Dimer_Tnp_hAT domain-containing protein

Overview
NameDimer_Tnp_hAT domain-containing protein
Smed IDSMED30004402
Length (bp)1679
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dimer_Tnp_hAT domain-containing protein (SMED30004402) t-SNE clustered cells

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30004402) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dimer_Tnp_hAT domain-containing protein (SMED30004402) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30004402) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004402

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004402 dd_Smed_v4_14487_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004402 dd_Smed_v4_14487_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004402 dd_Smed_v4_14487_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Match: MED25 (mediator complex subunit 25 [Source:HGNC Symbol;Acc:HGNC:28845])

HSP 1 Score: 54.299 bits (129), Expect = 5.297e-7
Identity = 26/71 (36.62%), Postives = 39/71 (54.93%), Query Frame = 2
Query: 1223 IVSRRGIVTKKRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYV 1417
            +  R  +   KR+ E E R F+ +WE   FF+++K      IC+  +S  K +N+KRHYE KH +  D Y 
Sbjct:  708 LPPRAPLPAAKRKREGEGRVFREKWERAYFFVEVKSMPMCLICKQIVSVLKEYNLKRHYESKHSKSYDQYT 778          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 52.7582 bits (125), Expect = 1.916e-6
Identity = 29/76 (38.16%), Postives = 44/76 (57.89%), Query Frame = 2
Query: 1253 KRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYVG-*RKVKLQLLKANL 1459
            KR+I+ E R FQ +WE   FF++++      IC+ S+S  K +N++RHY+  H +  D Y+   R  KL  LK  L
Sbjct:  580 KRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYMERMRDEKLHELKKGL 655          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 52.373 bits (124), Expect = 2.438e-6
Identity = 29/76 (38.16%), Postives = 43/76 (56.58%), Query Frame = 2
Query: 1253 KRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYVG-*RKVKLQLLKANL 1459
            KR+I+ E R FQ +WE   FF++++      IC+ S+S  K +N++RHY+  H +  D Y    R  KL  LK  L
Sbjct:  585 KRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYTERMRDEKLHELKKGL 660          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.515e-10
Identity = 41/121 (33.88%), Postives = 62/121 (51.24%), Query Frame = 2
Query: 1226 VSRRGIVTKKRRIEDENRTFQSEWEDL*FFIQ------IKICRDSISTFKLHNIKRHYEQKHGEIEDIYVG---*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NP 1561
            ++  G  T KR+ EDE RTF SEWEDL FF++        IC+ S+S FK  N++RH+   H  +   +      RK K++ LK     Q  +F K +  +  +  AS ++ + IA    P
Sbjct:    1 MAESGKRTAKRKYEDERRTFLSEWEDLYFFVERNGKPFCLICQTSLSHFKASNLERHFTSLHSAVAREFPKGSELRKHKVKTLKGQAEKQTQLFRKFSKHSETVTLASYQLAWNIARAKKP 121          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 69.3218 bits (168), Expect = 8.362e-12
Identity = 42/116 (36.21%), Postives = 61/116 (52.59%), Query Frame = 2
Query: 1244 VTKKRRIEDENRTFQSEWEDL*FF------IQIKICRDSISTFKLHNIKRHYEQKHGEIEDIYVG*RKVK-LQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLST 1570
              KKR+I+ ENR FQ +WE+  FF       Q  +C  +IS+ K +N+KRHY   HG     Y G  ++  ++ LK+ L  Q+NIF     T  A + AS  +  +IA    P S+
Sbjct:   14 CAKKRKIDSENREFQEKWEEEYFFGKNKDKPQCLVCAQTISSCKEYNVKRHYTTLHGAKYAKYTGEARLTIIKDLKSKLCKQKNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFSS 129          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 8.473e-12
Identity = 42/116 (36.21%), Postives = 61/116 (52.59%), Query Frame = 2
Query: 1244 VTKKRRIEDENRTFQSEWEDL*FF------IQIKICRDSISTFKLHNIKRHYEQKHGEIEDIYVG*RKVK-LQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLST 1570
              KKR+I+ ENR FQ +WE+  FF       Q  +C  +IS+ K +N+KRHY   HG     Y G  ++  ++ LK+ L  Q+NIF     T  A + AS  +  +IA    P S+
Sbjct:   14 CAKKRKIDSENREFQEKWEEEYFFGKNKDKPQCLVCAQTISSCKEYNVKRHYTTLHGAKYAKYTGEARLTIIKDLKSKLCKQKNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFSS 129          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Match: Med25 (mediator complex subunit 25 [Source:MGI Symbol;Acc:MGI:1922863])

HSP 1 Score: 53.1434 bits (126), Expect = 8.045e-7
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 2
Query: 1223 IVSRRGIVTKKRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYV 1417
            +  R  +   KR+ E E R F+ +WE   FF+++K      IC+ ++S  K +N+KRHYE +H +  D Y 
Sbjct:  706 LPQRAPLPVAKRKREGEGRVFREKWERDYFFVEVKSMPTCLICKKNVSVLKEYNLKRHYESQHSKSYDQYT 776          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 51.6026 bits (122), Expect = 2.618e-6
Identity = 30/76 (39.47%), Postives = 45/76 (59.21%), Query Frame = 2
Query: 1253 KRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYVG-*RKVKLQLLKANL 1459
            KR+I+ E R FQ +WE   FF++++      IC+ S+S  K +N++RHY+  H    D Y G  R+ KL+ LK  L
Sbjct:  414 KRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSVSVSKEYNLRRHYQTNHSRHYDQYSGQAREEKLRELKRGL 489          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Match: sp|A4IFA3|GT2D2_BOVIN (General transcription factor II-I repeat domain-containing protein 2 OS=Bos taurus OX=9913 GN=GTF2IRD2 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 4.986e-6
Identity = 36/106 (33.96%), Postives = 53/106 (50.00%), Query Frame = 2
Query: 1253 KRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYV-G*RKVKLQLLKANL------------TTQQNIFHKQNVTTNAII 1513
            KR+I+ E R FQ +WE   FF++++      IC+ S+S  K +N++RHY+  H +  D Y    R  KLQ LK  L              Q+ +F K N   NA +
Sbjct:  419 KRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYTEKMRDEKLQELKEGLRKYLLGSSDTVCPEQKQVFAKVNPRENAAV 524          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A5E4M951 (Uncharacterized protein OS=Cinara cedri OX=506608 GN=CINCED_3A006216 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.861e-12
Identity = 43/114 (37.72%), Postives = 66/114 (57.89%), Query Frame = 2
Query: 1247 TKKRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHG-EIEDIYVG*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLS 1567
            +KKR+I+ E R FQ +W +  F I+ K      +CR+ IS  K +NIKRHYE KH  + + +Y   R++++  L+  LT +Q IF K  +   A+ISAS+ +   IA    P +
Sbjct:    4 SKKRKIDSECRVFQHKWSNQYFVIENKGKVMCLVCRELISVLKEYNIKRHYESKHKVKYDSLYGQFREIEVNKLQKALTGEQTIFSKVTIQNKAVISASVNVAMLIAKEGKPFT 117          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: D6WTP3 (General transcription factor II-I repeat domain-containing protein 2-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC010214 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.793e-11
Identity = 40/114 (35.09%), Postives = 65/114 (57.02%), Query Frame = 2
Query: 1247 TKKRRIEDENRTFQSEWEDL*FFIQ------IKICRDSISTFKLHNIKRHYEQKHGEIEDIYVG-*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLS 1567
            TKKR+++ E R FQ +W ++ FF+         IC++S+S FK HNIKRHY+ KH +  + YVG  R+ K+  L++ +     +F+       +I+ AS R+ + I    +P S
Sbjct:    3 TKKRKVDSECRVFQEKWTNMYFFVAQGEKCLCLICKESLSVFKEHNIKRHYDSKHKQTYNKYVGVCRENKITNLQSEIGGLTKLFNNAKNINESIVRASYRVGHIIGKEVHPFS 116          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: J9JJ25 (DUF4371 domain-containing protein OS=Acyrthosiphon pisum OX=7029 GN=103308085 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.264e-11
Identity = 44/115 (38.26%), Postives = 65/115 (56.52%), Query Frame = 2
Query: 1244 VTKKRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYVG*RKV-KLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLS 1567
            V+KKR+I DE+R FQ +W +  FFIQ+K      IC++SI+  K +N+KRHY  KH    D+  G  ++ KL LL  N+  Q +   K +  + A + AS  I  KI+    P +
Sbjct:    3 VSKKRKISDESRVFQEKWSNNYFFIQVKEKAICLICQESIAVMKEYNLKRHYGTKHAAKYDMIQGQLRIDKLALLMKNIQGQSSGLKKYHKDSEASVKASFIIAQKISAKSKPFT 117          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A2S2Q713 (General transcription factor II-I repeat domain-containing protein 2 OS=Sipha flava OX=143950 GN=Gtf2ird2_4 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.379e-11
Identity = 39/115 (33.91%), Postives = 66/115 (57.39%), Query Frame = 2
Query: 1244 VTKKRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKH-GEIEDIYVG*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLS 1567
            +  KR+I DE+R F+ +W +L FFI++       IC  +I+  K +NI+RHY+ +H  + E++    R+ K++    +L++QQNIF  QN    A + AS  +   +A N  P +
Sbjct:    1 MAPKRKINDEHRIFKEDWTELFFFIELGGKLLCLICNKTITVMKEYNIRRHYDNEHKAKFENLTGELRQNKIKHFLTSLSSQQNIFKSQNTRNEASVRASYVVAEMLAKNNRPFT 115          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: X1X043 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.747e-10
Identity = 44/115 (38.26%), Postives = 64/115 (55.65%), Query Frame = 2
Query: 1244 VTKKRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYVG-*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLS 1567
            ++KKR+I DE+R F   W DL FFI+ K      IC+ +I T K +N+KRHYE +H    D   G  R++K+   K++LT QQN F  Q+    + + AS  +   IA    P +
Sbjct:    1 MSKKRKISDEHRIFNESWTDLYFFIENKGKLLCLICKKTILTVKEYNVKRHYETEHKLKFDTLTGDLRQIKINNFKSSLTNQQNSFKLQHNQNESGVRASFVVAEMIAKCNRPFN 115          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000052542.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000549.1:35642:40620:1 gene:ENSAMXG00000033785.1 transcript:ENSAMXT00000052542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 1.581e-11
Identity = 37/113 (32.74%), Postives = 61/113 (53.98%), Query Frame = 2
Query: 1247 TKKRRIEDENRTFQSEWEDL*FFIQIK-------ICRDSISTFKLHNIKRHYEQKHGEIEDIYVG*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPL 1564
            +KKR+++ E+R F  EW    FF +         +C + ++  K +N++RHYE KH ++ D+    RK K++ LK  L +QQ +F K+   + A   AS RI   +A +  P 
Sbjct:    4 SKKRKVDLEHRKFNPEWTSKYFFYETSSAVFSCLVCLECVAVAKEYNLRRHYETKHPKLADLQGEDRKQKIEALKKQLVSQQGVFEKRRKESEACTIASYRIANLVAKSARPF 116          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.791e-8
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 2
Query: 1253 KRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYVG*RKV-KLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLS 1567
            KR+I DE+R FQ +WE   FF++ +      IC + ++  K +N+KRHY  +H E    Y G  +  ++  LK  L  QQ+ F K     +A + AS  +   IA    P +
Sbjct:   61 KRKICDEHRQFQEKWEVQFFFVEHRGIPTCLICTEKVAVHKEYNLKRHYTTRHAEEYAKYQGDERANRVANLKTCLLRQQDFFKKATKENDAAVEASYVVSEMIAKAGKPFT 172          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048309.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000491.1:94927:99076:1 gene:ENSAMXG00000033081.1 transcript:ENSAMXT00000048309.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 1.627e-7
Identity = 33/110 (30.00%), Postives = 57/110 (51.82%), Query Frame = 2
Query: 1259 RIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYVG-*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLS 1567
            +++ ENR FQ++WE+   F + K      +C +++S  K +N+ RHY   H    + Y G  R   +  LK+ +  QQ+ F K   +  + I+AS  +  ++A    PLS
Sbjct:   36 KLDRENRIFQTKWEEEYLFTEFKGKPMCLVCLETLSALKDYNLSRHYSTLHKVKYEKYTGAARAAVVADLKSKVGKQQHFFTKATTSQESAITASYDVALELARAKKPLS 145          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29162452:29166863:1 gene:ENSAMXG00000037303.1 transcript:ENSAMXT00000037725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 2.016e-7
Identity = 27/79 (34.18%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1328 ICRDSISTFKLHNIKRHYEQKHGEIEDIYVG*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPL 1564
            +C + ++  K +N++RHYE KH ++ D+    RK K++ LK  L +QQ +F K+   + A   AS RI   +A +  P 
Sbjct:  226 VCLECVAVAKEYNLRRHYETKHPKLADLQGEDRKQKIEALKKQLVSQQGVFEKRRKESEACTIASYRIANLVAKSARPF 304          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035253.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111191579])

HSP 1 Score: 53.5286 bits (127), Expect = 4.767e-7
Identity = 31/108 (28.70%), Postives = 58/108 (53.70%), Query Frame = 2
Query: 1244 VTKKRRIEDENRTFQSEWEDL*FFIQ------IKICRDSISTFKLHNIKRHYEQKHG-EIEDIYVG*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIA 1546
            +++KR+++ + R FQ  WE    F+         +C +++S  K +N++RH++ KHG +     +  ++   Q LK  L +QQN+F K     +A + AS  +  +IA
Sbjct:    1 MSRKRKVDADGRLFQQRWEGEYMFVLQGERPVCLLCCEAVSVIKEYNLRRHFDTKHGAKYGKASLQEKQQIAQELKDKLKSQQNLFTKATAKNSAAVKASFIVAEEIA 108          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033014.1 (general transcription factor II-I repeat domain-containing protein 2 [Source:NCBI gene;Acc:101164918])

HSP 1 Score: 65.855 bits (159), Expect = 5.570e-11
Identity = 38/112 (33.93%), Postives = 63/112 (56.25%), Query Frame = 2
Query: 1250 KKRRIEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIEDIYVG*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLS 1567
            KKR+++ E R FQ  W+   FF  I+      IC+D+++ FK  NI+RHY+ KH   +++    R+ KL+ L++ LTTQQ+I   ++   +    AS  +   IA +  P +
Sbjct:    6 KKRKVDYEGRRFQDRWKLAYFFTDIQNNCVCLICQDTVAVFKEFNIRRHYQTKHASYDNLTGVQRREKLEQLESALTTQQSICAIKSEPDDNTTQASYEVATLIAKHCKPFT 117          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000017252.2 (pep primary_assembly:ASM223467v1:13:14820116:14821987:-1 gene:ENSORLG00000013757.2 transcript:ENSORLT00000017252.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 4.127e-7
Identity = 25/65 (38.46%), Postives = 39/65 (60.00%), Query Frame = 2
Query: 1247 TKKRRIEDENRTFQSEWEDL*FFIQIK--------ICRDSISTFKLHNIKRHYEQKHGEIEDIYV 1417
            +K ++++ ENRTF+ EW D   FI           IC ++++  K  N+KRHYE KHG  E++Y+
Sbjct:    4 SKMKKVDAENRTFKDEWTDKYMFILPAASSKPLCLICCENVALIKSGNVKRHYETKHGSFEEMYL 68          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000037770.1 (SMESG000037770.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.246e-9
Identity = 40/109 (36.70%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 1262 IEDENRTFQSEWEDL*FFIQIK------ICRDSISTFKLHNIKRHYEQKHGEIE-DIYVG*RKVKLQLLKANLTTQQNIFHKQNVTTNAIISASLRILYKIATN*NPLS 1567
            IE+E RTF  +W    FF+ IK      ICR+S++ FK +N+KRH++ KHG    ++     + K   L  +L  +Q IF K +    A   ASL I +KI  +  P S
Sbjct:  529 IEEECRTFNKDWTSKYFFVDIKTNAVCLICRESVAVFKEYNLKRHFQTKHGNFGINLNETELRRKADDLVRSLKQEQTIFLKPSSIQEAATKASLVIAHKIVKHNKPFS 637          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000045419.1 (SMESG000045419.1)

HSP 1 Score: 58.5362 bits (140), Expect = 8.252e-9
Identity = 36/93 (38.71%), Postives = 54/93 (58.06%), Query Frame = 2
Query: 1241 IVTKKRRIEDENRTFQSEWEDL*FFIQ------IKICRDSISTFKLHNIKRHYEQKHG-EIEDIYVG*RKVKLQLLKANLTTQQNIFHKQNVT 1498
            + ++KR+I DE R F  EW    FF +        I   S++  K +N+KRHYE++H  + +D+    RK K + LKA+LT QQ+IF K+  T
Sbjct:    1 MSSRKRKIADEGRVFNEEWNSKYFFTENGGKPLCLIFNKSVAVMKEYNVKRHYEKEHERQYKDLTGEIRKNKFRTLKASLTAQQSIFMKRPFT 93          
The following BLAST results are available for this feature:
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MED255.297e-736.62mediator complex subunit 25 [Source:HGNC Symbol;Ac... [more]
GTF2IRD21.916e-638.16GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD2B2.438e-638.16GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AL928808.11.515e-1033.88pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spag18.362e-1236.21sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000016563.18.473e-1236.21pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Med258.045e-735.21mediator complex subunit 25 [Source:MGI Symbol;Acc... [more]
Gtf2ird22.618e-639.47GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|A4IFA3|GT2D2_BOVIN4.986e-633.96General transcription factor II-I repeat domain-co... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4M9517.861e-1237.72Uncharacterized protein OS=Cinara cedri OX=506608 ... [more]
D6WTP33.793e-1135.09General transcription factor II-I repeat domain-co... [more]
J9JJ255.264e-1138.26DUF4371 domain-containing protein OS=Acyrthosiphon... [more]
A0A2S2Q7138.379e-1133.91General transcription factor II-I repeat domain-co... [more]
X1X0431.747e-1038.26Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000052542.11.581e-1132.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030525.11.791e-833.04pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
ENSAMXT00000048309.11.627e-730.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037725.12.016e-734.18pep primary_assembly:Astyanax_mexicanus-2.0:14:291... [more]
ENSAMXT00000035253.14.767e-728.70general transcription factor II-I repeat domain-co... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000033014.15.570e-1133.93general transcription factor II-I repeat domain-co... [more]
ENSORLT00000017252.24.127e-738.46pep primary_assembly:ASM223467v1:13:14820116:14821... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000037770.11.246e-936.70SMESG000037770.1[more]
SMESG000045419.18.252e-938.71SMESG000045419.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004402 ID=SMED30004402|Name=Dimer_Tnp_hAT domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1679bp
AAATTTTCTTTTGAATAAAACAAAAATAATTTAATAAATGTTATGAGACA
GACATGAGTAAATATTTCGTTTATTCTCTCAAGTCAAAGAAATAATAATT
CATTTTAATTATGTTTGAAATATAAATTATAAAAATTAAAGTTAATTTTT
AAGGTGTCAACGATTTTACAATTTTATATTTCAATTTTAGTTAATTACTA
TGATTATTATTATTTATACTTAAAAGTATTATTTGCCAATGCGGGATCAT
TCATATTCAACAAGTCTTTCACATTCTGGTTCTTATCTGCTTAACCTTTC
CTTCCCACTACTGTTTTCAATAAATGACAAGATTAAAACAGTTTGTTTTA
ATAATTAAAATTTTAATTTGCCAATAACCAAATATGAATAAATCCGAATA
AAATACTTTTTAACACAATTAAATACACTTTTAAATATTTGTAAATCAAA
CTTTTAAGATTTGCTAAATTTGAATTTTTGAAAATATTTCTGTGTGGGGC
TGATTTATATAAACTTAAAAATATTTAGGTAGTTTTTCTACCTTTTCAAA
TAGCTAAAATTTTCATGTTATAGGCATATTAATAAAACAAGATTAAATCT
TTATAAATTATTTATTTGAATTTGTTCTTAAAAACCACATTGCTTTTATT
AAATTTATATTTGTAGAAGCTCTCAAATCAGAATTGAGGATTTTAAGAGC
GTAAAATAAGCGATCTATGGATACTTGGGTTGATGGCAATGTTGTTATGA
TCAACCCTGAGTCTTCTACGATTTCTGGATACCACTGTATTGTCATTTTT
AACATTTAAATCAGCCCTGTCCAACACGCGGCCCGCGGGTAGCATGCGGC
CCAGTTTAAGATTTTCTCCGGCCCTATTGGAGTTCGCAACTTACTATTAA
CATATTTTGTTATTCATAAATCAAACAAAACAAGTAAAAATAATTCACGC
TCGAGTGGTGCACTCGCACACCTTTCCAGTGACTAGTGTAAAAACCTCAA
TCTAACTCACTCGCGCGAAAGAACGGGATGCGGCTAATTTCATGTGAATT
TGACATCAAAATATTTATACATATTATTTACTAGAATAAGTCACATTTAG
TACAGTCTGGTCGAGTTGTAACTTCTTTGTGATATTTAGAGGCGCTTGTT
TATTAAATGAAGTAAGATAGTACAACTTTACAATTATTTAATCATATCAC
TTATAATTAAAAAAACAGATTTATCGTATCTAGAAGAGGAATTGTAACGA
AGAAAAGAAGGATTGAAGATGAGAACAGAACATTCCAGAGTGAATGGGAA
GATTTGTAATTTTTCATCCAAATAAAAATTTGTCGTGATTCTATTTCAAC
TTTCAAATTACACAACATTAAAAGACATTATGAACAGAAACATGGTGAAA
TAGAAGACATTTATGTTGGCTAACGAAAGGTTAAGTTACAATTGCTAAAG
GCCAATCTTACAACACAACAAAACATATTTCATAAGCAAAATGTAACAAC
AAACGCTATTATCAGTGCCAGCCTGCGAATACTATATAAAATTGCTACAA
ATTGAAACCCTTTATCAACGAAATGAAATAAGTCCGCTAACATATCGTAA
GCATTTTAGTTCATTATTATTGAAAAAGAAATTTCATAAATGACAAACAC
TGAACTGCTTATTTTAATAAAAAACTTAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis