AAA domain-containing protein

Overview
NameAAA domain-containing protein
Smed IDSMED30004426
Length (bp)522
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AAA domain-containing protein (SMED30004426) t-SNE clustered cells

Violin plots show distribution of expression levels for AAA domain-containing protein (SMED30004426) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AAA domain-containing protein (SMED30004426) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AAA domain-containing protein (SMED30004426) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004426

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30004426SMESG000050587.1 SMESG000046053.1 SMESG000034701.1 SMESG000029555.1 SMESG000026530.1 SMESG000008351.1 SMESG000006220.1 Contig16387uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004426SMESG000050587.1 SMESG000046053.1 SMESG000034701.1 SMESG000029555.1 SMESG000026530.1 SMESG000008351.1 SMESG000006220.1 Contig16387newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004426SMESG000081267.1 SMESG000076652.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000042302.1 SMESG000040193.1 SMESG000037212.1 SMESG000036590.1 SMESG000035558.1 SMESG000034701.1 SMESG000030608.1 SMESG000029226.1 SMESG000014974.1 SMESG000003230.1 SMESG000003226.1 SMESG000003218.1 Contig19325uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004426SMESG000081267.1 SMESG000076652.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000042302.1 SMESG000040193.1 SMESG000037212.1 SMESG000036590.1 SMESG000035558.1 SMESG000034701.1 SMESG000030608.1 SMESG000029226.1 SMESG000014974.1 SMESG000003230.1 SMESG000003226.1 SMESG000003218.1 Contig19325newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30004426SMESG000079430.1 SMESG000079180.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000048922.1 SMESG000042302.1 SMESG000040193.1 SMESG000037212.1 SMESG000034701.1 SMESG000029226.1 SMESG000022704.1 SMESG000013229.1 SMESG000005221.1 SMESG000075565.1 SMESG000001901.1 dd_Smed_v4_11155_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004426SMESG000079430.1 SMESG000079180.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000048922.1 SMESG000042302.1 SMESG000040193.1 SMESG000037212.1 SMESG000034701.1 SMESG000029226.1 SMESG000022704.1 SMESG000013229.1 SMESG000005221.1 SMESG000075565.1 SMESG000001901.1 dd_Smed_v4_11155_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004426SMESG000079430.1 SMESG000079180.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000048922.1 SMESG000042302.1 SMESG000040193.1 SMESG000037212.1 SMESG000034701.1 SMESG000029226.1 SMESG000022704.1 SMESG000013229.1 SMESG000005221.1 SMESG000075565.1 SMESG000001901.1 dd_Smed_v4_11155_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004426SMESG000079430.1 SMESG000079180.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000048922.1 SMESG000042302.1 SMESG000040193.1 SMESG000037212.1 SMESG000034701.1 SMESG000029226.1 SMESG000022704.1 SMESG000013229.1 SMESG000005221.1 SMESG000075565.1 SMESG000001901.1 dd_Smed_v4_11155_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004426SMESG000050287.1 SMESG000040193.1 SMESG000037212.1 SMESG000012956.1 Contig39842uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004426SMESG000050287.1 SMESG000040193.1 SMESG000037212.1 SMESG000012956.1 Contig39842newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30004426SMESG000023289.1 SMESG000038292.1 SMESG000024597.1 Contig49304uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30004426SMESG000023289.1 SMESG000038292.1 SMESG000024597.1 Contig49304newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30004426SMESG000055140.1 SMESG000028231.1 SMESG000020698.1 Contig35729uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004426SMESG000055140.1 SMESG000028231.1 SMESG000020698.1 Contig35729newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A2L2YU97 (Uncharacterized protein (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.617e-14
Identity = 46/117 (39.32%), Postives = 66/117 (56.41%), Query Frame = 2
Query:  119 IVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLITKIARHIGVTVIFITQNFFIKGTVIE 469
            I GP+GSGK+ FV KL+++N+F      I +       +G  Q  F K+KN+K  +G   N SS      VIIIDDL  E + +   +NL +K + H  +T+IF+ QN F KG V+ 
Sbjct:    7 ISGPTGSGKSFFVSKLIENNMFYPMPKNIIY------CYGCYQPLFDKMKNVKFEEGLPSNLSSI--SDAVIIIDDLMSELSSDITLSNLFSKYSHHRKLTIIFLVQNIFHKGRVMR 115          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A4Y2QW74 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_149572_1 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.190e-11
Identity = 45/113 (39.82%), Postives = 60/113 (53.10%), Query Frame = 2
Query:  119 IVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLITKIARHIGVTVIFITQNFFIKG 457
            I GPS SGKT FV +LL S L Q    KI W  GA       Q  F  + N++  +G   +  +      +IIIDDL  E + +K  +NL TK + H  +++IFI QN F KG
Sbjct:   14 ISGPSNSGKTFFVKRLLDSKLIQPFPPKILWCYGA------YQKLFDNMPNVEFHEGLPSDIDTV--SDALIIIDDLMSEVSSDKRLSNLFTKGSHHRNLSIIFIVQNMFHKG 118          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A4Y2X7P9 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_182928_1 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 6.087e-11
Identity = 40/115 (34.78%), Postives = 59/115 (51.30%), Query Frame = 2
Query:  119 IVGPSGSGKTMFVCKLL--KSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLITKIARHIGVTVIFITQNFFIKG 457
            + GP+G GKT FV  LL  K  +F    +KI W       +G+ Q  +  +  +  V+G    +   L K  + IIDDL      +K   +L TK + H+ +++IFI QNFF KG
Sbjct:    3 MAGPTGCGKTYFVRDLLRYKGKMFSPVPDKIVWF------YGIHQPLYDNIPKVAFVEGLPLKFQEYLGKRTLFIIDDLMSHGANQKLLTDLFTKGSHHLNLSIIFIVQNFFHKG 111          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A443SPL1 (Uncharacterized protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_09714 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 2.392e-10
Identity = 39/115 (33.91%), Postives = 61/115 (53.04%), Query Frame = 2
Query:  119 IVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNW--SSRLRKGDVIIIDDLYQEANKEKDFNNLITKIARHIGVTVIFITQNFFIKG 457
            + GP+  GKT +V KLLK+ L + ++  +Y++     +  L  +       +K VK  D+N   +    K  VI+IDDL  EA   +   +L TK + H  ++VI + QNFF KG
Sbjct:   10 VAGPTSCGKTAWVMKLLKNMLEKNRYKIVYFY---SMKQPLYDEISASHPFIKFVKNIDQNIIENHNPCKKAVIVIDDLMSEATNNQYICDLFTKGSHHKNLSVILLLQNFFCKG 121          

HSP 2 Score: 33.8834 bits (76), Expect = 2.392e-10
Identity = 15/26 (57.69%), Postives = 20/26 (76.92%), Query Frame = 1
Query:  442 LFHQGNGHRTRNLNIQYLVIFKNLRD 519
             F +GN +RT +LN QY+V+FKN RD
Sbjct:  117 FFCKGNFNRTISLNTQYIVLFKNPRD 142          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A1I8J8Y3 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.706e-10
Identity = 38/127 (29.92%), Postives = 67/127 (52.76%), Query Frame = 2
Query:   89 MELRNDAVYQIVGPSGSGKTMFVCKLL--KSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKI--VKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLITKIARHIGVTVIFITQNFFIKG 457
            + LR  +   + GP+ +GKT FV  L+  K  LF  K  ++ W+      +G++Q    +L ++ +   +GF  +  + LR  D+++ DDL +E +      N+ T IA H+   ++ +TQN F KG
Sbjct:   99 VRLRQGSCMIVSGPTNAGKTTFVKHLIQYKDVLFDVKPGRVLWY------YGISQAAHSELSSLGVHLQQGFPSSIETALRPNDLVVFDDLIEETSNSAAMRNVFTGIAHHLPCFLVMLTQNVFFKG 219          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000051837.1 (SMESG000051837.1)

HSP 1 Score: 246.514 bits (628), Expect = 2.176e-77
Identity = 116/123 (94.31%), Postives = 120/123 (97.56%), Query Frame = 2
Query:   89 MELRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLITKIARHIGVTVIFITQNFFIKG 457
            M+LRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNL TKI+RH+GVTVIFITQN F +G
Sbjct:    1 MDLRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLFTKISRHVGVTVIFITQNLFHQG 123          

HSP 2 Score: 52.373 bits (124), Expect = 3.167e-8
Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 1
Query:  442 LFHQGNGHRTRNLNIQYLVIFKNLRDA 522
            LFHQG  HRTRNLN+QYLVIFKN RDA
Sbjct:  119 LFHQGGAHRTRNLNVQYLVIFKNPRDA 145          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000065288.1 (SMESG000065288.1)

HSP 1 Score: 248.44 bits (633), Expect = 2.082e-76
Identity = 117/123 (95.12%), Postives = 120/123 (97.56%), Query Frame = 2
Query:   89 MELRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLITKIARHIGVTVIFITQNFFIKG 457
            MELRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNL TKI+RH+GVTVIFITQN F +G
Sbjct:    1 MELRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLFTKISRHVGVTVIFITQNLFHQG 123          

HSP 2 Score: 52.7582 bits (125), Expect = 3.016e-8
Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 1
Query:  442 LFHQGNGHRTRNLNIQYLVIFKNLRDA 522
            LFHQG  HRTRNLN+QYLVIFKN RDA
Sbjct:  119 LFHQGGAHRTRNLNVQYLVIFKNPRDA 145          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000061056.1 (SMESG000061056.1)

HSP 1 Score: 248.054 bits (632), Expect = 2.227e-76
Identity = 117/123 (95.12%), Postives = 120/123 (97.56%), Query Frame = 2
Query:   89 MELRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLITKIARHIGVTVIFITQNFFIKG 457
            MELRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNL TKI+RH+GVTVIFITQN F +G
Sbjct:    1 MELRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLFTKISRHVGVTVIFITQNLFHQG 123          

HSP 2 Score: 52.373 bits (124), Expect = 3.282e-8
Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 1
Query:  442 LFHQGNGHRTRNLNIQYLVIFKNLRDA 522
            LFHQG  HRTRNLN+QYLVIFKN RDA
Sbjct:  119 LFHQGGAHRTRNLNVQYLVIFKNPRDA 145          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000029226.1 (SMESG000029226.1)

HSP 1 Score: 246.514 bits (628), Expect = 8.460e-76
Identity = 116/123 (94.31%), Postives = 120/123 (97.56%), Query Frame = 2
Query:   89 MELRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLITKIARHIGVTVIFITQNFFIKG 457
            M+LRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNL TKI+RH+GVTVIFITQN F +G
Sbjct:    1 MDLRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLFTKISRHVGVTVIFITQNLFHQG 123          

HSP 2 Score: 52.373 bits (124), Expect = 3.376e-8
Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 1
Query:  442 LFHQGNGHRTRNLNIQYLVIFKNLRDA 522
            LFHQG  HRTRNLN+QYLVIFKN RDA
Sbjct:  119 LFHQGGAHRTRNLNVQYLVIFKNPRDA 145          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000037212.1 (SMESG000037212.1)

HSP 1 Score: 242.662 bits (618), Expect = 1.852e-74
Identity = 113/122 (92.62%), Postives = 119/122 (97.54%), Query Frame = 2
Query:   89 MELRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLITKIARHIGVTVIFITQNFFIK 454
            M+ RNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWH+GADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNL TKI+RH+GVTVIFITQ +FI+
Sbjct:    1 MDFRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHKGADEEHGLTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNLFTKISRHVGVTVIFITQIYFIR 122          
The following BLAST results are available for this feature:
BLAST of AAA domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2L2YU976.617e-1439.32Uncharacterized protein (Fragment) OS=Parasteatoda... [more]
A0A4Y2QW742.190e-1139.82Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2X7P96.087e-1134.78Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A443SPL12.392e-1033.91Uncharacterized protein OS=Leptotrombidium deliens... [more]
A0A1I8J8Y32.706e-1029.92ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051837.12.176e-7794.31SMESG000051837.1[more]
SMESG000065288.12.082e-7695.12SMESG000065288.1[more]
SMESG000061056.12.227e-7695.12SMESG000061056.1[more]
SMESG000029226.18.460e-7694.31SMESG000029226.1[more]
SMESG000037212.11.852e-7492.62SMESG000037212.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004426 ID=SMED30004426|Name=AAA domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=522bp
GAAATATTAAGCTATATATATGAGTTTTTAGGAAGAGTTCATTAAATCGT
ATAATATAAACAAAAACCTATAATTATACAAATTAATAATGGAATTAAGA
AATGATGCTGTATATCAAATCGTCGGCCCAAGTGGTAGTGGTAAAACTAT
GTTTGTGTGTAAATTACTGAAATCTAATTTATTTCAAACAAAATTCAACA
AGATTTATTGGCATAGGGGTGCAGATGAAGAACATGGATTAACTCAAGAT
AATTTCTGTAAATTGAAAAACATGAAAATAGTAAAGGGTTTCGATAAAAA
CTGGTCAAGTCGTTTAAGGAAAGGTGATGTCATCATTATTGATGATTTGT
ATCAGGAAGCTAATAAAGAAAAGGATTTTAATAATTTAATTACAAAAATT
GCTCGACATATTGGAGTTACTGTTATTTTCATTACTCAAAACTTTTTCAT
CAAGGGAACGGTCATAGAACTCGTAATTTAAATATACAATACTTGGTTAT
TTTTAAAAACCTTCGAGATGCA
back to top

protein sequence of SMED30004426-orf-1

>SMED30004426-orf-1 ID=SMED30004426-orf-1|Name=SMED30004426-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MELRNDAVYQIVGPSGSGKTMFVCKLLKSNLFQTKFNKIYWHRGADEEHG
LTQDNFCKLKNMKIVKGFDKNWSSRLRKGDVIIIDDLYQEANKEKDFNNL
ITKIARHIGVTVIFITQNFFIKGTVIELVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0019073viral DNA genome packaging
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR000605Helicase_SF3_ssDNA/RNA_vir
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0003724RNA helicase activity
GO:0003723RNA binding