVKSNEPE 2219
            +FG D+   +      +PL+V  C+R I   G+  +G++R+ G+  DV+  K  F+  +     L  +  D++  A + K+Y R+L  P+F +E++++ V  Y   D++   E+++   +     L  P   T  YL   +  +AE S  + M + NL+ +FGP  L P P + S+ +   Q  ++ ++Q  I  +      D+E      +P   +  +  H  +V + EPE
Sbjct:  609 VFGVDIETVTSRESCDIPLIVIGCVREIEKRGLEEVGIYRLSGASSDVKRLKEGFDENSQSALVLV-SEADIHAVAGLFKMYLRDLPEPLFTDELYDKFVKAYAMADAEEKRETMLELFQ----SLPTPNRLTACYLFQHLRKVAEKSEVHKMGLNNLSTVFGPNVLRPSP-KTSSPMDLAQGTLDVMSQVGIFMY--FLKLDAEELHLPNDPELMRRLDPCHGSDVTTGEPE 833          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Nematostella
Match: EDO42176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S254])

HSP 1 Score: 78.5666 bits (192), Expect = 5.410e-15
Identity = 56/207 (27.05%), Postives = 97/207 (46.86%), Query Frame = 3
Query: 1536 KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELG--------TDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESI-VNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVF 2129
            + FG DL    K      P VV  CI  +   G+ + G++RV G   D+++ K+ F+ G        +D       T +D+N    + KLYFR+L  P+   E +++ +     +K  D+ + +  L   + +L    Y T+K+L+  +  +++  S+N M   NL+I+FGP LM  PE  S              + LI++   +F
Sbjct:  251 RAFGVDLTTLVKLHNTKRPFVVDICINEVEKRGLDSEGLYRVSGFADDIEALKNSFDKGNTHTTVNYSDGESVNLSTYDDINTITGVCKLYFRQLPLPLITFETYSKFIAA---AKTQDKHLRIEELSKALGELPQAHYETMKFLMGHLHRVSQRRSKNMMTEENLSIVFGPTLMRAPEGDSLDSLVDMKFQRLAVELLISHQHVLF 454          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Nematostella
Match: EDO49792 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFW5])

HSP 1 Score: 69.707 bits (169), Expect = 3.348e-13
Identity = 38/102 (37.25%), Postives = 57/102 (55.88%), Query Frame = 3
Query: 1533 SKLFGGDL---IKY-SKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMF 1826
              +FGGDL   +K+ +++    VP+VV  CI  I  YG+   G+FR+PG+   + + K+QF  G  P  S      D++  AS+LKLY REL  P+   + F
Sbjct:  110 GGMFGGDLCETVKFEARKGGGFVPIVVDVCIEYIKKYGLEEEGLFRLPGNAKHISTLKAQFNRGESPELS---DEKDIHTVASLLKLYLRELSEPVIPYDFF 208          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Medaka
Match: srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:NCBI gene;Acc:101168198])

HSP 1 Score: 309.686 bits (792), Expect = 1.277e-87
Identity = 245/931 (26.32%), Postives = 441/931 (47.37%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNN---LIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKEL-KFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS--------------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDL----DFSPDDN 2774
            I+  +ETQ+++   Q  +Q KCL+ +      +L ++ + ++R+A +E EYS +L KL+   S +  S   +   +KK+   L+ +N    L+  T+  ++ H  LSDIY   +  RL  + ED IRL +KS DI  + H E+++  N+L    K Y    T+S +   + +    +   Q  K       ++R +D++       +I+K++E+   R  ++   +   T ARN Y+++L +    +  +Y +++  ++ C + G+H +L R    + S E  L T      ++    ++ +D+ +D    ++             ++P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST +        +++ ++S  + L    +   + + E  YF   + YLN     +N+  KL++   +LK    +  +      +   +T    +  K               KLF G++  + +++ + +P VV+SC+R I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +   +D+N  A +LKLYFR L+ P+F +E F + ++        + +  + ++ II  L       ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +H+ +F   R+ +GPVY++      +        + P S+   TFD+                              ++ G E      ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +             + DD+   N        SQ+ ++ + SSG    E  SS+NDL    + SPD N
Sbjct:   11 IIAEYETQVKEIRNQLVEQFKCLEQQSESRIQLLQDLQEFFRRKAEVELEYSRSLEKLAERFSSKIRSSR-EHQQFKKDQHLLSSVNCWYLLLNQTRRESRDHATLSDIYTNNVIVRLAQIGEDVIRLFKKSKDIGIQMHEELVKVTNELYTVMKTYHMYHTESISAESKLKDAEKQEEKQFSKSGDLNVNLLRHEDRQPRRSTARKIEKMKEK---RQAKYSENKMKCTKARNDYLLNLAATNAVVAKYYIHDVSDMIDCCDLGYHASLARTFRTYLSAEYNLETSRHEGLDIIENAVDNLDSRSDKHKIMDMYNQVFCPPMRFEYLPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESI-------KSVASESYMSKLNIAKRRANQQETEMFYFSKFKEYLNG----SNLIIKLQAKHDLLKQTLGEGER------AECGTTRPPTLPPKPQKMRKPRPCSMNYHKLFNGNMETFIEDSGQPIPPVVESCVRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLIDDR-NEHDINSVAGVLKLYFRGLENPLFPKERFLDFISTIKLESGAERA--HHIQQIITALPRTVIIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VTCQAHVNEVIKTIIIHHEVIFPNLRELDGPVYEKCMAGGEEY------CDSPHSEPG-TFDE------------------------------ADNGTEP-----HTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQ------------DLDDAFSDNL-------SQK-ADSEASSGPLLEERSSSKNDLASPCEQSPDYN 843          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Medaka
Match: srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:NCBI gene;Acc:101168198])

HSP 1 Score: 303.908 bits (777), Expect = 1.150e-85
Identity = 242/917 (26.39%), Postives = 438/917 (47.76%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNN---LIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKEL-KFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDL----DFSPDDN 2774
            I+  +ETQ+++   Q  +Q KCL+ +      +L ++ + ++R+A +E EYS +L KL+   S +  S   +   +KK+   L+ +N    L+  T+  ++ H  LSDIY   +  RL  + ED IRL +KS DI  + H E+++  N+L    K Y    T+S +   + +    +   Q  K       ++R +D++       +I+K++E+   R  ++   +   T ARN Y+++L +    +  +Y +++  ++ C + G+H +L R    + S E  L T      ++    ++ +D+ +D    ++             ++P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST +        +++ ++S  + L    +   + + E  YF   + YLN     +N+  KL++   +LK  ++ + +    C      TT      ++++         +++ + +P VV+SC+R I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +   +D+N  A +LKLYFR L+ P+F +E F + ++        + +  + ++ II  L       ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +H+ +F   R+ +GPVY++      +        + P S+   TFD+                              ++ G E      ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +             + DD+   N        SQ+ ++ + SSG    E  SS+NDL    + SPD N
Sbjct:   11 IIAEYETQVKEIRNQLVEQFKCLEQQSESRIQLLQDLQEFFRRKAEVELEYSRSLEKLAERFSSKIRSSR-EHQQFKKDQHLLSSVNCWYLLLNQTRRESRDHATLSDIYTNNVIVRLAQIGEDVIRLFKKSKDIGIQMHEELVKVTNELYTVMKTYHMYHTESISAESKLKDAEKQEEKQFSKSGDLNVNLLRHEDRQPRRSTARKIEKMKEK---RQAKYSENKMKCTKARNDYLLNLAATNAVVAKYYIHDVSDMIDCCDLGYHASLARTFRTYLSAEYNLETSRHEGLDIIENAVDNLDSRSDKHKIMDMYNQVFCPPMRFEYLPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESI-------KSVASESYMSKLNIAKRRANQQETEMFYFSKFKEYLNG----SNLIIKLQAKHDLLKQ-TLGEGERA-EC-----GTTRGRRNARTRI---------QDSGQPIPPVVESCVRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLIDDR-NEHDINSVAGVLKLYFRGLENPLFPKERFLDFISTIKLESGAERA--HHIQQIITALPRTVIIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VTCQAHVNEVIKTIIIHHEVIFPNLRELDGPVYEKCMAGGEEY------CDSPHSEPG-TFDE------------------------------ADNGTEP-----HTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQ------------DLDDAFSDNL-------SQK-ADSEASSGPLLEERSSSKNDLASPCEQSPDYN 819          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Medaka
Match: srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:NCBI gene;Acc:101168198])

HSP 1 Score: 298.516 bits (763), Expect = 6.798e-84
Identity = 238/904 (26.33%), Postives = 427/904 (47.23%), Query Frame = 3
Query:  126 QFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNN---LIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIY----TKSFNXXXXXXXXXXXXMDQLDKE------VIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKEL-KFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSK-LFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDL----DFSPDDN 2774
            Q  +Q KCL+ +      +L ++ + ++R+A +E EYS +L KL+   S +  S   +   +KK+   L+ +N    L+  T+  ++ H  LSDIY   +  RL  + ED IRL +KS DI  + H E+++  N+L    K Y    T+S +   + +    +   Q  K       ++R +D++       +I+K++E+   R  ++   +   T ARN Y+++L +    +  +Y +++  ++ C + G+H +L R    + S E  L T      ++    ++ +D+ +D    ++             ++P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST +        +++ ++S  + L    +   + + E  YF   + YLN     +N+  KL++   +LK               ++     + I +  + LF    +  + ++ + +P VV+SC+R I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +   +D+N  A +LKLYFR L+ P+F +E F + ++        + +  + ++ II  L       ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +H+ +F   R+ +GPVY++      +        + P S+   TFD+                              ++ G E      ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +             + DD+   N        SQ+ ++ + SSG    E  SS+NDL    + SPD N
Sbjct:   23 QLVEQFKCLEQQSESRIQLLQDLQEFFRRKAEVELEYSRSLEKLAERFSSKIRSSR-EHQQFKKDQHLLSSVNCWYLLLNQTRRESRDHATLSDIYTNNVIVRLAQIGEDVIRLFKKSKDIGIQMHEELVKVTNELYTVMKTYHMYHTESISAESKLKDAEKQEEKQFSKSGDLNVNLLRHEDRQPRRSTARKIEKMKEK---RQAKYSENKMKCTKARNDYLLNLAATNAVVAKYYIHDVSDMIDCCDLGYHASLARTFRTYLSAEYNLETSRHEGLDIIENAVDNLDSRSDKHKIMDMYNQVFCPPMRFEYLPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESI-------KSVASESYMSKLNIAKRRANQQETEMFYFSKFKEYLNG----SNLIIKLQAKHDLLKQ--------------TLGEGKELFISVSCRGLFLRAYLTVTADSGQPIPPVVESCVRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLIDDR-NEHDINSVAGVLKLYFRGLENPLFPKERFLDFISTIKLESGAERA--HHIQQIITALPRTVIIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VTCQAHVNEVIKTIIIHHEVIFPNLRELDGPVYEKCMAGGEEY------CDSPHSEPG-TFDE------------------------------ADNGTEP-----HTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQ------------DLDDAFSDNL-------SQK-ADSEASSGPLLEERSSSKNDLASPCEQSPDYN 820          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Medaka
Match: srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:NCBI gene;Acc:101168198])

HSP 1 Score: 296.204 bits (757), Expect = 3.702e-83
Identity = 237/907 (26.13%), Postives = 432/907 (47.63%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNN---LIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKEL-KFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDL----DFSPDDN 2774
            I+  +ETQ+++   Q  +Q KCL+ +      +L ++ + ++R+A +E EYS +L KL+   S +  S   +   +KK+   L+ +N    L+  T+  ++ H  LSDIY   +  RL  + ED IRL +K       +H E I + ++L   +K   K F+++             L+  ++R +D++       +I+K++E+   R  ++   +   T ARN Y+++L +    +  +Y +++  ++ C + G+H +L R    + S E  L T      ++    ++ +D+ +D    ++             ++P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST +        +++ ++S  + L    +   + + E  YF   + YLN     +N+  KL++   +LK  ++ + +    C      TT      ++++         +++ + +P VV+SC+R I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +   +D+N  A +LKLYFR L+ P+F +E F + ++        + +  + ++ II  L       ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +H+ +F   R+ +GPVY++      +        + P S+   TFD+                              ++ G E      ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +             + DD+   N        SQ+ ++ + SSG    E  SS+NDL    + SPD N
Sbjct:   11 IIAEYETQVKEIRNQLVEQFKCLEQQSESRIQLLQDLQEFFRRKAEVELEYSRSLEKLAERFSSKIRSSR-EHQQFKKDQHLLSSVNCWYLLLNQTRRESRDHATLSDIYTNNVIVRLAQIGEDVIRLFKKVMKTYHMYHTESISAESKLKDAEKQEEKQFSKS-----------GDLNVNLLRHEDRQPRRSTARKIEKMKEK---RQAKYSENKMKCTKARNDYLLNLAATNAVVAKYYIHDVSDMIDCCDLGYHASLARTFRTYLSAEYNLETSRHEGLDIIENAVDNLDSRSDKHKIMDMYNQVFCPPMRFEYLPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESI-------KSVASESYMSKLNIAKRRANQQETEMFYFSKFKEYLNG----SNLIIKLQAKHDLLKQ-TLGEGERA-EC-----GTTRGRRNARTRI---------QDSGQPIPPVVESCVRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLIDDR-NEHDINSVAGVLKLYFRGLENPLFPKERFLDFISTIKLESGAERA--HHIQQIITALPRTVIIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VTCQAHVNEVIKTIIIHHEVIFPNLRELDGPVYEKCMAGGEEY------CDSPHSEPG-TFDE------------------------------ADNGTEP-----HTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQ------------DLDDAFSDNL-------SQK-ADSEASSGPLLEERSSSKNDLASPCEQSPDYN 798          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Medaka
Match: srgap3 (SLIT-ROBO Rho GTPase activating protein 3 [Source:NCBI gene;Acc:101168198])

HSP 1 Score: 278.87 bits (712), Expect = 2.831e-77
Identity = 240/928 (25.86%), Postives = 419/928 (45.15%), Query Frame = 3
Query:   84 IMKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNN---LIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKI-------KQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKEL-KFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKS--------------KLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFT--RDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDL----DFSPDDN 2774
            I+  +ETQ+++   Q  +Q KCL+ +      +L ++ + ++R+A +E EYS +L KL+   S +  S   +   +KK+   L+ +N    L+  T+  ++ H  LSDIY   +  RL  + ED IRL +KS DI  + H E+++  N+L    K Y                       E I  + K K+ +K        E+   ++G   +       +Q   + AR      +  +KE              +C + G+H +L R    + S E  L T      ++    ++ +D+ +D    ++             ++P  GD V Q+   Q+PVQ +L   + +  + + ++  + EE +  +D+  ++L D +   D+DV D  +   ST +        +++ ++S  + L    +   + + E  YF   + YLN     +N+  KL++   +LK    +  +      +   +T    +  K               KLF G++  + +++ + +P VV+SC+R I+LYG++  G+FRVPGSQ++V   K+ FE G DPL   +   +D+N  A +LKLYFR L+ P+F +E F + ++        + +  + ++ II  L       ++YL +F++HL+++S EN MD  NLAI FGP LMPIP+ +       Q  VN V + +I +H+ +F   R+ +GPVY++      +        + P S+   TFD+                              ++ G E      ++  E    + A+A FDY  +S +E+SFKK   L+L  R +E WW G       H     V+GLIP  +  +             + DD+   N        SQ+ ++ + SSG    E  SS+NDL    + SPD N
Sbjct:   11 IIAEYETQVKEIRNQLVEQFKCLEQQSESRIQLLQDLQEFFRRKAEVELEYSRSLEKLAERFSSKIRSSR-EHQQFKKDQHLLSSVNCWYLLLNQTRRESRDHATLSDIYTNNVIVRLAQIGEDVIRLFKKSKDIGIQMHEELVKVTNELYTVMKTY------------------HMYHTESISAESKLKDAEKQ------EEKQFSKSGDLNVNLLRHEDRQPRRSTARK-----IEKMKE--------------KCCDLGYHASLARTFRTYLSAEYNLETSRHEGLDIIENAVDNLDSRSDKHKIMDMYNQVFCPPMRFEYLPHMGDEVCQV-SAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESI-------KSVASESYMSKLNIAKRRANQQETEMFYFSKFKEYLNG----SNLIIKLQAKHDLLKQTLGEGER------AECGTTRPPTLPPKPQKMRKPRPCSMNYHKLFNGNMETFIEDSGQPIPPVVESCVRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLIDDR-NEHDINSVAGVLKLYFRGLENPLFPKERFLDFISTIKLESGAERA--HHIQQIITALPRTVIIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDGQDP--VTCQAHVNEVIKTIIIHHEVIFPNLRELDGPVYEKCMAGGEEY------CDSPHSEPG-TFDE------------------------------ADNGTEP-----HTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEG------RHNG---VDGLIPHQYIVVQ------------DLDDAFSDNL-------SQK-ADSEASSGPLLEERSSSKNDLASPCEQSPDYN 800          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Planmine SMEST
Match: SMESG000046904.1 (SMESG000046904.1)

HSP 1 Score: 2184.84 bits (5660), Expect = 0.000e+0
Identity = 1102/1109 (99.37%), Postives = 1106/1109 (99.73%), Query Frame = 3
Query:   87 MKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDLDFSPDDNRSLSHSLGNTADLSEFGESKSFXXXXXXXXXXXXXXXXXPETNNNDKESSEKSTEELGNLDNCTNNVVRIRGSRSSITVYPDSVEASETVDEDLQKTMQGLKRIEELNVIKHRNTVHIDKSLLASKFLSPLTSNQKMTLAEVSDQLMAFQQNKLNCSDFKMKKPGNVNALTSSFEMSQPTKPITVKPNEYPNNSLYRIRGVIPEENSAVVASY 3413
            MKHFETQIRDFNQQFTDQIKCLDAKVSVDN+ILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNEAEEARKRADRAMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTS KEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKN SIDDSQNTL CFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRN+GVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEK+TQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDLDFSPDDNRSLSHSLGNTADLSEFGESKSFESLENIIDDDEDNLLINPETNNNDKESSEKSTEELGNLDNCTNNVVRIRGSRSSITVYPD+VEASETVDEDLQKTMQGLKRIEELNVIKHRNTVHIDKSLLASKFLSPLTSNQKMTLAEVSDQLMAFQQNKLNCSDFKMKKPGNVNALTSSFEMSQPTKPITVKPNEYPNNSLYRIRGVIPEENSAVVASY
Sbjct:    1 MKHFETQIRDFNQQFTDQIKCLDAKVSVDNNILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNEAEEARKRADRAMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSVKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNTSIDDSQNTLCCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNMGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKNTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDLDFSPDDNRSLSHSLGNTADLSEFGESKSFESLENIIDDDEDNLLINPETNNNDKESSEKSTEELGNLDNCTNNVVRIRGSRSSITVYPDTVEASETVDEDLQKTMQGLKRIEELNVIKHRNTVHIDKSLLASKFLSPLTSNQKMTLAEVSDQLMAFQQNKLNCSDFKMKKPGNVNALTSSFEMSQPTKPITVKPNEYPNNSLYRIRGVIPEENSAVVASY 1109          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Planmine SMEST
Match: SMESG000046904.1 (SMESG000046904.1)

HSP 1 Score: 2165.19 bits (5609), Expect = 0.000e+0
Identity = 1095/1109 (98.74%), Postives = 1099/1109 (99.10%), Query Frame = 3
Query:   87 MKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDLDFSPDDNRSLSHSLGNTADLSEFGESKSFXXXXXXXXXXXXXXXXXPETNNNDKESSEKSTEELGNLDNCTNNVVRIRGSRSSITVYPDSVEASETVDEDLQKTMQGLKRIEELNVIKHRNTVHIDKSLLASKFLSPLTSNQKMTLAEVSDQLMAFQQNKLNCSDFKMKKPGNVNALTSSFEMSQPTKPITVKPNEYPNNSLYRIRGVIPEENSAVVASY 3413
            MKHFETQIRDFNQQFTDQIKCLDAKVSVDN+ILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNEAEEARKRADRAMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTS KEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKN SIDDSQNTL CFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRN+GVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEK+TQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDE       DLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDLDFSPDDNRSLSHSLGNTADLSEFGESKSFESLENIIDDDEDNLLINPETNNNDKESSEKSTEELGNLDNCTNNVVRIRGSRSSITVYPD+VEASETVDEDLQKTMQGLKRIEELNVIKHRNTVHIDKSLLASKFLSPLTSNQKMTLAEVSDQLMAFQQNKLNCSDFKMKKPGNVNALTSSFEMSQPTKPITVKPNEYPNNSLYRIRGVIPEENSAVVASY
Sbjct:    1 MKHFETQIRDFNQQFTDQIKCLDAKVSVDNNILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNEAEEARKRADRAMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSVKEKTTSLPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNTSIDDSQNTLCCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNMGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKNTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDE-------DLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVENDDSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDLDFSPDDNRSLSHSLGNTADLSEFGESKSFESLENIIDDDEDNLLINPETNNNDKESSEKSTEELGNLDNCTNNVVRIRGSRSSITVYPDTVEASETVDEDLQKTMQGLKRIEELNVIKHRNTVHIDKSLLASKFLSPLTSNQKMTLAEVSDQLMAFQQNKLNCSDFKMKKPGNVNALTSSFEMSQPTKPITVKPNEYPNNSLYRIRGVIPEENSAVVASY 1102          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Planmine SMEST
Match: SMESG000035669.1 (SMESG000035669.1)

HSP 1 Score: 471.855 bits (1213), Expect = 7.664e-146
Identity = 300/903 (33.22%), Postives = 493/903 (54.60%), Query Frame = 3
Query:  114 DFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRG---IESTSAKEKTTSLP----RNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSV-------ETVLKNISIDDSQNTLY---CFSSIHSTTAVIIGI-----KSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEG---PVYQR-EPKNS--------------ND-----------------------THNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLR----IRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQAN--PVVNGLIPSAFFTIHSQNELSTN 2615
            +   QF DQ+K LD +++VDNSIL+++ D YKRRA++EQEY+++LLKL  N  QR   E  KR NW K YS L ++N LI S+  T++ H  +++I+ +QMTQR+LD+Q+D +RL+++S ++LQ+    +  +  +L    K+Y   +  A+EA++  D+A ++L+KE  R   KKK+L+K+ + KK++E+  E+   +  K   ST ARN+YI+ L ++ ++I+ F+S E+  +++C  YG+HNNL+R  +NH +CEEAL T H +I +    T+  IDA  DT +FLE+ +   +      F P K D    I   +   ++ L    +   + I     +V+E    I+  +K+LN  INQ+DY+V DY      I +  +KE  + +P     N + + LYT+++  T+  + + E  Y   ++ YL         ++KL+ +        T+  +I ++D+  +L        +   T   +G+     K +LFGG L  Y + TKE +P V+ +CI++I+LYGM + GVFR+PGSQ ++  Y+  FE G D L++ +    DVN  A +LK+YFREL  P+F   +FN ++    +   TD  + N +  ++ +L    Y  L+YL +F++HL E++ +N MD  NLAI FGPCLMP+P + S   F++Q  VN++ Q  I  H+ +F +D +    P+Y R +P  S              ND                        H+    SNE +S  +K + +N               +   +  +S+ +++SN+ +E L     IR+ SDSE  S V    + D+   S +E++F+K  ++ L +R+N HWW G V   +E+  N  P+  GLIP ++  IH   E S N
Sbjct:   13 ELQSQFGDQLKSLDMRMNVDNSILADLNDFYKRRALVEQEYAESLLKLVQNFRQRLTIEQQKRQNWPK-YSSLDLINTLIVSSHRTSQTHYVMANIFSQQMTQRILDVQDDVLRLHKQSRELLQQCQQNVTNACLKLYKDHKLYVNCYQFADEAKRTLDKAREKLEKEEKRYISKKKDLEKSSKFKKIKEDINEKIELYDAKCVGSTQARNEYILQLAAVNKAIEKFFSQEIHDVLECMSYGYHNNLSRAILNHINCEEALVTSHKTIVDTLHTTMSNIDARKDTGVFLESCQLAFSRIPEFKFQPCKDDQYLGI-STEGSFKDTLTETVKDLKSNIDFTIVEVDEIWKTIEEAAKNLNSLINQNDYEVADYFLASKLIRNQKSKESISGIPLSSSSNSIHNFLYTNIRNATRIQRIEQEYFYITCLQKYLIKNHKYHTTAAKLEKILSACGEFSTLAGDIPLEDTDLSLTSSKITRQLTKKTHRRLGVQELQTKPRLFGGSLEDYIERTKESIPKVLTTCIQVINLYGMHHQGVFRIPGSQTEMNEYRDLFEKG-DKLQTKQFGPRDVNSIAGLLKMYFRELVEPVFPNCIFNRLIECSKEDIDTDLCVAN-ISNVVKELSDSVYIVLRYLFAFLNHLTEYTDDNMMDPQNLAICFGPCLMPVPPDLSQLQFEYQPHVNHIVQLFIERHKDIFKKDHKKPLMPLYDRFQPILSRHFSESISEDCLIDNDDASDLSLESSIVEISVDRPITAIKHDGKETSNEDKSHFSKIYFNN--------------SITRCQSTKSSGFLKSNMNDETLTKPYLIRKLSDSEIHSIVYGTTIADFVGSSSRELNFQKGQVVKLYRRLNSHWWEGCVNVAIENDKNIAPLKIGLIPHSYIRIHETTEFSKN 897          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Planmine SMEST
Match: SMESG000028956.1 (SMESG000028956.1)

HSP 1 Score: 389.037 bits (998), Expect = 4.652e-115
Identity = 256/845 (30.30%), Postives = 445/845 (52.66%), Query Frame = 3
Query:  126 QFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILK-------FQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTS----LPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDS-EGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVL---------AVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQ 2597
            Q  +Q+KC+D+K  +D + L+++ + YK+RAV+EQEY++ L KL  +  Q+ N+E+ KR NW K YS  ++LN L+ ST  TA AH+ LSDIY +QMTQRL D+QEDC R ++++ ++ Q     ++ + ++L    + Y  S+  AE+++K  D++ ++ D+E  R  DK K++DK+ +I+KL+E++ ++      +   S  +RN+Y+I + +   S+D ++  E+  ++ C   GFHN + R  +NH SCE+A+ + H + + +  ++++ ID   D   FL+ N+       +  F  +K D +  ++        F   + + +EN        +K    K EE        +K L+  I+  DYDV +       T++K  +      L   I     +   + +T+  +   E  YFE   +++    +   +S+KL+ ++  L       S N         S  +V      K+FGG L +Y   +++ +P ++ + I +I+LYGM N G+FR+ GSQ ++   K  ++   DP  +      DVN+AA +LK+YFREL  P+F+  +F++IV  + +++R  +S +N  + I+  +    Y  L+YL +F+ +++E   +N MD  NLAI FGPCLMPIP E +  LF  Q IVN + +  I NH ++F   S +GP+Y   P+  +   NH ++++         F  N     D        D  +  R++ T++  S  G + L     SDS    N +         A+A+ D+  +++ E+SF+K D LVL + +++HWW G ++  L         GLIP  +  I S 
Sbjct:   42 QLAEQLKCMDSKWEMDYNYLNDLLEFYKKRAVLEQEYAEALNKLVQSSKQKLNTESTKRQNWPK-YSYHSLLNVLLESTSQTAAAHQILSDIYSRQMTQRLQDLQEDCTRAHKQTRELAQLCQTTVLVTTSKLTTSYRDYCNSYQLAEDSKKVMDKSKEKFDRERKRAHDKNKDIDKSQKIRKLKEDFNQKCDFNSRQNIQSLQSRNEYLIQIAAANTSVDKYFGQEIFDLLNCLNLGFHNAIVRAGLNHISCEKAVASTHRTAAQMIEKSVQTIDPHRDQLKFLDKNQSAFNKTSSFAFQTIKDDVITCVMSHPSLVEVFHSTIAHIMEN--------VKESKKKFEEYWKMSSETTKKLHKLIDLRDYDVEELFSKSILTASKNGSRDNLDLLGSRINETQSFLHFRSSTRNNRIDLEKKYFEQFSAFIVENHHFHVLSTKLECLKQALGEGKSITSINPNKPLRESRSIASVENENLIKIFGGTLQEYVTLSQQPIPPLIHNTINIINLYGMHNQGIFRISGSQAEINELKEMYDNCQDPFIN-NSQIPDVNVAAGLLKMYFRELKEPVFSGTLFHQIVETF-ETEREKKSFINKAREIMNSIPTEIYVILRYLFAFLKYVSELKEDNMMDSYNLAICFGPCLMPIPNEFNKVLFHMQAIVNEIVRLFIENHNSIFNNPSIDGPLYV--PQRYSPPINHAMETS--------IFSTNDYAECD--------DANSTLRSQRTKF--SIDGSDTLEGSGASDSSSSHNEMKQMDSPPYTAIAIADFNGQTNSELSFQKNDRLVLEEFISDHWWHGRLMDGLGE-------GLIPLTYVQIVSH 848          
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Planmine SMEST
Match: SMESG000028956.1 (SMESG000028956.1)

HSP 1 Score: 388.267 bits (996), Expect = 6.190e-115
Identity = 256/845 (30.30%), Postives = 445/845 (52.66%), Query Frame = 3
Query:  126 QFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEYSDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHRNLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQKIYTKSFNXXXXXXXXXXXXMDQLDKEVIRCQDKKKELDKNPRIKKLREEYLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEYGFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEANKPTLTLKENLHFIPVKGDNVNQILK-------FQEPVQNDLENMFQRFSAEIKSISNKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTS----LPRNIVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVETVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEMVPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLKGTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNFLKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMPIPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDS-EGPVYQREPKNSNDTHNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVRSNVGEENLRIRRNSDSERPSNVL---------AVALFDYQAKSDQEISFKKKDILVLTKRVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQ 2597
            Q  +Q+KC+D+K  +D + L+++ + YK+RAV+EQEY++ L KL  +  Q+ N+E+ KR NW K YS  ++LN L+ ST  TA AH+ LSDIY +QMTQRL D+QEDC R ++++ ++ Q     ++ + ++L    + Y  S+  AE+++K  D++ ++ D+E  R  DK K++DK+ +I+KL+E++ ++      +   S  +RN+Y+I + +   S+D ++  E+  ++ C   GFHN + R  +NH SCE+A+ + H + + +  ++++ ID   D   FL+ N+       +  F  +K D +  ++        F   + + +EN        +K    K EE        +K L+  I+  DYDV +       T++K  +      L   I     +   + +T+  +   E  YFE   +++    +   +S+KL+ ++  L       S N         S  +V      K+FGG L +Y   +++ +P ++ + I +I+LYGM N G+FR+ GSQ ++   K  ++   DP  +      DVN+AA +LK+YFREL  P+F+  +F++IV  + +++R  +S +N  + I+  +    Y  L+YL +F+ +++E   +N MD  NLAI FGPCLMPIP E +  LF  Q IVN + +  I NH ++F   S +GP+Y   P+  +   NH ++++         F  N     D        D  +  R++ T++  S  G + L     SDS    N +         A+A+ D+  +++ E+SF+K D LVL + +++HWW G ++  L         GLIP  +  I S 
Sbjct:   42 QLAEQLKCMDSKWEMDYNYLNDLLEFYKKRAVLEQEYAEALNKLVQSSKQKLNTESTKRQNWPK-YSYHSLLNVLLESTSQTAAAHQILSDIYSRQMTQRLQDLQEDCTRAHKQTRELAQLCQTTVLVTTSKLTTSYRDYCNSYQLAEDSKKVMDKSKEKFDRERKRAHDKNKDIDKSQKIRKLKEDFNQKCDFNSRQNIQSLQSRNEYLIQIAAANTSVDKYFGQEIFDLLNCLNLGFHNAIVRAGLNHISCEKAVASTHRTAAQMIEKSVQTIDPHRDQLKFLDKNQSAFNKTSSFAFQTIKDDVITCVMSHPSLVEVFHSTIAHIMEN--------VKESKKKFEEYWKMSSETTKKLHKLIDLRDYDVEELFSKSILTASKNGSRDNLDLLGSRINETQSFLHFRSSTRNNRIDLEKKYFEQFSAFIVENHHFHVLSTKLECLKQALGEGKSITSINPNKPLRESRSIASVENENLIKIFGGTLQEYVTLSQQPIPPLIHNTINIINLYGMHNQGIFRISGSQAEINELKEMYDNCQDPFIN-NSQIPDVNVAAGLLKMYFRELKEPVFSGTLFHQIVETF-ETEREKKSFINKAREIMNSIPTEIYVILRYLFAFLKYVSELKEDNMMDSYNLAICFGPCLMPIPNEFNKVLFHMQAIVNEIVRLFIENHNSIFNNPSIDGPLYV--PQRYSPPINHAMETS--------IFSTNDYAECD--------DANSTLRSQRTKF--SIDGSDTLEGSGASDSSSSHNEMKQMDSPPYTAIAIADFNGQTNSELSFQKNDRLVLEEFISDHWWHGRLMDGLGE-------GLIPLTYVQIVSH 848          
The following BLAST results are available for this feature:
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRGAP31.973e-8625.86SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
SRGAP14.473e-8626.26SLIT-ROBO Rho GTPase activating protein 1 [Source:... [more]
SRGAP35.826e-8426.03SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
ARHGAP44.323e-8125.68Rho GTPase activating protein 4 [Source:HGNC Symbo... [more]
SRGAP25.229e-8126.10SLIT-ROBO Rho GTPase activating protein 2 [Source:... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srgp-13.277e-6729.22Slit-Robo GAP homolog [Source:UniProtKB/TrEMBL;Ac... [more]
srgp-12.889e-6629.27Slit-Robo GAP homolog [Source:UniProtKB/TrEMBL;Ac... [more]
srgp-12.868e-6529.42Slit-Robo GAP homolog [Source:UniProtKB/TrEMBL;Ac... [more]
srgp-19.322e-3742.65Slit-Robo GAP homolog [Source:UniProtKB/TrEMBL;Ac... [more]
pac-11.047e-1830.63GTPase-activating protein pac-1 [Source:UniProtKB... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CdGAPr8.236e-1726.83gene:FBgn0032821 transcript:FBtr0300966[more]
CdGAPr8.238e-1726.83gene:FBgn0032821 transcript:FBtr0332179[more]
CdGAPr8.238e-1726.83gene:FBgn0032821 transcript:FBtr0081318[more]
CdGAPr8.589e-1726.83gene:FBgn0032821 transcript:FBtr0300967[more]
RhoGAPp1904.364e-1428.50gene:FBgn0026375 transcript:FBtr0333660[more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srgap1b7.039e-9027.24SLIT-ROBO Rho GTPase activating protein 1b [Source... [more]
srgap1b1.121e-8726.46SLIT-ROBO Rho GTPase activating protein 1b [Source... [more]
srgap32.827e-8525.86SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
srgap33.115e-8225.82SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
srgap24.650e-7925.78SLIT-ROBO Rho GTPase activating protein 2 [Source:... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bves1.124e-8927.11blood vessel epicardial substance [Source:Xenbase;... [more]
bves3.004e-8926.96blood vessel epicardial substance [Source:Xenbase;... [more]
rab39a1.349e-8826.66RAB39A, member RAS oncogene family [Source:Xenbase... [more]
rab39a1.464e-8827.05RAB39A, member RAS oncogene family [Source:Xenbase... [more]
rab39a2.282e-8826.66RAB39A, member RAS oncogene family [Source:Xenbase... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srgap32.769e-8725.94SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
Srgap18.990e-8525.81SLIT-ROBO Rho GTPase activating protein 1 [Source:... [more]
Srgap31.385e-8426.23SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
Srgap27.086e-8225.44SLIT-ROBO Rho GTPase activating protein 2 [Source:... [more]
Arhgap42.173e-8025.91Rho GTPase activating protein 4 [Source:MGI Symbol... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z6B7|SRGP1_HUMAN2.148e-8526.26SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo ... [more]
sp|O43295|SRGP3_HUMAN2.617e-8525.86SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo ... [more]
sp|Q812A2|SRGP3_MOUSE3.717e-8525.83SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus m... [more]
sp|P98171|RHG04_HUMAN2.076e-8025.68Rho GTPase-activating protein 4 OS=Homo sapiens OX... [more]
sp|Q91Z67|SRGP2_MOUSE1.861e-7925.44SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus m... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A224Z8Q01.066e-9227.01SLIT-ROBO Rho GTPase activating protein OS=Rhipice... [more]
A0A131YYC21.780e-9226.90SLIT-ROBO Rho GTPase activating protein OS=Rhipice... [more]
A0A3B3B8R85.378e-9127.11Uncharacterized protein OS=Oryzias melastigma OX=3... [more]
A0A553P9V51.238e-9027.82Uncharacterized protein (Fragment) OS=Tigriopus ca... [more]
A0A437DDN93.369e-9026.89Uncharacterized protein OS=Oryzias javanicus OX=12... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srgap32.429e-7825.59SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
srgap32.525e-7725.59SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
srgap1a1.800e-7527.16SLIT-ROBO Rho GTPase activating protein 1 [Source:... [more]
srgap23.741e-7424.71SLIT-ROBO Rho GTPase activating protein 2 [Source:... [more]
srgap1a5.068e-7425.89SLIT-ROBO Rho GTPase activating protein 1 [Source:... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002614.17.432e-6726.69pep scaffold:Pmarinus_7.0:GL476653:52136:136508:1 ... [more]
ENSPMAT00000001421.14.636e-5724.05pep scaffold:Pmarinus_7.0:GL477135:481099:531889:1... [more]
chn23.581e-2129.35chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
arhgap21b1.106e-1830.53Rho GTPase activating protein 21b [Source:ZFIN;Acc... [more]
si:ch211-247j9.13.762e-1729.89si:ch211-247j9.1 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
RGD13.494e-1226.98GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
BEM21.584e-1126.56Rho GTPase activating protein (RhoGAP); involved i... [more]
RGA15.514e-925.91GTPase-activating protein for polarity-establishme... [more]
BEM34.598e-629.48Rho GTPase activating protein (RhoGAP); involved i... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468652.094e-4824.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314066.367e-1626.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474412.577e-1525.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421765.410e-1527.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497923.348e-1337.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srgap31.277e-8726.32SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
srgap31.150e-8526.39SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
srgap36.798e-8426.33SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
srgap33.702e-8326.13SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
srgap32.831e-7725.86SLIT-ROBO Rho GTPase activating protein 3 [Source:... [more]
back to top
BLAST of SLIT-ROBO Rho GTPase activating protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046904.10.000e+099.37SMESG000046904.1[more]
SMESG000046904.10.000e+098.74SMESG000046904.1[more]
SMESG000035669.17.664e-14633.22SMESG000035669.1[more]
SMESG000028956.14.652e-11530.30SMESG000028956.1[more]
SMESG000028956.16.190e-11530.30SMESG000028956.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004435 ID=SMED30004435|Name=SLIT-ROBO Rho GTPase activating protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3855bp
ATATAACCCTGTATGTCGCTTTTCTGAATTCGAATGAAAGTTTTTTCAAA
AATTATTTTTCTTTTATGTAAATAACATTATTTATAATGAAACATTTTGA
GACACAAATAAGAGATTTCAATCAACAGTTTACAGATCAAATTAAATGCT
TAGATGCTAAAGTTTCTGTTGATAACAGCATTTTGAGTAATATTTTTGAT
TTATATAAAAGACGAGCCGTGATCGAACAGGAATACTCTGATAATTTATT
GAAACTTAGTTCAAATATTTCCCAAAGAAACAATTCAGAAAATCTAAAAC
GGCCAAACTGGAAAAAAAACTATTCACCTCTTACAGTCCTTAATAATCTA
ATAGCCAGTACTCAATATACGGCTAAAGCTCATAGGAATCTATCAGATAT
TTATGGGAAACAAATGACACAGAGGCTTTTGGACATGCAAGAGGACTGTA
TCCGATTGAATAGGAAGTCTACCGACATCTTGCAAAAGCATCATGCAGAA
ATCATCAGATCTCTGAATCAATTGTTACTGAAGCAAAAGATATATACTAA
ATCATTCAATGAAGCTGAAGAAGCTAGAAAAAGAGCCGACAGAGCAATGG
ATCAGTTGGACAAAGAAGTAATTCGTTGCCAAGACAAGAAAAAAGAATTA
GATAAAAATCCAAGAATTAAGAAATTAAGAGAAGAGTATTTAGAACGGAA
TGGCCAATTCAAAATCAAACAGGCCGATAGCACCATTGCAAGGAACAAAT
ATATTATCCACCTGATATCATTAAAGGAAAGCATTGACTATTTTTACTCA
AACGAACTGAAGACTATTGTTCAGTGTGCCGAATACGGTTTTCACAATAA
CCTGACTCGGCTCAGCATGAACCATAACAGCTGTGAAGAAGCCCTAACGA
CTGTCCATGATTCAATAAGCAACCTGTTCACTGAAACCATAGAGAAAATA
GATGCCGAAAATGACACGGAAATCTTTCTGGAAGCTAACAAACCAACTTT
GACCCTGAAAGAAAACCTTCATTTTATTCCAGTTAAAGGCGATAATGTCA
ATCAAATTTTAAAGTTTCAAGAACCGGTTCAAAATGATTTAGAAAATATG
TTCCAAAGATTTAGTGCCGAAATAAAATCCATTTCCAATAAAGTCGAAGA
AAATAAACTGCAGATTGATTCACTGTCAAAATCACTAAATGATTTTATCA
ATCAGTCCGATTATGATGTCGTGGATTATATCCGTGGAATAGAAAGTACT
AGCGCGAAGGAAAAGACGACCAGTTTGCCAAGAAATATTGTTACAGATTC
TTTATATACTTCTCTTCAGAAAAATACAAAAGAACTTAAATTTAAAGCTG
AAAATTCCTACTTTGAAGCCATGGAATCATATCTTAACAACGAGATAAAC
ATGACGAATATGTCAAGTAAATTAAAGAGTGTCGAAACCGTTCTTAAAAA
CATTTCCATTGATGACTCTCAGAATACACTTTATTGTTTTTCAAGTATTC
ATTCGACCACTGCAGTTATTATCGGAATAAAATCAAAACTTTTCGGAGGA
GACTTGATAAAATATAGTAAGGAAACTAAGGAAATGGTGCCTTTAGTAGT
TCAAAGTTGTATTCGTCTCATTAGTTTATACGGCATGCGCAATATTGGCG
TTTTTCGTGTTCCTGGAAGTCAGATAGACGTCCAGAGCTATAAATCACAA
TTTGAACTCGGGACCGACCCTTTAAAAAGTCTAAAAGGAACTTCAAATGA
TGTTAATCTTGCTGCAAGTATTTTGAAACTTTATTTCCGAGAGTTAGATC
CGCCGATATTCAATGAAGAAATGTTTAACGAAATCGTAAATAATTATAAC
GACTCCAAAAGAACAGATGAATCCATTGTCAATTTCTTGAAGGTTATTAT
ATTGAAACTTCGACCTCCAGCTTACTGTACTCTGAAATATCTTTTATCAT
TTATAAGCCACTTAGCAGAATTCTCATCGGAAAATTGTATGGATGTAGTA
AATCTCGCAATAATATTCGGTCCGTGTCTGATGCCTATTCCTGAAGAAAA
GAGCACTCAATTATTCCAATTTCAGACAATTGTCAATTATGTTGCTCAGT
GTCTAATAACCAACCACCAAACAGTGTTCACCAGGGATTCTGAGGGTCCT
GTTTATCAAAGAGAACCAAAAAATTCAAATGACACCCATAATCACAATGT
AAAATCAAACGAACCAGAATCAGATAAAGCAAAAACTTTTGATGACAATT
TCACTTGTGGAACCGACGAAGTATTGAAAAAATCAAAACCAGACTTAAAA
AATCTAAAACGGAATGAAAGTACGAGATATGTCCGTTCAAATGTGGGTGA
AGAAAATTTACGAATTCGACGCAATTCAGATTCTGAAAGACCTTCCAATG
TGCTAGCAGTCGCATTATTTGACTACCAAGCAAAATCAGATCAAGAGATT
TCATTTAAGAAGAAGGATATATTAGTGTTAACGAAAAGGGTCAATGAACA
TTGGTGGACAGGACATGTTATTAAAGAACTGGAACATCAAGCAAATCCTG
TTGTTAATGGCCTTATTCCAAGCGCATTCTTCACAATACATTCTCAAAAC
GAATTAAGTACGAATGTTGAATCGGTTGAGAATGATGACTCGGTGAAATC
AAATTATATGGATTTGTCGTCTCCCGAAAGCCAAAGGTTATCAAATAAAG
ATAGAAGTTCAGGTAAAAGAAGCATGGAGTCGGTAAGCAGTGAAAATGAT
CTGGATTTTAGTCCAGATGATAATCGTAGTCTTTCTCATTCTTTGGGAAA
TACCGCAGATCTTTCAGAATTCGGTGAATCTAAATCATTCGAAAGTTTGG
AAAATATAATTGATGATGATGAAGATAATTTGCTTATTAATCCTGAAACT
AACAACAATGACAAAGAATCTTCAGAGAAATCGACCGAGGAACTAGGAAA
TCTAGATAACTGTACAAATAATGTTGTTAGAATTCGAGGATCCAGGAGTA
GTATAACAGTCTATCCGGATTCTGTTGAAGCTTCAGAAACAGTTGATGAG
GATTTACAAAAGACTATGCAAGGCTTAAAAAGAATTGAGGAGTTAAATGT
TATTAAGCATCGCAACACCGTACATATTGATAAATCCTTATTGGCTAGCA
AATTTCTTAGCCCTCTAACTTCCAATCAGAAAATGACATTAGCGGAAGTT
AGTGACCAATTAATGGCTTTTCAGCAGAACAAACTCAATTGTTCCGATTT
TAAAATGAAGAAACCCGGCAATGTGAATGCATTGACATCTTCATTTGAAA
TGAGCCAACCGACAAAGCCAATCACAGTGAAACCAAACGAATACCCAAAC
AACAGTCTTTACCGGATTCGAGGTGTCATCCCGGAAGAGAATTCCGCGGT
TGTCGCGAGTTATCCTCCACCAATTTTTCCAAAACCACCTTTCTCGAAAA
ACTTTAAAAAATAAAATCTGAACTGATGAAATTTGATTAAAATATTTCTA
TTTGTTTTGAAAATTTGTTTTCTACGATTATTTTCTATTATAATTGAAAA
AATAATTTATGTATTTTGTGAGAAAGCGTATTTCATCGAAAAATTGATTT
CCGTTTGACGAATCAAATTATTGCGCAACAACAGCAAGTTAATTTAAACA
ATAAACAATTGAGTTTCGTTCTAGTTGATGATTGGTGTTTGACAATTTAC
TTTGTAAACCAACTAAAAATTTTCATTTTACAGATTATTGTTGGTTGTTT
TTGATATCTGATTTGAGTATATATTGGTTGTTTTTTCGTATTTCATATTT
GACATTTTCATACAGTCGATTGGAATTGTTTTTTTTTAGATAATTTAGTA
TTAAG
back to top

protein sequence of SMED30004435-orf-1

>SMED30004435-orf-1 ID=SMED30004435-orf-1|Name=SMED30004435-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1126bp
MKHFETQIRDFNQQFTDQIKCLDAKVSVDNSILSNIFDLYKRRAVIEQEY
SDNLLKLSSNISQRNNSENLKRPNWKKNYSPLTVLNNLIASTQYTAKAHR
NLSDIYGKQMTQRLLDMQEDCIRLNRKSTDILQKHHAEIIRSLNQLLLKQ
KIYTKSFNEAEEARKRADRAMDQLDKEVIRCQDKKKELDKNPRIKKLREE
YLERNGQFKIKQADSTIARNKYIIHLISLKESIDYFYSNELKTIVQCAEY
GFHNNLTRLSMNHNSCEEALTTVHDSISNLFTETIEKIDAENDTEIFLEA
NKPTLTLKENLHFIPVKGDNVNQILKFQEPVQNDLENMFQRFSAEIKSIS
NKVEENKLQIDSLSKSLNDFINQSDYDVVDYIRGIESTSAKEKTTSLPRN
IVTDSLYTSLQKNTKELKFKAENSYFEAMESYLNNEINMTNMSSKLKSVE
TVLKNISIDDSQNTLYCFSSIHSTTAVIIGIKSKLFGGDLIKYSKETKEM
VPLVVQSCIRLISLYGMRNIGVFRVPGSQIDVQSYKSQFELGTDPLKSLK
GTSNDVNLAASILKLYFRELDPPIFNEEMFNEIVNNYNDSKRTDESIVNF
LKVIILKLRPPAYCTLKYLLSFISHLAEFSSENCMDVVNLAIIFGPCLMP
IPEEKSTQLFQFQTIVNYVAQCLITNHQTVFTRDSEGPVYQREPKNSNDT
HNHNVKSNEPESDKAKTFDDNFTCGTDEVLKKSKPDLKNLKRNESTRYVR
SNVGEENLRIRRNSDSERPSNVLAVALFDYQAKSDQEISFKKKDILVLTK
RVNEHWWTGHVIKELEHQANPVVNGLIPSAFFTIHSQNELSTNVESVEND
DSVKSNYMDLSSPESQRLSNKDRSSGKRSMESVSSENDLDFSPDDNRSLS
HSLGNTADLSEFGESKSFESLENIIDDDEDNLLINPETNNNDKESSEKST
EELGNLDNCTNNVVRIRGSRSSITVYPDSVEASETVDEDLQKTMQGLKRI
EELNVIKHRNTVHIDKSLLASKFLSPLTSNQKMTLAEVSDQLMAFQQNKL
NCSDFKMKKPGNVNALTSSFEMSQPTKPITVKPNEYPNNSLYRIRGVIPE
ENSAVVASYPPPIFPKPPFSKNFKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR036028SH3-like_dom_sf
IPR000198RhoGAP_dom
IPR001452SH3_domain
IPR001060FCH_dom
IPR008936Rho_GTPase_activation_prot
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 157..191
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 763..843
e-value: 9.5E-14
score: 52.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 684..717
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 927..956
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 857..895
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 696..717
NoneNo IPR availablePANTHERPTHR14166SLIT-ROBO RHO GTPASE ACTIVATING PROTEINcoord: 2..982
NoneNo IPR availableCDDcd00174SH3coord: 774..831
e-value: 6.88097E-12
score: 59.0135
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 499..678
e-value: 4.1E-35
score: 132.6
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 502..654
e-value: 4.9E-34
score: 117.3
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 488..681
score: 33.527
IPR001452SH3 domainSMARTSM00326SH3_2coord: 772..836
e-value: 4.3E-10
score: 49.5
IPR001452SH3 domainPFAMPF00018SH3_1coord: 775..813
e-value: 1.8E-10
score: 40.3
IPR001452SH3 domainPROSITEPS50002SH3coord: 769..837
score: 19.844
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 472..684
e-value: 3.8E-46
score: 159.0
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 484..681
IPR001060FCH domainPFAMPF00611FCHcoord: 18..100
e-value: 3.1E-10
score: 40.2
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 8..324
e-value: 7.0E-36
score: 125.8
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 10..307
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 768..866