Integrator complex subunit 2

Overview
NameIntegrator complex subunit 2
Smed IDSMED30004424
Length (bp)1833
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Integrator complex subunit 2 (SMED30004424) t-SNE clustered cells

Violin plots show distribution of expression levels for Integrator complex subunit 2 (SMED30004424) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Integrator complex subunit 2 (SMED30004424) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Integrator complex subunit 2 (SMED30004424) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004424

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004424SMESG000061179.1 SmedASXL_015478SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004424SMESG000061179.1 SmedASXL_015478SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30004424SMESG000061179.1 dd_Smed_v4_7197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30004424SMESG000061179.1 dd_Smed_v4_7197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Match: INTS2 (integrator complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:29241])

HSP 1 Score: 209.149 bits (531), Expect = 8.804e-57
Identity = 154/584 (26.37%), Postives = 269/584 (46.06%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKI--QGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLC------LLDFLKRILLDEGVETNQWFTQYLKAIRTGSQL-----------------------------TLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMFDTNVLGHPMTACYKMSDNVHIDNNMS 1831
            V +H +  D +K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V  S    F F  SEL  +  +  E   V+ +L  + PSL     + +  ++   G   +  L  N P  +  +C  LI+   +   + L    +        ++ +   NP Q   +    +    LP L + + +D H   + C      L+ F+  +LL    +   WF  +   IR G Q                              T ++ E  ++M  N +  S     +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y      +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI G LPI C+ QLL  RSF+K+KV I +WIYRQ+C +  P+HP+L  LI  Y+ S+L   SK++    N P++E  I+ +F   V+G          DN+ ++   S
Sbjct:   82 VDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIMNKVSESNGEFF-FKSSELFESPVYLEEAADVLCILQAELPSLLPIVDVAEALLHVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRT-----DALRFLCKMNPSQALKVRGMVVEECHLPGLGVALTLD-HTKNEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTF---IRNGQQRKRETSSSVLWQMRRQLLLELMGILPTVRSTRIVEEADVDMEPNVSVYSGL--KEEHVVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQ-----EQLMVVWL-SWMIKEEAYFESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNIFQ-GVIG---------GDNIRLNQRFS 636          
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Match: INTS2 (integrator complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:29241])

HSP 1 Score: 209.149 bits (531), Expect = 8.804e-57
Identity = 154/584 (26.37%), Postives = 269/584 (46.06%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKI--QGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLC------LLDFLKRILLDEGVETNQWFTQYLKAIRTGSQL-----------------------------TLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMFDTNVLGHPMTACYKMSDNVHIDNNMS 1831
            V +H +  D +K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V  S    F F  SEL  +  +  E   V+ +L  + PSL     + +  ++   G   +  L  N P  +  +C  LI+   +   + L    +        ++ +   NP Q   +    +    LP L + + +D H   + C      L+ F+  +LL    +   WF  +   IR G Q                              T ++ E  ++M  N +  S     +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y      +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI G LPI C+ QLL  RSF+K+KV I +WIYRQ+C +  P+HP+L  LI  Y+ S+L   SK++    N P++E  I+ +F   V+G          DN+ ++   S
Sbjct:   82 VDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIMNKVSESNGEFF-FKSSELFESPVYLEEAADVLCILQAELPSLLPIVDVAEALLHVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRT-----DALRFLCKMNPSQALKVRGMVVEECHLPGLGVALTLD-HTKNEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTF---IRNGQQRKRETSSSVLWQMRRQLLLELMGILPTVRSTRIVEEADVDMEPNVSVYSGL--KEEHVVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQ-----EQLMVVWL-SWMIKEEAYFESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNIFQ-GVIG---------GDNIRLNQRFS 636          
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Match: INTS2 (integrator complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:29241])

HSP 1 Score: 208.764 bits (530), Expect = 1.103e-56
Identity = 154/584 (26.37%), Postives = 269/584 (46.06%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKI--QGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLC------LLDFLKRILLDEGVETNQWFTQYLKAIRTGSQL-----------------------------TLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMFDTNVLGHPMTACYKMSDNVHIDNNMS 1831
            V +H +  D +K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V  S    F F  SEL  +  +  E   V+ +L  + PSL     + +  ++   G   +  L  N P  +  +C  LI+   +   + L    +        ++ +   NP Q   +    +    LP L + + +D H   + C      L+ F+  +LL    +   WF  +   IR G Q                              T ++ E  ++M  N +  S     +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y      +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI G LPI C+ QLL  RSF+K+KV I +WIYRQ+C +  P+HP+L  LI  Y+ S+L   SK++    N P++E  I+ +F   V+G          DN+ ++   S
Sbjct:   90 VDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIMNKVSESNGEFF-FKSSELFESPVYLEEAADVLCILQAELPSLLPIVDVAEALLHVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRT-----DALRFLCKMNPSQALKVRGMVVEECHLPGLGVALTLD-HTKNEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTF---IRNGQQRKRETSSSVLWQMRRQLLLELMGILPTVRSTRIVEEADVDMEPNVSVYSGL--KEEHVVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQ-----EQLMVVWL-SWMIKEEAYFESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNIFQ-GVIG---------GDNIRLNQRFS 644          
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Match: INTS2 (integrator complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:29241])

HSP 1 Score: 208.764 bits (530), Expect = 1.103e-56
Identity = 154/584 (26.37%), Postives = 269/584 (46.06%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKI--QGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLC------LLDFLKRILLDEGVETNQWFTQYLKAIRTGSQL-----------------------------TLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMFDTNVLGHPMTACYKMSDNVHIDNNMS 1831
            V +H +  D +K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V  S    F F  SEL  +  +  E   V+ +L  + PSL     + +  ++   G   +  L  N P  +  +C  LI+   +   + L    +        ++ +   NP Q   +    +    LP L + + +D H   + C      L+ F+  +LL    +   WF  +   IR G Q                              T ++ E  ++M  N +  S     +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y      +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI G LPI C+ QLL  RSF+K+KV I +WIYRQ+C +  P+HP+L  LI  Y+ S+L   SK++    N P++E  I+ +F   V+G          DN+ ++   S
Sbjct:   90 VDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIMNKVSESNGEFF-FKSSELFESPVYLEEAADVLCILQAELPSLLPIVDVAEALLHVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRT-----DALRFLCKMNPSQALKVRGMVVEECHLPGLGVALTLD-HTKNEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTF---IRNGQQRKRETSSSVLWQMRRQLLLELMGILPTVRSTRIVEEADVDMEPNVSVYSGL--KEEHVVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQ-----EQLMVVWL-SWMIKEEAYFESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNIFQ-GVIG---------GDNIRLNQRFS 644          
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Match: INTS2 (integrator complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:29241])

HSP 1 Score: 53.5286 bits (127), Expect = 5.917e-7
Identity = 54/253 (21.34%), Postives = 99/253 (39.13%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQ----GLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLC------LLDFLKRILLDEGVETNQWFTQYLKAIRTGSQLTL 934
            V +H +  D +K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V  S    F F  SEL  +  +  E   V+ +L  + PSL     + +  ++   G   +  L  N P  +  +C  LI+   +      G         F+  +       NP Q   +    +    LP L + + +D H   + C      L+ F+  +LL    +   WF  +   IR G Q+ +
Sbjct:   82 VDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIMNKVSESNGEFF-FKSSELFESPVYLEEAADVLCILQAELPSLLPIVDVAEALLHVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRTDALRFLCKM-------NPSQALKVRGMVVEECHLPGLGVALTLD-HTKNEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTF---IRNGQQVRV 321          
BLAST of Integrator complex subunit 2 vs. Ensembl Fly
Match: IntS2 (gene:FBgn0030858 transcript:FBtr0074480)

HSP 1 Score: 191.43 bits (485), Expect = 2.991e-51
Identity = 133/484 (27.48%), Postives = 240/484 (49.59%), Query Frame = 2
Query:  350 KKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAI--RTGSQLTLVISE---KLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQNSYS--ELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLL---PTESKN-SQGNDPISEATIIEMFDTNVL 1768
            +K  ++L EI  L   V   KP     + SE+L++  +  E+  ++ + + + PSL +   +    ++   G  +I +L  NFP  +  + + +I   ++      H       L ++  +   NP Q  +    C+    +P  +L + +         L+ FL  +LL        WF  Y+++   R G  L LV  E   K+I+   N   +      ++  ++  +LL++   L+     +F+ +    L +L+T     T   V F+  ++  +IA  S        +  ++    +WL+ LI +   + K+   S S  E+LLL A+ +H+ Q++ IS+++ S    K+     S N  +++FT D+FTEQ++  HAV+VPVT NLN  I  +LP+ C+ QLL  R+F K+KV I +WI++QIC+S+ P+HP +P L++ +V +L+   PT   N    + P +EA I+ +F T+ L
Sbjct:  126 RKVRVVLSEIFNLQQQVSEQKPA----AHSEMLDDGIYLEEVVDILCIALAELPSLLNILELTDALVHVPNGHRIICALVANFPDCYRDVVSHVIANCDEDGSDGKHR------LMLLMGLSEMNPSQALANRSMCVDMLKVPSFMLKLTLKHPED----LIAFLTGLLLGNDQNLRSWFAAYIRSSQKRKGDALNLVRVELLQKVIQTTTNAAEL------RDFNLQGAVLLRLYCALRGIGGLKFNDDEINALSQLVTSCPQATPSGVRFVTLALCMLIACPSLV-----STIPLENKAVEWLQWLIREDAFFCKRPGTSTSLGEMLLLLAIHFHSNQISAISEMVCSTLAMKIPIRPNSTNRIKQLFTQDLFTEQVVALHAVRVPVTPNLNGTILCYLPVHCIQQLLKSRTFLKHKVPIKSWIFKQICSSVRPVHPVMPALVEVFVNTLIIPNPTGKVNIDHMHRPFTEAEILHVFRTSKL 584          
BLAST of Integrator complex subunit 2 vs. Ensembl Zebrafish
Match: ints2 (integrator complex subunit 2 [Source:ZFIN;Acc:ZDB-GENE-050522-148])

HSP 1 Score: 197.208 bits (500), Expect = 5.402e-53
Identity = 151/561 (26.92%), Postives = 262/561 (46.70%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQ----SKKSNNVGDMKFQF---ICNEFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANK-----IQGLNYHIQLPEFILHIIKSVLNFNPKQIYSI----LEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGSQLTLVISEKLIEMAK-------------------NFNSISCKCSS------KEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLL-PTESKNSQG-NDPISEATIIEMFDTNVLG 1771
            V +H +  D  K QQ    +  SN    +  Q    +  EF+ S +P ++  + L E+  +++ V +S    F    SEL  +  +  E+  V+ +L  + PSL     + +  ++   G   +  L  N P  +  +C  LI+   +     + G              ++ +   NP Q  +I    +E C    L   L L+   DM +     L+ ++  +LL    +   WF+ +   IR G Q     S  L +M +                   N + +  + SS      +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++EY      +  S+ E+LLL A+++H+ QL+ I +++ S  G K+     S++  + +FT ++FTEQ++T+HAV+V VT NL++NI G LPI C+ QLL  R+F+K+KV I +WI+RQ+C +  P+H +L  LI  Y+ S+L P    N +  N PI+E  I+ +F     G
Sbjct:   82 VDFHALEQDARKEQQLRHKAGGSNGESILVSQLQHGLTLEFEHS-DPLRRLRLALSELLAIMNKVADSNGEFF-LKSSELFESPVYLEEVADVLCILQAELPSLLPIIEVAEALLHVRNGEWFLCLLVANVPDSFNEVCRGLIKNGERQDEESVGGRRRT--------EALRQLCQMNPSQALNIRAMVVEECHLPGLGVALTLDYKPDMADEAVSPLVSYVSGLLLGTNGKVRTWFSLF---IRNGQQRKRESSSVLWQMRRQLLLELVAILPRSRSTHVPNDSDMDTESSSGYSGLREEHVVKASALLRLYCALMGIAGLRPTDEEAEQLLQLMTSRPPATPAGVRFVSLSFCKLLAFPTLVSTPEQ-----EQLMVMWL-SWMIKEEEYFESAAGVSASFGEMLLLVAMYFHSNQLSAIIELVCSTLGMKIAIKPSSLSKMKTIFTQEIFTEQVVTAHAVRVAVTNNLSANITGFLPIHCIYQLLRSRAFTKHKVSIKDWIFRQLCETTTPLHTQLLPLIDVYINSILTPASKTNPEATNQPITEQEILNVFQGLAGG 623          
BLAST of Integrator complex subunit 2 vs. Ensembl Zebrafish
Match: ints2 (integrator complex subunit 2 [Source:ZFIN;Acc:ZDB-GENE-050522-148])

HSP 1 Score: 157.532 bits (397), Expect = 7.898e-40
Identity = 143/561 (25.49%), Postives = 246/561 (43.85%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQ----SKKSNNVGDMKFQF---ICNEFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANK-----IQGLNYHIQLPEFILHIIKSVLNFNPKQIYSI----LEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGSQLTLVISEKLIEMAK-------------------NFNSISCKCSS------KEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLL-PTESKNSQG-NDPISEATIIEMFDTNVLG 1771
            V +H +  D  K QQ    +  SN    +  Q    +  EF+ S +P ++  + L E+  +++ V +S    F    SEL  +  +  E+  V+ +L  + PSL     + +  ++   G   +  L  N P  +  +C  LI+   +     + G              ++ +   NP Q  +I    +E C    L   L L+   DM +     L+ ++  +LL    +   WF+ +   IR G Q     S  L +M +                   N + +  + SS      +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++EY      +  S+ E+LLL A+++H+ QL+ I +++ S  G KV            +  H+        +H V V  T NL++NI G LPI C+ QLL  R+F+K+KV I +WI+RQ+C +  P+H +L  LI  Y+ S+L P    N +  N PI+E  I+ +F     G
Sbjct:   82 VDFHALEQDARKEQQLRHKAGGSNGESILVSQLQHGLTLEFEHS-DPLRRLRLALSELLAIMNKVADSNGEFF-LKSSELFESPVYLEEVADVLCILQAELPSLLPIIEVAEALLHVRNGEWFLCLLVANVPDSFNEVCRGLIKNGERQDEESVGGRRRT--------EALRQLCQMNPSQALNIRAMVVEECHLPGLGVALTLDYKPDMADEAVSPLVSYVSGLLLGTNGKVRTWFSLF---IRNGQQRKRESSSVLWQMRRQLLLELVAILPRSRSTHVPNDSDMDTESSSGYSGLREEHVVKASALLRLYCALMGIAGLRPTDEEAEQLLQLMTSRPPATPAGVRFVSLSFCKLLAFPTLVSTPEQ-----EQLMVMWL-SWMIKEEEYFESAAGVSASFGEMLLLVAMYFHSNQLSAIIELVCSTLGMKV------------IGQHE--------THLVAV--TNNLSANITGFLPIHCIYQLLRSRAFTKHKVSIKDWIFRQLCETTTPLHTQLLPLIDVYINSILTPASKTNPEATNQPITEQEILNVFQGLAGG 601          
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:595088])

HSP 1 Score: 178.718 bits (452), Expect = 1.068e-46
Identity = 127/486 (26.13%), Postives = 226/486 (46.50%), Query Frame = 2
Query:  422 FEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANK-----IQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAID-----MHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGS------------QLTLVISEKLIEMAKNFNSISCKCSSK---------------EMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMF 1753
            F    SEL  +     E   V+ +L  +  +L   + + +  ++   G   +  L  N P  +  +C SLI+   +     I G              ++ +   NP Q   +    +    LP L + + +D     +   G   ++ F+  +LL    +   WF  +   IR G             Q+   +  +L+ +     SIS    ++               E +VKA  LL++   L      + + E +  +++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y      +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI+G LPI C+ QLL  R+F+K+KV I +WIY QIC +  P+H +L  LI  Y+ S++   SK+S    N P++E  I+++F
Sbjct:  167 FFLKSSELFESPVHMEEAADVLCILQAELHTLLPINDMAEALLHVRNGAWFLCLLVANVPDSFSEVCRSLIKNGERQDEESIGGRRR--------TEALRQLCKMNPSQALKVRSMVVEECHLPGLGVALTLDHTKNEVGEDGVSNMVCFVSGLLLGTNTKVRTWFGTF---IRNGQLRRRENSSSVLWQMRRQLLSELMGILPAAKSISVADEAEKSQEPGVSVHPGLKEEHVVKASALLRLYCALMGIAGLKPTDEEAEQVLQLMTSRPPATPAGVRFVSLSFCMLLAFSTVVSTPEQ-----EQLMLMWL-SWMIKEEAYFESTAGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANISGFLPIHCIYQLLRSRAFTKHKVSIKDWIYTQICETTTPLHQQLLPLIDVYINSIITPASKSSPEATNKPVTEQEILKVF 635          
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:595088])

HSP 1 Score: 178.718 bits (452), Expect = 1.203e-46
Identity = 127/486 (26.13%), Postives = 226/486 (46.50%), Query Frame = 2
Query:  422 FEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANK-----IQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAID-----MHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGS------------QLTLVISEKLIEMAKNFNSISCKCSSK---------------EMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMF 1753
            F    SEL  +     E   V+ +L  +  +L   + + +  ++   G   +  L  N P  +  +C SLI+   +     I G              ++ +   NP Q   +    +    LP L + + +D     +   G   ++ F+  +LL    +   WF  +   IR G             Q+   +  +L+ +     SIS    ++               E +VKA  LL++   L      + + E +  +++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y      +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI+G LPI C+ QLL  R+F+K+KV I +WIY QIC +  P+H +L  LI  Y+ S++   SK+S    N P++E  I+++F
Sbjct:  152 FFLKSSELFESPVHMEEAADVLCILQAELHTLLPINDMAEALLHVRNGAWFLCLLVANVPDSFSEVCRSLIKNGERQDEESIGGRRR--------TEALRQLCKMNPSQALKVRSMVVEECHLPGLGVALTLDHTKNEVGEDGVSNMVCFVSGLLLGTNTKVRTWFGTF---IRNGQLRRRENSSSVLWQMRRQLLSELMGILPAAKSISVADEAEKSQEPGVSVHPGLKEEHVVKASALLRLYCALMGIAGLKPTDEEAEQVLQLMTSRPPATPAGVRFVSLSFCMLLAFSTVVSTPEQ-----EQLMLMWL-SWMIKEEAYFESTAGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANISGFLPIHCIYQLLRSRAFTKHKVSIKDWIYTQICETTTPLHQQLLPLIDVYINSIITPASKSSPEATNKPVTEQEILKVF 620          
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:595088])

HSP 1 Score: 177.948 bits (450), Expect = 2.237e-46
Identity = 126/483 (26.09%), Postives = 224/483 (46.38%), Query Frame = 2
Query:  422 FEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANK-----IQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAID-----MHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGS------------QLTLVISEKLIEMAKNFNSISCKCSSK---------------EMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMF 1753
            F    SEL  +     E   V+ +L  +  +L   + + +  ++   G   +  L  N P  +  +C SLI+   +     I G              ++ +   NP Q   +    +    LP L + + +D     +   G   ++ F+  +LL    +   WF  +   IR G             Q+   +  +L+ +     SIS    ++               E +VKA  LL++   L      + + E +  +++L+T   P T   V F+  S   ++A  +   + +  SC +   L+ +    I     +   +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI+G LPI C+ QLL  R+F+K+KV I +WIY QIC +  P+H +L  LI  Y+ S++   SK+S    N P++E  I+++F
Sbjct:  172 FFLKSSELFESPVHMEEAADVLCILQAELHTLLPINDMAEALLHVRNGAWFLCLLVANVPDSFSEVCRSLIKNGERQDEESIGGRRR--------TEALRQLCKMNPSQALKVRSMVVEECHLPGLGVALTLDHTKNEVGEDGVSNMVCFVSGLLLGTNTKVRTWFGTF---IRNGQLRRRENSSSVLWQMRRQLLSELMGILPAAKSISVADEAEKSQEPGVSVHPGLKEEHVVKASALLRLYCALMGIAGLKPTDEEAEQVLQLMTSRPPATPAGVRFVSLSFCMLLAFSTVVRYAER-SCCITLCLSPFFFFYIY----FTAGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANISGFLPIHCIYQLLRSRAFTKHKVSIKDWIYTQICETTTPLHQQLLPLIDVYINSIITPASKSSPEATNKPVTEQEILKVF 638          
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:595088])

HSP 1 Score: 177.563 bits (449), Expect = 2.466e-46
Identity = 126/483 (26.09%), Postives = 224/483 (46.38%), Query Frame = 2
Query:  422 FEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANK-----IQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAID-----MHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGS------------QLTLVISEKLIEMAKNFNSISCKCSSK---------------EMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMF 1753
            F    SEL  +     E   V+ +L  +  +L   + + +  ++   G   +  L  N P  +  +C SLI+   +     I G              ++ +   NP Q   +    +    LP L + + +D     +   G   ++ F+  +LL    +   WF  +   IR G             Q+   +  +L+ +     SIS    ++               E +VKA  LL++   L      + + E +  +++L+T   P T   V F+  S   ++A  +   + +  SC +   L+ +    I     +   +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI+G LPI C+ QLL  R+F+K+KV I +WIY QIC +  P+H +L  LI  Y+ S++   SK+S    N P++E  I+++F
Sbjct:  152 FFLKSSELFESPVHMEEAADVLCILQAELHTLLPINDMAEALLHVRNGAWFLCLLVANVPDSFSEVCRSLIKNGERQDEESIGGRRR--------TEALRQLCKMNPSQALKVRSMVVEECHLPGLGVALTLDHTKNEVGEDGVSNMVCFVSGLLLGTNTKVRTWFGTF---IRNGQLRRRENSSSVLWQMRRQLLSELMGILPAAKSISVADEAEKSQEPGVSVHPGLKEEHVVKASALLRLYCALMGIAGLKPTDEEAEQVLQLMTSRPPATPAGVRFVSLSFCMLLAFSTVVRYAER-SCCITLCLSPFFFFYIY----FTAGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANISGFLPIHCIYQLLRSRAFTKHKVSIKDWIYTQICETTTPLHQQLLPLIDVYINSIITPASKSSPEATNKPVTEQEILKVF 618          
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:595088])

HSP 1 Score: 159.844 bits (403), Expect = 1.781e-40
Identity = 135/553 (24.41%), Postives = 241/553 (43.58%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANK-----IQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAID-----MHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGS----------QLTLVISEKLIEMAKNFNSISCKCSSK---------------EMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMF 1753
            V +H +  D  K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V +S    F    SEL  +     E   V+ +L  +  +L   + + +  ++   G   +  L  N P  +  +C SLI+   +     I G              ++ +   NP Q   +    +    LP L + + +D     +   G   ++ F+  +LL    +   WF  +   IR G           Q+   +  +L+ +     SIS    ++               E +VKA  LL++   L      + + E +  +++L+T   P T   V F+  S   ++A  +   + +  SC +   L+ +    I     +   +  S+ E+LLL A+++H+ QL+ I  ++ S  G KV                       +T+HAV+VPVT NL++NI+G LPI C+ QLL  R+F+K+KV I +WIY QIC +  P+H +L  LI  Y+ S++   SK+S    N P++E  I+++F
Sbjct:   82 VDFHALEQDANKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIINKVADSSGEFF-LKSSELFESPVHMEEAADVLCILQAELHTLLPINDMAEALLHVRNGAWFLCLLVANVPDSFSEVCRSLIKNGERQDEESIGGRRR--------TEALRQLCKMNPSQALKVRSMVVEECHLPGLGVALTLDHTKNEVGEDGVSNMVCFVSGLLLGTNTKVRTWFGTF---IRNGQLVKNSSSVLWQMRRQLLSELMGILPAAKSISVADEAEKSQEPGVSVHPGLKEEHVVKASALLRLYCALMGIAGLKPTDEEAEQVLQLMTSRPPATPAGVRFVSLSFCMLLAFSTVVRYAER-SCCITLCLSPFFFFYIY----FTAGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKV-----------------------VTAHAVRVPVTSNLSANISGFLPIHCIYQLLRSRAFTKHKVSIKDWIYTQICETTTPLHQQLLPLIDVYINSIITPASKSSPEATNKPVTEQEILKVF 593          
BLAST of Integrator complex subunit 2 vs. Ensembl Mouse
Match: Ints2 (integrator complex subunit 2 [Source:MGI Symbol;Acc:MGI:1917672])

HSP 1 Score: 205.682 bits (522), Expect = 8.990e-56
Identity = 150/566 (26.50%), Postives = 257/566 (45.41%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQ----GLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLC------LLDFLKRILLDEGVETNQWFTQYLKAIRTGSQL-----------------------------TLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMFDTNVLG 1771
            V +H +  D +K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V       F F  SEL  +  +  E   V+ +L  + PSL     + +  +    G   +  L  N P  +  +C  LI+   +      G         F+  +       NP Q   +    +    LP L + + +D H   + C      L+ F+  +LL    +   WF  +   IR G Q                              T ++ E  +EM    +  S     +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y      +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI G LPI C+ QLL  RSF+K+KV I +WIYRQ+C +  P+HP+L  LI  Y+ S+L   SK++    N P++E  I+ +F   + G
Sbjct:   83 VDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIMNKVSECNGEFF-FKSSELFESAVYLEEAADVLCILQAELPSLLPIVDVAEALLRVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRTDALRFLCRM-------NPSQALKVRGMVVEECHLPGLGVALTLD-HTKTEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTF---IRNGQQRKRETSGSVLWQMRRQLLLELMGILPTVRSTRIVEEADVEMEPTVSVYSGL--KEEHVVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQ-----EQLMVLWL-SWMIKEEAYFESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNLFQEVIGG 627          
BLAST of Integrator complex subunit 2 vs. Ensembl Mouse
Match: Ints2 (integrator complex subunit 2 [Source:MGI Symbol;Acc:MGI:1917672])

HSP 1 Score: 205.682 bits (522), Expect = 8.990e-56
Identity = 150/566 (26.50%), Postives = 257/566 (45.41%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQ----GLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLC------LLDFLKRILLDEGVETNQWFTQYLKAIRTGSQL-----------------------------TLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMFDTNVLG 1771
            V +H +  D +K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V       F F  SEL  +  +  E   V+ +L  + PSL     + +  +    G   +  L  N P  +  +C  LI+   +      G         F+  +       NP Q   +    +    LP L + + +D H   + C      L+ F+  +LL    +   WF  +   IR G Q                              T ++ E  +EM    +  S     +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y      +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI G LPI C+ QLL  RSF+K+KV I +WIYRQ+C +  P+HP+L  LI  Y+ S+L   SK++    N P++E  I+ +F   + G
Sbjct:   83 VDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIMNKVSECNGEFF-FKSSELFESAVYLEEAADVLCILQAELPSLLPIVDVAEALLRVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRTDALRFLCRM-------NPSQALKVRGMVVEECHLPGLGVALTLD-HTKTEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTF---IRNGQQRKRETSGSVLWQMRRQLLLELMGILPTVRSTRIVEEADVEMEPTVSVYSGL--KEEHVVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQ-----EQLMVLWL-SWMIKEEAYFESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNLFQEVIGG 627          
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q9H0H0|INT2_HUMAN (Integrator complex subunit 2 OS=Homo sapiens OX=9606 GN=INTS2 PE=1 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 5.296e-56
Identity = 154/584 (26.37%), Postives = 269/584 (46.06%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKI--QGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLC------LLDFLKRILLDEGVETNQWFTQYLKAIRTGSQL-----------------------------TLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMFDTNVLGHPMTACYKMSDNVHIDNNMS 1831
            V +H +  D +K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V  S    F F  SEL  +  +  E   V+ +L  + PSL     + +  ++   G   +  L  N P  +  +C  LI+   +   + L    +        ++ +   NP Q   +    +    LP L + + +D H   + C      L+ F+  +LL    +   WF  +   IR G Q                              T ++ E  ++M  N +  S     +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y      +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI G LPI C+ QLL  RSF+K+KV I +WIYRQ+C +  P+HP+L  LI  Y+ S+L   SK++    N P++E  I+ +F   V+G          DN+ ++   S
Sbjct:   90 VDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIMNKVSESNGEFF-FKSSELFESPVYLEEAADVLCILQAELPSLLPIVDVAEALLHVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRT-----DALRFLCKMNPSQALKVRGMVVEECHLPGLGVALTLD-HTKNEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTF---IRNGQQRKRETSSSVLWQMRRQLLLELMGILPTVRSTRIVEEADVDMEPNVSVYSGL--KEEHVVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQ-----EQLMVVWL-SWMIKEEAYFESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNIFQ-GVIG---------GDNIRLNQRFS 644          
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q80UK8|INT2_MOUSE (Integrator complex subunit 2 OS=Mus musculus OX=10090 GN=Ints2 PE=1 SV=2)

HSP 1 Score: 205.682 bits (522), Expect = 6.289e-55
Identity = 150/566 (26.50%), Postives = 257/566 (45.41%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQ----GLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLC------LLDFLKRILLDEGVETNQWFTQYLKAIRTGSQL-----------------------------TLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNS--QGNDPISEATIIEMFDTNVLG 1771
            V +H +  D +K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V       F F  SEL  +  +  E   V+ +L  + PSL     + +  +    G   +  L  N P  +  +C  LI+   +      G         F+  +       NP Q   +    +    LP L + + +D H   + C      L+ F+  +LL    +   WF  +   IR G Q                              T ++ E  +EM    +  S     +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y      +  S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT NL++NI G LPI C+ QLL  RSF+K+KV I +WIYRQ+C +  P+HP+L  LI  Y+ S+L   SK++    N P++E  I+ +F   + G
Sbjct:   83 VDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIMNKVSECNGEFF-FKSSELFESAVYLEEAADVLCILQAELPSLLPIVDVAEALLRVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRTDALRFLCRM-------NPSQALKVRGMVVEECHLPGLGVALTLD-HTKTEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTF---IRNGQQRKRETSGSVLWQMRRQLLLELMGILPTVRSTRIVEEADVEMEPTVSVYSGL--KEEHVVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQ-----EQLMVLWL-SWMIKEEAYFESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNLFQEVIGG 627          
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q5ZKU4|INT2_CHICK (Integrator complex subunit 2 OS=Gallus gallus OX=9031 GN=INTS2 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.078e-53
Identity = 151/565 (26.73%), Postives = 260/565 (46.02%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMKFQFICN-------EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANK-----IQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAID-----MHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGSQ------------------------LTLVISEKLIEMAKNFNSISCKCSS---KEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQN---SYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLL-PTESKNSQG-NDPISEATIIEMFDTNVLGH 1774
            V +H +  D +K QQ +     G  +   +         EF+ S +P ++  ++L E+  +++ V  S    F    SEL  +  +  E   V+ +L  + PSL     + +  ++ + G   +  L  N P  +  +C  LI+   +     + G        E + H+ K     NP Q   +    +    LP L + + +D       + G   L+ F+  +LL    +   WF  +   IR G Q                        L  V S  ++E A      +    S   +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++ Y + +     S+ E+LLL A+++H+ QL+ I  ++ S  G K+     S++  + +FT ++FTEQ++T+HAV+VPVT +L++NI G LPI C+ QLL  RSF+K+KV I +WIYRQ+C +  P+HP+L  LI  Y+ S+L P    N +  N P++E  I+ +F     G 
Sbjct:   82 VDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSP-RRLRLVLSELLAIMNKVSESNGEFF-LKSSELFESPVYLEEAADVLCILQAELPSLLPIVDVAEALLHVKNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESVGGRRRT----EALRHLCK----MNPSQALRVRGMVVEECHLPGLGVALTLDHTKNESSDDGVSDLVCFVSGLLLGTNAKVRTWFGTF---IRNGQQRKRDNISSVLWQMRRQLLLELMGILPTVRSTHIVEEADVDTEPNVSVYSGLKEEHVVKASALLRLYCALMGIAGLKPTDEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQ-----EQLMVMWL-SWMIKEEAYFESISGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTGSLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETTTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNVFQGLTGGE 627          
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q9VX31|INT2_DROME (Integrator complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=IntS2 PE=1 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 2.998e-50
Identity = 133/484 (27.48%), Postives = 240/484 (49.59%), Query Frame = 2
Query:  350 KKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAI--RTGSQLTLVISE---KLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQNSYS--ELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLL---PTESKN-SQGNDPISEATIIEMFDTNVL 1768
            +K  ++L EI  L   V   KP     + SE+L++  +  E+  ++ + + + PSL +   +    ++   G  +I +L  NFP  +  + + +I   ++      H       L ++  +   NP Q  +    C+    +P  +L + +         L+ FL  +LL        WF  Y+++   R G  L LV  E   K+I+   N   +      ++  ++  +LL++   L+     +F+ +    L +L+T     T   V F+  ++  +IA  S        +  ++    +WL+ LI +   + K+   S S  E+LLL A+ +H+ Q++ IS+++ S    K+     S N  +++FT D+FTEQ++  HAV+VPVT NLN  I  +LP+ C+ QLL  R+F K+KV I +WI++QIC+S+ P+HP +P L++ +V +L+   PT   N    + P +EA I+ +F T+ L
Sbjct:  126 RKVRVVLSEIFNLQQQVSEQKPA----AHSEMLDDGIYLEEVVDILCIALAELPSLLNILELTDALVHVPNGHRIICALVANFPDCYRDVVSHVIANCDEDGSDGKHR------LMLLMGLSEMNPSQALANRSMCVDMLKVPSFMLKLTLKHPED----LIAFLTGLLLGNDQNLRSWFAAYIRSSQKRKGDALNLVRVELLQKVIQTTTNAAEL------RDFNLQGAVLLRLYCALRGIGGLKFNDDEINALSQLVTSCPQATPSGVRFVTLALCMLIACPSLV-----STIPLENKAVEWLQWLIREDAFFCKRPGTSTSLGEMLLLLAIHFHSNQISAISEMVCSTLAMKIPIRPNSTNRIKQLFTQDLFTEQVVALHAVRVPVTPNLNGTILCYLPVHCIQQLLKSRTFLKHKVPIKSWIFKQICSSVRPVHPVMPALVEVFVNTLIIPNPTGKVNIDHMHRPFTEAEILHVFRTSKL 584          
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q55CB6|INT2_DICDI (Integrator complex subunit 2 homolog OS=Dictyostelium discoideum OX=44689 GN=ints2 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.453e-14
Identity = 41/119 (34.45%), Postives = 72/119 (60.50%), Query Frame = 2
Query: 1307 ELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLI 1663
            ELLLL ++++HT QL  I+ ++ +I GF+     +S+N   ++ T +++TE ++   A ++P+ + LN+N   ++ I CV  LL+ R F K +  + NW + Q+  S  PIH  LP L+
Sbjct:  452 ELLLLISIYFHTHQLQNIALLVKNILGFRPSIHTESLNQIGEILTKEIYTESLVAKRAQQLPIIEKLNTN-HQNISIVCVYHLLSERIFEKYETDVGNWCWSQLTKSSTPIHYLLPSLL 569          
BLAST of Integrator complex subunit 2 vs. TrEMBL
Match: A0A0X3PEG7 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR104377 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 7.341e-69
Identity = 192/636 (30.19%), Postives = 319/636 (50.16%), Query Frame = 2
Query:   44 FQKTINNDFSDISYEEILEVFPLLYYTVEDVDEFILNLPLTDF--------QACKIVSLCN-----LFEEYSTRVPYHQIFADIAKYQQSKKSNNVG--DMKFQFICNEFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGF-MYCEKGLE-LISSLTLNFPHKWYIICTSLIE--------------------AANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIR-TGSQLTLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNF-------YFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQ--------NSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLP-TESKNSQGNDPISEATIIEMFDTNVLGHPMTAC 1789
            +    N D   I    I ++ PLLY+TV D++  IL+  ++D+        Q   + SLC+     L++E             +++Y   +K +++G  + +  ++C++F+   + E K  +++ ++  LL  +E             +L + T  S++   I  LI+        S I+ G   +C      LI  L LNFPH W  +   L+E                    AA+K +            L  ++    F P+  Y IL+HCIS   LP+ +L +A+ +H S    LL F +RI  DEG +T +WF  YLK +  T   L + ++ +L+ +  + +S S     K+ L+ A   L++++ L+ F ++  +PE+   +++LI +   I + AV+FI +++AF + MRS F       +  D+ S   +  L  WL  L+ +QD  +  L+        NSYS+LLLL AL +HT Q + I +++  + G     + ++I+  RK+FT  VFTEQ++ + A  VPVT +LN+++AGHLPI CV QLL   +F+KN+V+I  WIYRQIC S+ P+HP LP L++ YV S L  T       + P +E+ ++  F   V G     C
Sbjct:   11 YHAAANLDLDSIDEIAISDIIPLLYFTVADIELLILDK-ISDYYLLQKSTEQIQLLDSLCSTNFELLWKE------------GLSEY---RKRSHLGHSNTRNPYVCSDFELQTSAEAKLKLVVQQLCHLL--LEPCTSDCLIRRCCSILESPTLISQVVSCIVALIYALSQPSFLSDIICGLSAHCSHAARGLIRLLLLNFPHFWPAVWKRLLEVSVSADQQNQPISVTSSEGLAASKARSSPLRDCRASRALATLRYATTFMPQTEY-ILDHCISLHCLPDFLLQLALSLHQSEGNDLLGFFRRIFFDEGRDTCEWFGNYLKTLSDTDPSLAIEVNSRLLSIGLSLSSDSKTAIPKDKLILALEFLRVVAALRGFADFPLTPEIRQSILQLIIRPTSINERAVNFICYALAFSVGMRSCFMDSNTAPFSVDNSSIESEEHLVTWLHRLLNRQDVIHAALRPSSSGAAPNSYSQLLLLLALLFHTNQQSAIRELVADVLGVDAPCLARNISASRKLFTQKVFTEQLIAAQAAHVPVTVSLNAHMAGHLPIHCVHQLLRSHTFNKNRVQIKGWIYRQICESVRPLHPLLPELVEAYVASCLNFTPRAGVAISLPFTESELLHQFSAPVAGPAACIC 627          
BLAST of Integrator complex subunit 2 vs. TrEMBL
Match: A0A0X3P3D8 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR104377 PE=4 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 7.868e-69
Identity = 192/636 (30.19%), Postives = 319/636 (50.16%), Query Frame = 2
Query:   44 FQKTINNDFSDISYEEILEVFPLLYYTVEDVDEFILNLPLTDF--------QACKIVSLCN-----LFEEYSTRVPYHQIFADIAKYQQSKKSNNVG--DMKFQFICNEFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGF-MYCEKGLE-LISSLTLNFPHKWYIICTSLIE--------------------AANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIR-TGSQLTLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNF-------YFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQ--------NSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLP-TESKNSQGNDPISEATIIEMFDTNVLGHPMTAC 1789
            +    N D   I    I ++ PLLY+TV D++  IL+  ++D+        Q   + SLC+     L++E             +++Y   +K +++G  + +  ++C++F+   + E K  +++ ++  LL  +E             +L + T  S++   I  LI+        S I+ G   +C      LI  L LNFPH W  +   L+E                    AA+K +            L  ++    F P+  Y IL+HCIS   LP+ +L +A+ +H S    LL F +RI  DEG +T +WF  YLK +  T   L + ++ +L+ +  + +S S     K+ L+ A   L++++ L+ F ++  +PE+   +++LI +   I + AV+FI +++AF + MRS F       +  D+ S   +  L  WL  L+ +QD  +  L+        NSYS+LLLL AL +HT Q + I +++  + G     + ++I+  RK+FT  VFTEQ++ + A  VPVT +LN+++AGHLPI CV QLL   +F+KN+V+I  WIYRQIC S+ P+HP LP L++ YV S L  T       + P +E+ ++  F   V G     C
Sbjct:   11 YHAAANLDLDSIDEIAISDIIPLLYFTVADIELLILDK-ISDYYLLQKSTEQIQLLDSLCSTNFELLWKE------------GLSEY---RKRSHLGHSNTRNPYVCSDFELQTSAEAKLKLVVQQLCHLL--LEPCTSDCLIRRCCSILESPTLISQVVSCIVALIYALSQPSFLSDIICGLSAHCSHAARGLIRLLLLNFPHFWPAVWKRLLEVSVSADQQNQPISVTSSEGLAASKARSSPLRDCRASRALATLRYATTFMPQTEY-ILDHCISLHCLPDFLLQLALSLHQSEGNDLLGFFRRIFFDEGRDTCEWFGNYLKTLSDTDPSLAIEVNSRLLSIGLSLSSDSKTAIPKDKLILALEFLRVVAALRGFADFPLTPEIRQSILQLIIRPTSINERAVNFICYALAFSVGMRSCFMDSNTAPFSVDNSSIESEEHLVTWLHRLLNRQDVIHAALRPSSSGAAPNSYSQLLLLLALLFHTNQQSAIRELVADVLGVDAPCLARNISASRKLFTQKVFTEQLIAAQAAHVPVTVSLNAHMAGHLPIHCVHQLLRSHTFNKNRVQIKGWIYRQICESVRPLHPLLPELVEAYVASCLNFTPRAGVAISLPFTESELLHQFSAPVAGPAACIC 627          
BLAST of Integrator complex subunit 2 vs. TrEMBL
Match: A0A194PKL3 (Integrator complex subunit 2 OS=Papilio xuthus OX=66420 GN=RR46_13032 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 1.502e-64
Identity = 160/557 (28.73%), Postives = 278/557 (49.91%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMK-------FQFICNEFDSSLNPEKKFTIILYEI----SELLDLVENSKPYT-FEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLK-----AIRTGSQLTLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNSQG--NDPISEATIIEMFDTNVLGHPMTACYKMSDNVHIDNNMS 1831
            + +H +  D+ K QQ ++ +     +          I N+F+ S +  ++  ++L EI    +++++  +N           SEL +N  +  EI  VI + + + P+L + S IV+  ++  KG  ++S +  N P   Y +  SLI   N  +G    I+    +     S+    P    ++    +S   LP LVLN+ +  H      L+ F+  +LL     T  WF  +L+         GS   + + ++L++  K+ ++           V+A  LL++   L+     +F  +  + L+ L+T+  P T   V F+  S+  ++A  S     DH    ++ V  +WL    +K++ Y   N  +  S+ E+LLL A+ +H+ QL  + +++ +  G +V      +   ++ FT ++FTEQ++T+HAVKVPVT NLN NI G+LP+ C+ QLL  R+FSK+KV I NWIY+QICN  AP+HP +P L++ YV+S+L   +K +    N PI+E  I ++F  ++ G       K    + IDN  S
Sbjct:   81 IEFHTLEVDLKKEQQMRQKSGTQTTESFLIPNPVNGISNDFEQS-DSARRVRLVLSEILQMQAQIVEYQQNKHANNDCSVKPSELFDNDVYLEEITDVICISLAELPNLLNISDIVEVLLHVNKGPVIVSWIVANMPDTLYEVAESLI--VNAERGEEGGIRAKALM-----SLCAMCPYLSATVRAKAVSASRLPALVLNLTLTHHQDD---LVSFMSGLLLGSDQSTRGWFATFLRNSHKRGKGDGSAALIKLRQELLKRLKDASAG----------VEASALLRLYCALRGIAGIKFQDDEVSGLLRLVTQKPPPTPAGVRFVSLSLCMILACPSLMTATDHEKKAIEWV--QWL----VKEEAYFESNSGVTASFGEMLLLIAIHFHSGQLAAVGELVCATLGMRVPVRPNGLARIKQAFTQEIFTEQVVTAHAVKVPVTANLNGNIPGYLPVHCIHQLLKSRAFSKHKVPIKNWIYKQICNCTAPLHPVMPALVEVYVSSILVINNKGNSEYVNKPITEEEIRKVFRNSIFGVNFDQQNKGFSPMEIDNGES 610          
BLAST of Integrator complex subunit 2 vs. TrEMBL
Match: A0A194RCI7 (Integrator complex subunit 2 OS=Papilio machaon OX=76193 GN=RR48_09211 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 1.999e-63
Identity = 158/557 (28.37%), Postives = 278/557 (49.91%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQSKKSNNVGDMK-------FQFICNEFDSSLNPEKKFTIILYEI----SELLDLVENSKPYT-FEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLK-----AIRTGSQLTLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNSQG--NDPISEATIIEMFDTNVLGHPMTACYKMSDNVHIDNNMS 1831
            + +H +  D+ K QQ ++ +     +          I N+F+ S +  ++  ++L EI    +++++  +N           SEL +N  +  EI  VI + + + P+L + S IV+  ++  KG  ++S +  N P   Y +  SL+   N  +G    I+    +     S+    P    ++    +S   LP LVLN+ +  H      L+ F+  +LL     T  WF  +L+         G+   + + ++L++  K+ ++           V+A  LL++   L+     +F  +  + L+ L+T+  P T   V F+  S+  ++A  S     DH    ++ V  +WL    +K++ Y   N  +  S+ E+LLL A+ +H+ QL  + +++ +  G +V      +   ++ FT ++FTEQ++T+HAVKVPVT NLN NI G+LP+ C+ QLL  R+FSK+KV I NWIY+QICN  AP+HP +P L++ YV+S+L   +K +    N PI+E  I ++F  ++ G       K    + IDN  S
Sbjct:   81 IEFHTLEVDLKKEQQIRQKSGTQTTESFLIPNPVNGISNDFEQS-DSARRVRLVLSEILQMQAQIVEYQQNRHTNNDCSVKPSELFDNDVYLEEITDVICISLAELPNLLNISDIVEVLLHVNKGPVIVSWVVANMPDTLYEVAESLV--VNAERGEEGGIRAKALM-----SLCAMCPYLSATVRAKAVSASRLPALVLNLTLTHHQDD---LVSFMSGLLLGSDQSTRGWFATFLRNSHKRGKGDGNAALIKLRQELLKRLKDASAG----------VEASALLRLYCALRGIAGIKFQDDEVSGLLRLVTQKPPPTPAGVRFVSLSLCMILACPSLMTAADHEKKAIEWV--QWL----VKEEAYFESNSGVTASFGEMLLLIAIHFHSGQLAAVGELVCATLGMRVPVRPNGLARIKQAFTQEIFTEQVVTAHAVKVPVTANLNGNIPGYLPVHCIHQLLKSRAFSKHKVPIKNWIYKQICNCTAPLHPVMPALVEVYVSSILVINNKGNSEYVNKPITEEEIRKVFRNSIFGVNFDQQNKGFSPMEIDNGES 610          
BLAST of Integrator complex subunit 2 vs. TrEMBL
Match: W6UC10 (Integrator complex subunit 2 OS=Echinococcus granulosus OX=6210 GN=EGR_07011 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 3.845e-63
Identity = 187/625 (29.92%), Postives = 304/625 (48.64%), Query Frame = 2
Query:   35 MLLFQKTINNDFSDISYEEILEVFPLLYYTVEDVDEFIL--------------------NLPLTDFQACKIVSLCNLFEEYSTRVPYHQIFADIAKYQQSKKSNNVGDMKFQFICNEFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGF-MYCEKGLEL-ISSLTLNFPHKWYIICTSLIEAANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQ-LCLLDFLKRILLDEGVETNQWFTQYLK-AIRTGSQLTLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFY-----FDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQ--NSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTES---KNSQ------GNDPISEATIIEMFDTNVLGHPMTAC 1789
            M L    I+++FS      ++ +FP +Y+TVE++D FI+                    +L + D +     SL +  +  +T+VP     + +  Y   +  N+V + K + +  + +  L+ +       Y    LL+                LL+ +T    I   + + +H+   L D   ++ G  ++C     L I  L LNFP KWY I   L+   + ++G + H +     L ++  +  F P  +  +L  CI  R LP LV+ +AI   N+G+   L++F KR+LLD+G +T  WF +YLK A  T   L   ++EK++         S     KE L+ A   L+ ++ L   T +  S +L + ++ LIT     ++ AV+FI F +AF+I +RS  +      ++  S   +  L  WLR LI +QD ++  L+  +SYSE+LLLF L ++      I  II +          ++I+  RK+F   VFT Q + + A  VPVT  LN++I G+LPI CV QLL   +F+KN+V+I  WIYRQIC S+ P+HP +  L++ YVT+ L T++    +SQ      G  P +EA +   F     G     C
Sbjct:    1 MDLHAYRIDDEFS------LVAIFPRVYFTVENLDSFIVEKFKEPSLLMTVVELLHVLDSLAVVDIKKVWETSLLDTLKRVTTQVPLR---SRVYTYNDFEAHNSV-ESKVKLVAQQLEHVLHEDADEQCESYRCCSLLE-------------SPTLLDTIT---AITSAVLLGLHNTDILPD---VIAGLSIHCALNSRLLIERLVLNFPEKWYDIYECLLGRISILKGNSDH-KGSARCLAVLHHLSTFVP-DMNGLLNKCIQLRQLPSLVIQLAIKQSNTGENFSLINFFKRVLLDQGRKTQSWFGEYLKSAWETNPTLIADVNEKILSAISGILDDSKAVLPKEQLLPALEFLRTIAALCGHTGFVLSSKLRSFVLHLITHPTGRSEKAVNFICFCLAFIIGLRSCLFDNSVGLNEASSGETEEQLVVWLRRLISRQDIFHTSLRQSSSYSEVLLLFGLLFNDSHPTTIRDIIVNTLDIDAPCFVRNISASRKLFAQKVFTCQSIAAQAAHVPVTACLNAHITGNLPIHCVFQLLKNHAFNKNRVQIKGWIYRQICASVRPLHPLMLELLEIYVTNAL-TQTVGLASSQMIGACGGCVPFTEAELFVQFSDPAFGPDARMC 593          
BLAST of Integrator complex subunit 2 vs. Ensembl Nematostella
Match: EDO44556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVD7])

HSP 1 Score: 160.229 bits (404), Expect = 3.015e-41
Identity = 115/476 (24.16%), Postives = 223/476 (46.85%), Query Frame = 2
Query:  323 EFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAA-----NKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMH--NSGQLCLLDFLKRILLDEGVETNQWFTQYLK-AIRTGSQLTLVISEKLIEMAKNF---------------NSISCKCS----SKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQ--LQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLI 1663
            EF+ S  P ++  +IL E+  ++  V+      F   KSEL     +  E+  V+ +   + PSL    ++ +  +  + G  L+  L  N P  +  +C SL+E       + + G+   I L        + +   +P    ++         LP L + + +D    +SG   L+ FL  I+    +++  WF++++K   R   +L + + E      ++                N +   C     ++E ++    LLK+  GLK     + +   S  L+ LIT   P +   V F+   +  ++A        ++    ++     W++ L  ++  Y     +  S+ E+LLL ++ +H  QL  ++++++SI G +V+    S++  + +FT ++F E+++ +HAV VPVT  L++N  G LPI CV QLL  R+F+K+ V + +W+Y+Q+C  + P+H  +P L+
Sbjct:  108 EFERS-EPSRRLRLILSELLRIMSKVKKE----FLPEKSELFECEIYLEEVSDVLCIAQAELPSLLPLEQVAEALLRVKYGPWLLCRLVANVPDNFEQVCHSLLENGESQDDSALGGMVRTIAL--------RQLCAMDPSHALTMRAKATRLCRLPGLAIALTLDFGADDSGSD-LVAFLSGIMFGGDLKSRTWFSEFIKIGQRVCHELRVCVFEGFSRQKQHLKPTGRLTHVYYKALVNKLPFLCMFFVIAEEKVLYGSALLKLYCGLKNIAGMKLTRPESDSLLSLITCHPPPSAAGVRFVVVGLCTLLACPHIVSTPENEQAAIN-----WIKWLSKEESHYEAASGMHASFGEVLLLISIHFHGNQLESVAELVSSILGMRVRP--GSLSRMKALFTQELFPEKVVAAHAVTVPVTPQLSANDTGFLPIHCVHQLLKTRAFTKHSVAVKDWVYKQLCTCVTPLHSLIPGLV 562          
BLAST of Integrator complex subunit 2 vs. Ensembl Medaka
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:101173965])

HSP 1 Score: 195.282 bits (495), Expect = 1.761e-52
Identity = 150/559 (26.83%), Postives = 260/559 (46.51%), Query Frame = 2
Query:  227 VPYHQIFADIAKYQQ----SKKSNNVGDMKFQF---ICNEFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANK-----IQGLNYHIQLPEFILHIIKSVLNFNPKQIYSI----LEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGSQLTLVISEKLIEMAK-------------------NFNSISCKCSS------KEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEY---NKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLL-PTESKNSQG-NDPISEATIIEMFDTNV 1765
            V +H +  D  K QQ    +  SN    +  Q    +  EF+ S +P ++  + L E+  +++ V +S    F    SEL  +  +  E+  V+ +L  + PSL     + +  ++   G   +  L  N P  +  +C  LI+   +     + G              ++ +   NP Q  +I    +E C    L   L L+   D  +     L+ ++  +LL    +   WF+ +   IR G Q     S  L +M +                   N   +  + +S      +E +VKA  LL++   L      + + E +  L++L+T   P T   V F+  S   ++A  +     +      + ++  WL   +IK++EY      +  S+ E+LLL A+++H+ QL+ I +++ S  G K+     S++  + +FT ++FTEQ++T+HAV+V VT NL++NI G LPI C+ QLL  RSF+K+KV I +WIY Q+C +  PIH +L  LI  Y+ S+L P    N +  N PI+E  I+ +F ++ 
Sbjct:   82 VDFHALEQDARKEQQLRHKAGGSNGESILVSQLQHGLTLEFEHS-DPLRRLRLTLSELLAIMNKVADSNGEFF-LKSSELFESPVYLEEVADVLCILQAELPSLLPIVDVAEALLHVRNGDWFLCLLVANVPDSFNEVCRGLIKNGERQDEESVGGRRRT--------EALRQLCQMNPSQALNIRAMVVEECHLPGLGVALTLDYKPDTPDEAVSPLVSYVSGLLLGTNSKVRTWFSMF---IRNGQQRKRESSSVLWQMRRQLLLELVAILPRSRSTRLPNDGGMEDEAASGYSGLREEHVVKASALLRLYCALVGIAGLRPTDEEAEQLLQLMTSRPPATPAGVRFVSLSFCKLLAFPTLVSTPEQ-----EQLMVIWL-SWMIKEEEYFESAAGVSASFGEMLLLVAMYFHSNQLSSIIELVCSTLGMKIAIKASSLSKMKTIFTQEIFTEQVVTAHAVRVAVTNNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYHQLCETTTPIHTQLIPLIDAYINSILTPASKANPEATNQPITEQEILSVFQSSA 621          
BLAST of Integrator complex subunit 2 vs. Planmine SMEST
Match: SMESG000061179.1 (SMESG000061179.1)

HSP 1 Score: 1217.99 bits (3150), Expect = 0.000e+0
Identity = 598/599 (99.83%), Postives = 599/599 (100.00%), Query Frame = 2
Query:   35 MLLFQKTINNDFSDISYEEILEVFPLLYYTVEDVDEFILNLPLTDFQACKIVSLCNLFEEYSTRVPYHQIFADIAKYQQSKKSNNVGDMKFQFICNEFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGSQLTLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNSQGNDPISEATIIEMFDTNVLGHPMTACYKMSDNVHIDNNMS 1831
            MLLFQKTINNDFSDISYEEILEVFPLLYYTVE+VDEFILNLPLTDFQACKIVSLCNLFEEYSTRVPYHQIFADIAKYQQSKKSNNVGDMKFQFICNEFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGSQLTLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNSQGNDPISEATIIEMFDTNVLGHPMTACYKMSDNVHIDNNMS
Sbjct:    1 MLLFQKTINNDFSDISYEEILEVFPLLYYTVENVDEFILNLPLTDFQACKIVSLCNLFEEYSTRVPYHQIFADIAKYQQSKKSNNVGDMKFQFICNEFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLNNLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFPHKWYIICTSLIEAANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILEHCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYLKAIRTGSQLTLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGLKIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYFDDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQNSYSELLLLFALFYHTKQLNEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTKNLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKLPLLIQTYVTSLLPTESKNSQGNDPISEATIIEMFDTNVLGHPMTACYKMSDNVHIDNNMS 599          
The following BLAST results are available for this feature:
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
INTS28.804e-5726.37integrator complex subunit 2 [Source:HGNC Symbol;A... [more]
INTS28.804e-5726.37integrator complex subunit 2 [Source:HGNC Symbol;A... [more]
INTS21.103e-5626.37integrator complex subunit 2 [Source:HGNC Symbol;A... [more]
INTS21.103e-5626.37integrator complex subunit 2 [Source:HGNC Symbol;A... [more]
INTS25.917e-721.34integrator complex subunit 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
IntS22.991e-5127.48gene:FBgn0030858 transcript:FBtr0074480[more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ints25.402e-5326.92integrator complex subunit 2 [Source:ZFIN;Acc:ZDB-... [more]
ints27.898e-4025.49integrator complex subunit 2 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ints21.068e-4626.13integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
ints21.203e-4626.13integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
ints22.237e-4626.09integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
ints22.466e-4626.09integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
ints21.781e-4024.41integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ints28.990e-5626.50integrator complex subunit 2 [Source:MGI Symbol;Ac... [more]
Ints28.990e-5626.50integrator complex subunit 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H0H0|INT2_HUMAN5.296e-5626.37Integrator complex subunit 2 OS=Homo sapiens OX=96... [more]
sp|Q80UK8|INT2_MOUSE6.289e-5526.50Integrator complex subunit 2 OS=Mus musculus OX=10... [more]
sp|Q5ZKU4|INT2_CHICK2.078e-5326.73Integrator complex subunit 2 OS=Gallus gallus OX=9... [more]
sp|Q9VX31|INT2_DROME2.998e-5027.48Integrator complex subunit 2 OS=Drosophila melanog... [more]
sp|Q55CB6|INT2_DICDI1.453e-1434.45Integrator complex subunit 2 homolog OS=Dictyostel... [more]
back to top
BLAST of Integrator complex subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PEG77.341e-6930.19Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0X3P3D87.868e-6930.19Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A194PKL31.502e-6428.73Integrator complex subunit 2 OS=Papilio xuthus OX=... [more]
A0A194RCI71.999e-6328.37Integrator complex subunit 2 OS=Papilio machaon OX... [more]
W6UC103.845e-6329.92Integrator complex subunit 2 OS=Echinococcus granu... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445563.015e-4124.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ints21.761e-5226.83integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061179.10.000e+099.83SMESG000061179.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004424 ID=SMED30004424|Name=Integrator complex subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1833bp
TTTGAATATTTTAAATCAAAATTTAATTAAACTAATGTTACTCTTTCAAA
AAACCATAAATAATGATTTTTCTGATATTTCATATGAAGAAATATTAGAA
GTTTTTCCGTTACTTTATTATACAGTTGAGGATGTTGACGAATTTATTTT
AAATTTACCATTAACTGATTTTCAAGCTTGTAAAATTGTCAGTTTGTGTA
ATTTATTTGAAGAATATTCAACTAGAGTTCCATATCATCAGATTTTTGCT
GACATTGCTAAATATCAGCAGTCTAAGAAATCTAATAATGTAGGTGACAT
GAAATTTCAATTCATTTGTAATGAATTTGATAGTTCCCTCAATCCAGAAA
AAAAGTTTACTATTATTCTTTACGAAATATCTGAATTGCTGGATCTAGTC
GAAAACTCCAAGCCTTATACTTTTGAATTTTCTAAGAGTGAATTATTAAA
CAACCTAACTTTTCATTCAGAAATCAAATTAGTCATTTATGTTCTAATAC
ATGACTTTCCATCATTATGGGATTTTTCACGAATTGTAAAAGGTTTTATG
TATTGTGAAAAAGGTTTGGAGTTGATTAGCAGTTTAACACTGAACTTTCC
ACACAAGTGGTATATAATCTGTACATCATTAATTGAAGCTGCAAACAAAA
TCCAAGGATTAAATTATCATATTCAATTGCCGGAATTTATTTTGCATATA
ATAAAGTCGGTTTTAAATTTTAATCCGAAACAAATCTATTCGATTCTTGA
GCATTGCATCTCAAATCGATTGTTACCGGAACTCGTATTGAATATCGCAA
TTGACATGCACAACAGCGGTCAGCTGTGTTTATTGGATTTCCTAAAACGT
ATTTTGCTCGACGAGGGAGTAGAAACCAATCAATGGTTCACTCAGTATTT
GAAAGCAATAAGAACCGGATCCCAGTTAACATTGGTAATCAGTGAAAAAC
TGATTGAAATGGCGAAGAATTTCAACTCCATTTCGTGTAAATGTTCCTCA
AAAGAAATGTTGGTTAAAGCCCAATTGCTGCTTAAAATGTTGTCAGGGTT
GAAAATTTTCACTAATTATCAATTCAGCCCAGAATTATCCACTCTATTGA
TAGAGTTGATAACTAAAAGCTTGCCAATAACAAAAATTGCCGTTGACTTC
ATCCAATTCTCAATAGCCTTTGTAATAGCTATGAGATCAAACTTTTACTT
TGACGACCATCATAGCTGTAATGTCGATGCCGTTCTTACTAAGTGGCTGC
GTGATCTGATTATTAAACAAGACGAATACAACAAACAATTGCAAAATTCG
TACAGTGAATTGTTGCTATTGTTTGCTTTATTCTATCACACGAAGCAACT
TAATGAGATCTCAAAAATTATAACATCAATATTTGGCTTCAAGGTCCAGG
ATATCCAGCAATCGATAAACATGTTCCGAAAGGTGTTCACACATGATGTG
TTTACAGAGCAGATACTCACAAGTCACGCAGTTAAGGTGCCGGTGACGAA
AAATCTCAATAGCAACATCGCTGGGCATCTTCCGATTGATTGTGTTTTGC
AATTGCTGAATTTGCGATCGTTTTCGAAAAATAAAGTGAAAATCGATAAT
TGGATCTATCGACAAATTTGTAACAGCATCGCACCGATCCATCCGAAATT
GCCGCTATTGATTCAGACTTATGTTACCAGTCTGTTGCCGACAGAATCGA
AGAACAGCCAAGGAAACGACCCGATTTCAGAGGCGACAATAATAGAAATG
TTCGATACGAATGTGCTCGGTCATCCGATGACAGCATGCTATAAGATGTC
AGATAATGTGCATATTGATAATAACATGTCCAT
back to top

protein sequence of SMED30004424-orf-1

>SMED30004424-orf-1 ID=SMED30004424-orf-1|Name=SMED30004424-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=610bp
LNILNQNLIKLMLLFQKTINNDFSDISYEEILEVFPLLYYTVEDVDEFIL
NLPLTDFQACKIVSLCNLFEEYSTRVPYHQIFADIAKYQQSKKSNNVGDM
KFQFICNEFDSSLNPEKKFTIILYEISELLDLVENSKPYTFEFSKSELLN
NLTFHSEIKLVIYVLIHDFPSLWDFSRIVKGFMYCEKGLELISSLTLNFP
HKWYIICTSLIEAANKIQGLNYHIQLPEFILHIIKSVLNFNPKQIYSILE
HCISNRLLPELVLNIAIDMHNSGQLCLLDFLKRILLDEGVETNQWFTQYL
KAIRTGSQLTLVISEKLIEMAKNFNSISCKCSSKEMLVKAQLLLKMLSGL
KIFTNYQFSPELSTLLIELITKSLPITKIAVDFIQFSIAFVIAMRSNFYF
DDHHSCNVDAVLTKWLRDLIIKQDEYNKQLQNSYSELLLLFALFYHTKQL
NEISKIITSIFGFKVQDIQQSINMFRKVFTHDVFTEQILTSHAVKVPVTK
NLNSNIAGHLPIDCVLQLLNLRSFSKNKVKIDNWIYRQICNSIAPIHPKL
PLLIQTYVTSLLPTESKNSQGNDPISEATIIEMFDTNVLGHPMTACYKMS
DNVHIDNNMS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR026236Int2_metazoa
IPR029321INTS2
Vocabulary: biological process
TermDefinition
GO:0016180snRNA processing
Vocabulary: cellular component
TermDefinition
GO:0032039integrator complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026236Integrator complex subunit 2, metazoaPRINTSPR02105INTSUBUNIT2coord: 478..503
score: 61.97
coord: 512..532
score: 50.62
coord: 435..461
score: 36.76
IPR029321Integrator complex subunit 2PFAMPF14750INTS2coord: 89..588
e-value: 6.9E-93
score: 312.0
IPR029321Integrator complex subunit 2PANTHERPTHR28608FAMILY NOT NAMEDcoord: 116..589