Alpha-1A adrenergic receptor

Overview
NameAlpha-1A adrenergic receptor
Smed IDSMED30004401
Length (bp)1279
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-1A adrenergic receptor (SMED30004401) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-1A adrenergic receptor (SMED30004401) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-1A adrenergic receptor (SMED30004401) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-1A adrenergic receptor (SMED30004401) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004401

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004401SMESG000005640.1 SmedASXL_002339SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30004401SMESG000005640.1 dd_Smed_v6_31015_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 241.121 bits (614), Expect = 9.281e-75
Identity = 140/353 (39.66%), Postives = 212/353 (60.06%), Query Frame = 3
Query:   90 SDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL----YCKRSPNRQRL 1136
            S+C       NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P     F         E +    C++N   GYV+FS L SFY+P  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       +  +   +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   + K S+ +F  +FWLGY NS  NP+IY C+++E+K AF  +L     C++  ++  L
Sbjct:   12 SNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL----FGWRQPAPEDETI----CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHAL 356          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 241.121 bits (614), Expect = 9.696e-75
Identity = 140/353 (39.66%), Postives = 212/353 (60.06%), Query Frame = 3
Query:   90 SDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL----YCKRSPNRQRL 1136
            S+C       NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P     F         E +    C++N   GYV+FS L SFY+P  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       +  +   +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   + K S+ +F  +FWLGY NS  NP+IY C+++E+K AF  +L     C++  ++  L
Sbjct:   12 SNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL----FGWRQPAPEDETI----CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHAL 356          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 240.736 bits (613), Expect = 3.278e-74
Identity = 140/353 (39.66%), Postives = 212/353 (60.06%), Query Frame = 3
Query:   90 SDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL----YCKRSPNRQRL 1136
            S+C       NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P     F         E +    C++N   GYV+FS L SFY+P  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       +  +   +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   + K S+ +F  +FWLGY NS  NP+IY C+++E+K AF  +L     C++  ++  L
Sbjct:   12 SNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL----FGWRQPAPEDETI----CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHAL 356          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 241.121 bits (614), Expect = 3.373e-74
Identity = 140/353 (39.66%), Postives = 212/353 (60.06%), Query Frame = 3
Query:   90 SDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLY----CKRSPNRQRL 1136
            S+C       NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P     F         E +    C++N   GYV+FS L SFY+P  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       +  +   +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   + K S+ +F  +FWLGY NS  NP+IY C+++E+K AF  +L     C++  ++  L
Sbjct:   12 SNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL----FGWRQPAPEDETI----CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHAL 356          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 240.736 bits (613), Expect = 4.097e-74
Identity = 140/353 (39.66%), Postives = 212/353 (60.06%), Query Frame = 3
Query:   90 SDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL----YCKRSPNRQRL 1136
            S+C       NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P     F         E +    C++N   GYV+FS L SFY+P  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       +  +   +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   + K S+ +F  +FWLGY NS  NP+IY C+++E+K AF  +L     C++  ++  L
Sbjct:   12 SNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL----FGWRQPAPEDETI----CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHAL 356          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Celegans
Match: ser-5 (SERotonin/octopamine receptor family [Source:UniProtKB/TrEMBL;Acc:G5EBX8])

HSP 1 Score: 159.073 bits (401), Expect = 9.081e-44
Identity = 110/380 (28.95%), Postives = 180/380 (47.37%), Query Frame = 3
Query:  117 ENIFISTVVGICLFSVI--FLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFI---------LSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL------------YCKRSPNR--QRLPLHVNMQISNTVETN 1181
            E +  + +V +C+ +VI   LTI GN++VL    +      +T  L+ NL + D L+G+ VLP  A   +++ WIFG  LC  W A DV  CT S+ ++C+IS+DRY+ +TRPL+             +     IS +  +  F+ +           E   +  C V +   ++  S + +F++P  + + LY  IY  A  + + L +GF+         L+N  S+   + VH+           ++N      R+  + R   + AKTLG+V   F+ CWLPFF L      C  C +     D   WLGYCNS+ NP+IYS T +E+K + ++L+            +    P+   QR+  HV+      ++T 
Sbjct:   55 EQLPPAVLVLLCIPAVIIILLTIFGNLLVLFFKARVGR--TNTTLLVWNLGLTDFLVGVIVLPMGAVYLIYRKWIFGRFLCRLWVAADVTFCTCSVVTICVISVDRYLAVTRPLR---------YKSIVTKTKVISVMTIIWIFSSSILLTTVRWEQPECYDDSLCFVGNEIRHLAHSVVFAFFLPASVTLTLYWRIYKLARNRQKALDRGFLMILGSNMNFLTNTLSQQTTLRVHFG----------KTNGMVEHQRR--VLRTHERIAKTLGVVSCSFLFCWLPFFGLYLTNYKCSGC-VPPIAIDVASWLGYCNSMLNPIIYSFTVKEFKRSAFRLVVPIWQFVNRCLPFVPAPPDNILQRIARHVHRHKEKEMQTR 410          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Celegans
Match: dop-1 (DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:Q86ME5])

HSP 1 Score: 156.377 bits (394), Expect = 3.705e-43
Identity = 119/342 (34.80%), Postives = 188/342 (54.97%), Query Frame = 3
Query:  147 ICLFSV-IFLTISGNIMVLIASKKNKNL--VPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPF-----TMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSR----QLKQG--FILSNQGSEVVKMNVHYKSFID---------RNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL 1103
            + LFSV I L + GN++V  A   +++L   P  ++L++ LAV+DLL+ + V+ F+A   +   W FG   C FW + D+  CTASI +LC IS+DRY  I+RP+       +RRI Y I+L+W IS  +  AP      +     NLT L V        CE+     Y I S++VSF++P ++++ILY  +YL A K  R    QL+Q   F++    SE ++  +    F           +N+   Q  H+ +++ +  I   ++KA  TLG+++G F++CWLPFF +  L+A       S +    + WLGY NS  NP+IYS  NR+++ AF +++
Sbjct:    9 LGLFSVLIILALFGNLLVCAAILWDRSLRKQPENLFLVS-LAVSDLLVSVLVMLFAAVNDILGYWPFGQFYCQFWISFDITTCTASILNLCAISLDRYWHISRPMVYIRYCNRRRINYVIVLVWLISAGIGAAPLGFGFGSKVTINNLTGLPV--------CEMRLPLPYAIGSSMVSFFLPAMVMVILYTKLYLYARKHVRSIKTQLQQATSFLIMQLASEKIR-EIRTSIFSKLNFLCPTRFKNQRSPQDPHTPAAHNRSNI--SDQKARLTLGVIMGTFLVCWLPFFTVNILRAWLPEI-FSSKTIMAVTWLGYANSSANPLIYSIFNRDFRRAFKKII 337          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Celegans
Match: dop-1 (DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:Q86ME5])

HSP 1 Score: 155.992 bits (393), Expect = 4.111e-43
Identity = 119/342 (34.80%), Postives = 188/342 (54.97%), Query Frame = 3
Query:  147 ICLFSV-IFLTISGNIMVLIASKKNKNL--VPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPF-----TMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSR----QLKQG--FILSNQGSEVVKMNVHYKSFID---------RNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL 1103
            + LFSV I L + GN++V  A   +++L   P  ++L++ LAV+DLL+ + V+ F+A   +   W FG   C FW + D+  CTASI +LC IS+DRY  I+RP+       +RRI Y I+L+W IS  +  AP      +     NLT L V        CE+     Y I S++VSF++P ++++ILY  +YL A K  R    QL+Q   F++    SE ++  +    F           +N+   Q  H+ +++ +  I   ++KA  TLG+++G F++CWLPFF +  L+A       S +    + WLGY NS  NP+IYS  NR+++ AF +++
Sbjct:    9 LGLFSVLIILALFGNLLVCAAILWDRSLRKQPENLFLVS-LAVSDLLVSVLVMLFAAVNDILGYWPFGQFYCQFWISFDITTCTASILNLCAISLDRYWHISRPMVYIRYCNRRRINYVIVLVWLISAGIGAAPLGFGFGSKVTINNLTGLPV--------CEMRLPLPYAIGSSMVSFFLPAMVMVILYTKLYLYARKHVRSIKTQLQQATSFLIMQLASEKIR-EIRTSIFSKLNFLCPTRFKNQRSPQDPHTPAAHNRSNI--SDQKARLTLGVIMGTFLVCWLPFFTVNILRAWLPEI-FSSKTIMAVTWLGYANSSANPLIYSIFNRDFRRAFKKII 337          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 150.214 bits (378), Expect = 7.489e-41
Identity = 116/378 (30.69%), Postives = 180/378 (47.62%), Query Frame = 3
Query:  153 LFSVIFLTISGNIMVLIASKKNKNL-VPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAP-FTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQ-LKQGF-------ILSNQGSEVVKMNVHY--------------KSFIDRN---------------------KVITQSNHSSS---------------SNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLY 1106
            + +V+ L I GN++V++   +++ L +    +LI +LAVAD+L+G+ V+P +    +   W  G+ LC  W A+DV   TASI  +C IS+DRY  +T PL      T  R+   I + W +S ++ L P F     R           A   C V++  GYV++S+L SFY+P +I+II+Y  IY    + SRQ LK+         +L+ + S   + N+ Y              K   +R+                     K+   +NH+S                  RK  +  +ER+A   LGI++  FI+ WLPFF++  + A          +F   FWLGYCNS  NPVIY+  NRE+K    + L+
Sbjct:   28 MLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPER-----------AEGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEA--PPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLH 392          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 149.443 bits (376), Expect = 1.563e-40
Identity = 116/380 (30.53%), Postives = 181/380 (47.63%), Query Frame = 3
Query:  153 LFSVIFLTISGNIMVLIASKKNKNL-VPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAP-FTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQ-LKQGF-------ILSNQGSEVVKMNVHYKS-------FIDRNKVIT------------------------------QSNHSSS---------------SNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLY 1106
            + +V+ L I GN++V++   +++ L +    +LI +LAVAD+L+G+ V+P +    +   W  G+ LC  W A+DV   TASI  +C IS+DRY  +T PL      T  R+   I + W +S ++ L P F     R           A   C V++  GYV++S+L SFY+P +I+II+Y  IY    + SRQ LK+         +L+ + S   + N+ Y+          ++ KV+T                               +NH+S                  RK  +  +ER+A   LGI++  FI+ WLPFF++  + A          +F   FWLGYCNS  NPVIY+  NRE+K    + L+
Sbjct:   28 MLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPER-----------AEGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKVSIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEA--PPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLH 394          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0100322)

HSP 1 Score: 178.718 bits (452), Expect = 2.506e-51
Identity = 109/316 (34.49%), Postives = 186/316 (58.86%), Query Frame = 3
Query:  162 VIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIE-NLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYK-SFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL 1103
            +I   I GN++V+++  +++ L   T Y + +LAVAD+L+ +C + F+A+  +   W+FGS +C+ W + DV+  TASI  LC IS+DRY  I +PL   +I+T+RR+   ++++W    ++S  P     +    N   ++ N   C  +VN A  Y I S+ +SF++P I+++ +Y+ IY  A +Q R + +  + +      + +  H + S I + +   Q   S+ S       R+ERKAA+TLGI++  F+ICWLPFF+   + +LC++C     L   +FW+GY NS  NP+IY+  NR+++AAF + L
Sbjct:  117 IILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKA--YAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAA------LLLEKHLQISQIPKPRPSIQVEQSTIST-----MRRERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL 419          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0301484)

HSP 1 Score: 178.718 bits (452), Expect = 3.457e-51
Identity = 109/316 (34.49%), Postives = 186/316 (58.86%), Query Frame = 3
Query:  162 VIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIE-NLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYK-SFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL 1103
            +I   I GN++V+++  +++ L   T Y + +LAVAD+L+ +C + F+A+  +   W+FGS +C+ W + DV+  TASI  LC IS+DRY  I +PL   +I+T+RR+   ++++W    ++S  P     +    N   ++ N   C  +VN A  Y I S+ +SF++P I+++ +Y+ IY  A +Q R + +  + +      + +  H + S I + +   Q   S+ S       R+ERKAA+TLGI++  F+ICWLPFF+   + +LC++C     L   +FW+GY NS  NP+IY+  NR+++AAF + L
Sbjct:  117 IILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKA--YAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAA------LLLEKHLQISQIPKPRPSIQVEQSTIST-----MRRERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL 419          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Fly
Match: Octbeta2R (gene:FBgn0038063 transcript:FBtr0304845)

HSP 1 Score: 180.644 bits (457), Expect = 5.244e-51
Identity = 120/391 (30.69%), Postives = 208/391 (53.20%), Query Frame = 3
Query:   63 NFTKYIAKFSDCFHQIQ--VENIFISTVVGI----CLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLS-VIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSN-------------HSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQL---LYCKRSPNRQRLPLHVNMQISN 1166
            NF +  A  SD  H  Q   +  ++  +V +     +  +I   I GN++V+I+  + + L   T Y + +LA+AD+++ I  + F+ +  +   W F   LC+ W ++DV+  TASI  LC IS+DRY  I +PLK  I +TKR +   ++  W    ++S  P  +  +    +   VI+N   C+  VN    Y + S+ +SF++PC I+I  Y +I+  A++Q +QL     +   G+ ++   +H  S     + ++ S              H+ + ++     ++E KAA+TLGI++G FI+CWLPFF+   L   CE C++ D +   +FW+GY NS  NP+IY+  NR+++ AF      L+C    +R  LPL ++++ S+
Sbjct:  124 NFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKY--YAVISSSISFWIPCTIMIFTYLAIFREANRQEKQL-----MMRHGNAML---MHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDRH-LPLDIDIRRSS 503          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Fly
Match: Octbeta2R (gene:FBgn0038063 transcript:FBtr0347149)

HSP 1 Score: 180.644 bits (457), Expect = 5.244e-51
Identity = 120/391 (30.69%), Postives = 208/391 (53.20%), Query Frame = 3
Query:   63 NFTKYIAKFSDCFHQIQ--VENIFISTVVGI----CLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLS-VIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSN-------------HSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQL---LYCKRSPNRQRLPLHVNMQISN 1166
            NF +  A  SD  H  Q   +  ++  +V +     +  +I   I GN++V+I+  + + L   T Y + +LA+AD+++ I  + F+ +  +   W F   LC+ W ++DV+  TASI  LC IS+DRY  I +PLK  I +TKR +   ++  W    ++S  P  +  +    +   VI+N   C+  VN    Y + S+ +SF++PC I+I  Y +I+  A++Q +QL     +   G+ ++   +H  S     + ++ S              H+ + ++     ++E KAA+TLGI++G FI+CWLPFF+   L   CE C++ D +   +FW+GY NS  NP+IY+  NR+++ AF      L+C    +R  LPL ++++ S+
Sbjct:  124 NFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKY--YAVISSSISFWIPCTIMIFTYLAIFREANRQEKQL-----MMRHGNAML---MHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDRH-LPLDIDIRRSS 503          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Fly
Match: Octbeta2R (gene:FBgn0038063 transcript:FBtr0100019)

HSP 1 Score: 180.644 bits (457), Expect = 5.244e-51
Identity = 120/391 (30.69%), Postives = 208/391 (53.20%), Query Frame = 3
Query:   63 NFTKYIAKFSDCFHQIQ--VENIFISTVVGI----CLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLS-VIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSN-------------HSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQL---LYCKRSPNRQRLPLHVNMQISN 1166
            NF +  A  SD  H  Q   +  ++  +V +     +  +I   I GN++V+I+  + + L   T Y + +LA+AD+++ I  + F+ +  +   W F   LC+ W ++DV+  TASI  LC IS+DRY  I +PLK  I +TKR +   ++  W    ++S  P  +  +    +   VI+N   C+  VN    Y + S+ +SF++PC I+I  Y +I+  A++Q +QL     +   G+ ++   +H  S     + ++ S              H+ + ++     ++E KAA+TLGI++G FI+CWLPFF+   L   CE C++ D +   +FW+GY NS  NP+IY+  NR+++ AF      L+C    +R  LPL ++++ S+
Sbjct:  124 NFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKY--YAVISSSISFWIPCTIMIFTYLAIFREANRQEKQL-----MMRHGNAML---MHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDRH-LPLDIDIRRSS 503          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Zebrafish
Match: adra1d (adrenoceptor alpha 1D [Source:ZFIN;Acc:ZDB-GENE-090312-203])

HSP 1 Score: 236.113 bits (601), Expect = 3.116e-72
Identity = 143/357 (40.06%), Postives = 218/357 (61.06%), Query Frame = 3
Query:   39 LHNEMKSENFTKYIAKFSDCFHQIQVENIFI-STVVGICLFSVIFLTIS--GNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQS-NHS--SSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAF 1091
            L NE K E  + +++  S+       E I + S V+G+ +F  IF++++  GNI+V+++   NK+L   T + I NLA+ADLLL I VLPFSA+  +   W+FG   CN W A+DV CCTASI SLC+ISIDRYIG+   LK   I+T+R+    ++L+W  S V+S+ P         ++ S+        C +    GY +FS+L SFY+P ++I+++Y  +Y+ A + ++ L+ G       S  V + +H +S  + +   +++ NH   SS + +   F +E+KAAKTL IVVG+FI+CWLPFF +LPL +     K SD +F  IFWLGY NS  NP+IY C+++E++ AF
Sbjct:    6 LLNESKDEFPSDFLSNISN----TTCEGITLDSQVIGVGIFLAIFISVAIVGNILVILSVLCNKHLQTVTNFFIVNLAIADLLLSIIVLPFSASLEVLGCWVFGRVFCNIWAAVDVLCCTASILSLCVISIDRYIGVKHCLKYPTIMTERKAGVILVLVWVSSMVISIGPLLGWKEPPPSDESI--------CRITEEPGYALFSSLFSFYLPLMVILVMYIRVYIVARRTTKSLEAGVKRERDKSMEVVLRIHCRSMPEDSSTSSKTKNHPFRSSLSVRLMKFSREKKAAKTLAIVVGMFILCWLPFFFVLPLGSFFPALKPSDMVFKVIFWLGYFNSCINPIIYPCSSKEFQRAF 350          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Zebrafish
Match: adra1aa (adrenoceptor alpha 1Aa [Source:ZFIN;Acc:ZDB-GENE-030131-2831])

HSP 1 Score: 229.95 bits (585), Expect = 5.851e-70
Identity = 145/392 (36.99%), Postives = 221/392 (56.38%), Query Frame = 3
Query:   21 IQNLIHLHNEMKSENFTKYIAKFSDCFHQIQVE-NIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQG-FILSNQGSEVVKMNVHYKSF-IDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYC----KRSPNRQRL-----PLHVNMQI 1160
            ++ ++   + M  E+F +     S+C   +  E N+  +  +G+ L   I   + GNI+V+++   ++NL   T Y I NLAVADLLL   VLPFS    +   WIFG   C+ W AMDV CCTASI SLC+IS+DRYIG++ PL+   I+T+RR + A+I +W +S  +S+ P          + S+        C++    GY IFS L SFY+P ++I+ +Y  +Y+ A +++R L  G     +  +E V + +H  +  +  ++ +    H +    K   F +E+KAAKTLGIVVG F++CWLPFF++LP+ ++    + SD +F   FWLGY NS  NP+IY C+++E+K AF  +L      KRS     L     P H   QI
Sbjct:    5 LEQMVPFKDNMTPESFPE---NCSNCSQVLVPELNVMKAVALGVVLAIFIVFGVLGNILVILSVACHRNLRTVTHYFIVNLAVADLLLSSTVLPFSTVFEMLGRWIFGRPFCDVWAAMDVLCCTASIMSLCVISVDRYIGVSYPLQYPSIVTERRALLALIALWVLSITISIGPLFGWKEPAPDDESI--------CKITEEPGYAIFSALGSFYLPLVVILSMYCRVYVVARRETRGLISGQKTEKSDHAETVTLRIHRGNMTVSEDEALRNRTHFALRLLK---FSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPTYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVLGARCLRKRSTPSHTLYQSHSPRHGQSQI 382          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Zebrafish
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 229.18 bits (583), Expect = 8.284e-70
Identity = 136/354 (38.42%), Postives = 214/354 (60.45%), Query Frame = 3
Query:   87 FSDCFHQIQVENIFISTVVGICLFSVIFLT--ISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSS-NRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQRLP 1139
            FS   +   +E + +S  V + L    F+T  I+GNI+V+++   N++L   T Y I NLA+ADLLLG  VLP SA   +   W+FG   C+ W A+DV CCTASI SLC+ISIDRYIG++ PL+   I+T RR + A++ +W +S V+S+ P        L       +  +  C +N    Y +FS+L SFY+P I+I+++Y  +Y+ A + ++ L+ G    +  S  + + +H  S +  +   ++++ + +S   K   F +E+KAAKTLG+VVG+F +CWLPFF+ LP+ +   + +  + +   IFWLGY NS  NP+IY C +RE+K AF ++L C+   +R+R P
Sbjct:   30 FSLKLNGTGLEPLLLSRAVPLGLVLGFFITFAIAGNILVILSVVCNRHLRSPTNYFIVNLAIADLLLGTTVLPVSATLEVVGHWVFGRIFCDVWAAVDVLCCTASIMSLCVISIDRYIGVSHPLQYPNIVTGRRALLAMLGVWVLSLVISIGP--------LLGWKEPPSPDDTVCAINEEPFYALFSSLGSFYIPLIVILVMYCRVYVVAKRTTKNLEAGVKTESMNSGEITLRIHRGSQVHEDAGKSRAHQARNSLTVKLLKFSREKKAAKTLGVVVGMFTLCWLPFFLTLPIVSFNTSLRPPETVSSIIFWLGYFNSCLNPIIYPCYSREFKLAFIRILKCR--CHRRRRP 373          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Zebrafish
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 228.024 bits (580), Expect = 2.897e-69
Identity = 136/354 (38.42%), Postives = 213/354 (60.17%), Query Frame = 3
Query:   87 FSDCFHQIQVENIFISTVVGICLFSVIFLT--ISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSS-NRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQRLP 1139
            FS   +   +E + +S  V + L    F+T  I+GNI+V+++   N++L   T Y I NLA+ADLLLG  VLP SA   +   W+FG   C+ W A+DV CCTASI SLC+ISIDRYIG++ PL+   I+T RR + A++ +W +S V+S+ P        L       +  +  C +N    Y +FS+L SFY+P I+I+++Y  +Y+ A   ++ L+ G    +  S  + + +H  S +  +   ++++ + +S   K   F +E+KAAKTLG+VVG+F +CWLPFF+ LP+ +   + +  + +   IFWLGY NS  NP+IY C +RE+K AF ++L C+   +R+R P
Sbjct:   30 FSLKLNGTGLEPLLLSRAVPLGLVLGFFITFAIAGNILVILSVVCNRHLRSPTNYFIVNLAIADLLLGTTVLPVSATLEVVGHWVFGRIFCDVWAAVDVLCCTASIMSLCVISIDRYIGVSHPLQYPNIVTGRRALLAMLGVWVLSLVISIGP--------LLGWKEPPSPDDTVCAINEEPFYALFSSLGSFYIPLIVILVMYCRVYVVAKMTTKNLEAGVKTESMNSGEITLRIHRGSQVHEDAGKSRAHQARNSLTVKLLKFSREKKAAKTLGVVVGMFTLCWLPFFLTLPIVSFNTSLRPPETVSSIIFWLGYFNSCLNPIIYPCYSREFKLAFIRILKCR--CHRRRRP 373          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Zebrafish
Match: adra1ba (adrenoceptor alpha 1Ba [Source:ZFIN;Acc:ZDB-GENE-120510-1])

HSP 1 Score: 227.254 bits (578), Expect = 5.443e-69
Identity = 127/321 (39.56%), Postives = 195/321 (60.75%), Query Frame = 3
Query:  141 VGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL 1103
            +G+ L + I   I GNI+V+++   N++L   T Y I NLA+ADLLL   VLP SA + +   W+FG   C+ W A+DV CCTASI SLC+ISIDRYIG+  PL+   I+T++R + A++ +W ++FV+S+ P        L       +  +  C +     Y +FS+L SFY+P  +I+ +Y  +Y+ A + ++ L+ G +     S  + + +HYK    +    ++ +  SS   K   F +E+KAAKTLG+VVG+FI+CWLPFF+ LP+ +   + +  +  F  IFWLGY NS  NP+IY C +RE+K AF ++L
Sbjct:   45 LGMVLGAFIVFAIVGNILVILSVVCNRHLRIPTNYFIINLAMADLLLSTTVLPVSATREILNYWVFGRIFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPSIVTEKRALLAMLGVWVLAFVISIGP--------LLGWKEPPSEDDTVCLITEEPFYALFSSLGSFYIPLAVILAMYCRVYIVAKRTTKNLEAGVMKERMDSNELTLRIHYKGSQTQEDC-SKGHLRSSLTVKLLKFSREKKAAKTLGVVVGMFILCWLPFFLALPIGSFNTSLRPPETFFKVIFWLGYFNSCLNPIIYPCYSREFKQAFIRIL 356          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491])

HSP 1 Score: 240.736 bits (613), Expect = 5.879e-74
Identity = 141/346 (40.75%), Postives = 204/346 (58.96%), Query Frame = 3
Query:   93 DCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQ 1130
            +C H     NI  + VVG+     I   + GNI+V+++   +++L   T Y IANLAVADLLL   VLPFSA   +   W+FG   CN W A+DV CCTASI SLC ISIDRYIG++ PL+   I+T++R + A++ IW +S V+S+ P        L          +  CE+    GY +FS   SFY+P  II+++Y  +Y+ A ++S+ L  G  L    SE V + +H KS  +     + S   +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ ++      SD +F   FWLGY NS  NPVIY C++ E++ AF  +L+ + S  RQ
Sbjct:   37 NCTHPGATINISKAIVVGVIFGVFITFGVLGNILVILSVACHRHLQTVTHYFIANLAVADLLLMSMVLPFSATFEIQGYWLFGRIFCNIWAAVDVLCCTASIMSLCAISIDRYIGVSYPLRYPSIMTEKRGVLALLCIWVLSLVISIGP--------LFGWKQPAPEDDKICEITKEPGYALFSAFGSFYLPLSIILVMYFRVYIVAKRESKVLTSGMKLEKSDSEEVTLRIHRKSTPESIGSTSSSKQKTQFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSIYPPANSSDTIFKITFWLGYFNSCINPVIYPCSSPEFRKAFQNILHARCSHRRQ 374          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Xenopus
Match: ENSXETT00000011711.1 (adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488806])

HSP 1 Score: 240.736 bits (613), Expect = 6.532e-74
Identity = 153/372 (41.13%), Postives = 220/372 (59.14%), Query Frame = 3
Query:  120 NIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDR--NKVITQSNHSSSS-NRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYC----------KRSPNRQRLPLHVNMQISNTVE--TNFIN 1190
            N+  + ++G  L + I + I GNIMV+I+   NK L   T YLI NLA+ADLLL   VLPFSA K +   W+FG  LC+ W AMDV CCTASI SLC ISIDRYIG+   L+   I+T++R I A++ +W  S V+S+ P          +  V        CE+ +   Y IFS+L SFY+P I+I+++Y  +Y+ A + ++ L+ G +     S+ + + +H ++  D   N    Q+N   S+ + K   F +E+KAAKTLGIVVG+FI+CWLPFF +LPL +L E+      L   IFWLGY NS  NP+IY C+++E+K AF ++L C          +RS  R R    V+    +++E  + FIN
Sbjct:   40 NLTRAMLLGFTLGAFISVAIIGNIMVIISVVTNKQLRIPTNYLIVNLAIADLLLSSTVLPFSATKEIVGYWVFGRILCDVWAAMDVLCCTASIFSLCTISIDRYIGVRHSLRYPTIVTRKRTILALLGVWMFSTVISIGPLLGWKEPAPPDTYV--------CEITTEIFYAIFSSLASFYIPLIVILVMYCRVYVVAKRITKNLEAGVMKERMDSKELTLRIHCRNKQDDSPNNSKVQNNQPRSALSLKLLKFSREKKAAKTLGIVVGMFILCWLPFFTVLPLSSLSEHLTPPVTLEKIIFWLGYFNSCINPIIYPCSSKEFKRAFIRILKCQWGNRKNSAFRRSQYRPRPGSTVSHSRKDSIEETSQFIN 403          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Xenopus
Match: ADRA1D (adrenoceptor alpha 1D [Source:NCBI gene;Acc:100495969])

HSP 1 Score: 239.58 bits (610), Expect = 1.951e-73
Identity = 136/329 (41.34%), Postives = 197/329 (59.88%), Query Frame = 3
Query:  141 VGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNR-----KCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCK 1112
            VGI L   I   I GNIMV+++   N+ L   T Y I NLA+ADLLL   VLPFSA   +   W FG   C+ W A+DV CCTASI SLC+ISIDRY+G+   LK   I+T+++ +  +IL+W  S V+S+ P        L          +  C +    GY +FS+L SFY+P ++I+++Y  +Y+ A + ++ L+ G       S  V + +H +S ++ +   T+ NH   + R     +   F +E+KAAKTL IVVGVFI+CWLPFF++LPL +     K +D +F  IFWLGY NS  NP+IY C+++E+K AF ++L C+
Sbjct:   45 VGIVLAVFILFAIVGNIMVILSVACNRQLQTVTNYFIVNLAIADLLLSTTVLPFSATLEVLGFWAFGRVFCDIWAAVDVLCCTASIMSLCVISIDRYVGVKYSLKYPTIMTEKKAVVILILLWLSSMVISIGP--------LLGWKEPPPPDDSKCSITEEPGYALFSSLFSFYLPLLVILVMYFRVYIVARRTTKSLEAGVKKERNKSMEVVLRIHCRSVLEESSSSTR-NHKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFILCWLPFFLILPLGSFFPALKPTDSVFKVIFWLGYFNSCVNPIIYPCSSKEFKRAFIRILKCQ 364          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Xenopus
Match: exd2 (exonuclease 3'-5' domain containing 2 [Source:Xenbase;Acc:XB-GENE-5752408])

HSP 1 Score: 193.356 bits (490), Expect = 2.643e-56
Identity = 126/337 (37.39%), Postives = 189/337 (56.08%), Query Frame = 3
Query:  138 VVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFK-LWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLK-QGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFIL---LPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCK-RSPNRQ 1130
            V+G  L  +  LTI+GN +V+I+    K L   + YLI +LA+ADL + I V+PF +   L    WIFG   CN + AMDV CCTASI +LC+ISIDRY+GITRPL   +    R +   I+ +W +S  ++L P      +N+ +  V        C ++  +GY I+ST V+FY+P  +++ +Y+ I+ AA + + + K  G     +   ++  N + K+  +  +    S    +  +  +IF++E+KAA TLGI+VG F ICWLPFF+L    P     E   I   L     WLGY NSL NP IY+  NR+ +  +  LL C+ R+ NR+
Sbjct:   80 VIGAILSLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAIAVMPFVSVTDLIGGEWIFGHVFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGRCMAKMILCVWLLSASITLPPL-FGWAQNVNDDKV--------CLISQDFGYTIYSTAVAFYIPMSVMLFMYYRIFKAAKRSAAKHKFTGLPRPEESEGMISANGNVKTHKESEECTNLSKLLRNDRKNISIFKREQKAATTLGIIVGAFTICWLPFFLLSTARPFICGTECSCIPLWLERTFLWLGYANSLINPFIYAFFNRDLRTTYRNLLQCRYRNINRK 407          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Xenopus
Match: HTR1F (5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [Source:NCBI gene;Acc:100494586])

HSP 1 Score: 171.4 bits (433), Expect = 6.426e-49
Identity = 118/373 (31.64%), Postives = 191/373 (51.21%), Query Frame = 3
Query:   51 MKSENFTKYIAKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAP-FTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVV-----KMNVHYKSFID------------RNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKR 1115
            M  EN T Y     +C  +   + I    ++ + L  +  +T + N +V+ A    + L     YLI +LAV D L+ + V+PFS    + + WI G A+C+ W ++D+ CCT SI  L  I++DRY  IT  ++     T +   + I ++W IS  +S+ P F      N  +  +I++             + I+ST  +FY+P  +I+ILY+ IY AA     +     +   Q  +V+      + +  KSF D            RN  +      +   +K +  R ERKAA TLG+++G F+ICWLPFF+   +  +CE+C ISD++ + + WLGY NSL NP+IY+  N ++K AF +L+ C+ 
Sbjct:    1 MDIENLTDY-----NCTSEHLQKGITPKILISLTLSILTLMTTAINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIMYIMKETWIMGQAICDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAAFMIAVVWIISIFISMPPLFWRHQALNKEDECIIKH---------DHIVFTIYSTFGAFYIPLALILILYYKIYKAAKTLYHKRSVSRVEREQNGQVLLDATTTLCIAEKSFSDHSTDFDKIHITVRNARVEMKQEKAYRKQKISSTR-ERKAATTLGLILGAFVICWLPFFVKEVIVNICESCYISDDMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQKLMRCRH 358          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 248.44 bits (633), Expect = 9.518e-78
Identity = 140/350 (40.00%), Postives = 214/350 (61.14%), Query Frame = 3
Query:   81 AKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQ 1130
            ++ S+C H     NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P      +   + ++        C++N   GYV+FS L SFYVP  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       ++ + + +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   N K  + +F  +FWLGY NS  NP+IY C+++E+K AF  +L  +    RQ
Sbjct:    9 SEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETI--------CQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQ 350          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 248.44 bits (633), Expect = 2.823e-77
Identity = 140/350 (40.00%), Postives = 214/350 (61.14%), Query Frame = 3
Query:   81 AKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQ 1130
            ++ S+C H     NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P      +   + ++        C++N   GYV+FS L SFYVP  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       ++ + + +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   N K  + +F  +FWLGY NS  NP+IY C+++E+K AF  +L  +    RQ
Sbjct:    9 SEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETI--------CQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQ 350          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 248.44 bits (633), Expect = 2.823e-77
Identity = 140/350 (40.00%), Postives = 214/350 (61.14%), Query Frame = 3
Query:   81 AKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQ 1130
            ++ S+C H     NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P      +   + ++        C++N   GYV+FS L SFYVP  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       ++ + + +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   N K  + +F  +FWLGY NS  NP+IY C+++E+K AF  +L  +    RQ
Sbjct:    9 SEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETI--------CQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQ 350          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 248.44 bits (633), Expect = 2.823e-77
Identity = 140/350 (40.00%), Postives = 214/350 (61.14%), Query Frame = 3
Query:   81 AKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQ 1130
            ++ S+C H     NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P      +   + ++        C++N   GYV+FS L SFYVP  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       ++ + + +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   N K  + +F  +FWLGY NS  NP+IY C+++E+K AF  +L  +    RQ
Sbjct:    9 SEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETI--------CQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQ 350          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Mouse
Match: Adra1b (adrenergic receptor, alpha 1b [Source:MGI Symbol;Acc:MGI:104774])

HSP 1 Score: 235.343 bits (599), Expect = 2.697e-72
Identity = 145/362 (40.06%), Postives = 212/362 (58.56%), Query Frame = 3
Query:   45 NEMKSENFTKYIAKFSD-CFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCN--CEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQS---NHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCK 1112
             E+K  NFT      S+    Q+ V     +  VG+ L + I   I GNI+V+++   N++L   T Y I NLA+ADLLL   VLPFSA   +   W+ G   C+ W A+DV CCTASI SLC ISIDRYIG+   L+   ++T+R+ I A++ +W +S V+S+ P           L   E   N +  C V     Y +FS+L SFY+P  +I+++Y  +Y+ A + ++ L+ G +     S+ + + +H K+F +     T++   N  SS   K   F +E+KAAKTLGIVVG+FI+CWLPFFI LPL +L    K  D +F  +FWLGY NS  NP+IY C+++E+K AF ++L C+
Sbjct:   18 GELKDANFTGPNQTSSNSTLPQLDVTR---AISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPL----------LGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRILGCQ 366          
BLAST of Alpha-1A adrenergic receptor vs. UniProt/SwissProt
Match: sp|P97718|ADA1A_MOUSE (Alpha-1A adrenergic receptor OS=Mus musculus OX=10090 GN=Adra1a PE=1 SV=3)

HSP 1 Score: 248.44 bits (633), Expect = 1.975e-76
Identity = 140/350 (40.00%), Postives = 214/350 (61.14%), Query Frame = 3
Query:   81 AKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQ 1130
            ++ S+C H     NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P      +   + ++        C++N   GYV+FS L SFYVP  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       ++ + + +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   N K  + +F  +FWLGY NS  NP+IY C+++E+K AF  +L  +    RQ
Sbjct:    9 SEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETI--------CQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQ 350          
BLAST of Alpha-1A adrenergic receptor vs. UniProt/SwissProt
Match: sp|P43140|ADA1A_RAT (Alpha-1A adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra1a PE=1 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 5.933e-76
Identity = 142/350 (40.57%), Postives = 213/350 (60.86%), Query Frame = 3
Query:   81 AKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQ 1130
            ++ S+C H     NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W +S V+S+ P     F         E +    C++N   GYV+FS L SFYVP  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       ++ + + +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   + K S+ +F  +FWLGY NS  NP+IY C+++E+K AF  +L  +    RQ
Sbjct:    9 SEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPL----FGWRQPAPEDETI----CQINEEPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNVPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQ 350          
BLAST of Alpha-1A adrenergic receptor vs. UniProt/SwissProt
Match: sp|P18130|ADA1A_BOVIN (Alpha-1A adrenergic receptor OS=Bos taurus OX=9913 GN=ADRA1A PE=2 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 6.277e-75
Identity = 139/338 (41.12%), Postives = 208/338 (61.54%), Query Frame = 3
Query:   90 SDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL 1103
            S+C H     NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T++R + A++ +W++S V+S+ P     F         E +    C++N   GYV+FS L SFYVP  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       +T + + +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   + + S+ +F   FWLGY NS  NP+IY C+++E+K AF  +L
Sbjct:   12 SNCTHPPPPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNVWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPL----FGWRQPAPEDETI----CQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAQVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFRPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVL 341          
BLAST of Alpha-1A adrenergic receptor vs. UniProt/SwissProt
Match: sp|O02824|ADA1A_RABIT (Alpha-1A adrenergic receptor OS=Oryctolagus cuniculus OX=9986 GN=ADRA1A PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.082e-74
Identity = 137/338 (40.53%), Postives = 206/338 (60.95%), Query Frame = 3
Query:   90 SDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL 1103
            S+C H     NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI SLC+ISIDRYIG++ PL+   I+T+RR + A++ +W+ S V+S+ P          + ++        C++N   GYV+FS L SFYVP  II+ +Y  +Y+ A ++SR LK G       SE V + +H K+       +  + + +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   + K  + +F  +FWLGY NS  NP+IY C+++E+K AF  +L
Sbjct:   12 SNCTHPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIISLCVISIDRYIGVSYPLRYPTIVTQRRGLRALLCVWAFSLVISVGPLFGWRQPAPDDETI--------CQINEEPGYVLFSALGSFYVPLTIILAMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGVASAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVL 341          
BLAST of Alpha-1A adrenergic receptor vs. UniProt/SwissProt
Match: sp|P35348|ADA1A_HUMAN (Alpha-1A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1A PE=1 SV=2)

HSP 1 Score: 240.736 bits (613), Expect = 1.967e-73
Identity = 140/353 (39.66%), Postives = 212/353 (60.06%), Query Frame = 3
Query:   90 SDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL----YCKRSPNRQRL 1136
            S+C       NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P     F         E +    C++N   GYV+FS L SFY+P  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       +  +   +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   + K S+ +F  +FWLGY NS  NP+IY C+++E+K AF  +L     C++  ++  L
Sbjct:   12 SNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL----FGWRQPAPEDETI----CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHAL 356          
BLAST of Alpha-1A adrenergic receptor vs. TrEMBL
Match: V4AVH7 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_142302 PE=3 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 2.334e-81
Identity = 161/326 (49.39%), Postives = 215/326 (65.95%), Query Frame = 3
Query:  141 VGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGS-EVVKMNVHY-KSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCK 1112
            VGI L S++F+T+ GN++VL+A   N +L  +T Y I NLA+ADLLLG CVLPFSA+  +   W FG   C+ W A+DV CCTASI SLC+ISIDRYIG+TRPL+ + I+T++R  Y IILIW +S  +S+AP        L       +     C V +  GYV+FS   SFY+P +III++Y  IY  A K SR L  G   S     E V++ +H  ++     + +T   H  +   K A F++E+KAAKTLGIVVGVFI+CW PFF +LPL +LC  C+I ++LF  IFWLGYCNSL NPVIY+C++RE+K AF ++L CK
Sbjct:   27 VGIILGSIVFMTVGGNVLVLLAVFVNSHLRSTTNYFIVNLAIADLLLGTCVLPFSASLEVLNFWAFGQIFCDIWAAIDVLCCTASIMSLCVISIDRYIGVTRPLQHSSILTEKRAFYIIILIWLLSISISVAP--------LVGWKEPPDPDPLICSVTTNLGYVLFSVAGSFYIPLLIIIVVYIRIYREAVKNSRFLSTGVRTSKIDECEGVQLRIHMGRTCTQPGRKVT---HRMTLAGKVAKFKREKKAAKTLGIVVGVFILCWFPFFFILPLGSLCPVCEIPEDLFKVIFWLGYCNSLMNPVIYACSSREFKRAFKRILTCK 341          
BLAST of Alpha-1A adrenergic receptor vs. TrEMBL
Match: E9HUC1 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_66063 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.413e-79
Identity = 153/345 (44.35%), Postives = 206/345 (59.71%), Query Frame = 3
Query:  129 ISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGF-----ILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAI------FRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQ 1130
            +S VV + L  ++ LTI GN+++L A   N NL   T  LIANLAVADLLLG  VLPFSA   +   W FG   C+ W A+DV CCTASI SLC+IS+DRYIG+TRPL    I+T +R     +++W  S  +S+ P      R L    ++++     C VN    YV+FST+ SFY+P +II+ +Y  IY  A KQ++ L+ G        S  GSEV+ + VH         V T +      +R   +      FR+++KAAKTLGIVVG F++CW PFF++LP++ALC  C I   LF C FWLGYCNS  NP IY+ T+RE+K AF ++L   R   +Q
Sbjct:    1 MSLVVAVALSVIVLLTIGGNLLILAAVLFNSNLRGPTHILIANLAVADLLLGFLVLPFSATLEVTGNWYFGPIFCDVWAAVDVLCCTASIMSLCVISVDRYIGVTRPLNYYSIVTAKRSTVLCLIVWISSLSISIGPLLGWKERML----LLDSAELQACNVNKEKAYVLFSTIGSFYLPTLIILAIYWRIYRTAVKQTKFLESGTKTDKSTSSLSGSEVLTLRVHVGRANPMKTVATTTVGHHHHHRPTGLSAKMFKFRRQKKAAKTLGIVVGAFLLCWFPFFVILPVEALCSTCNIPSPLFSCCFWLGYCNSCLNPFIYASTSREFKRAFSKILCDCRGGQQQ 341          
BLAST of Alpha-1A adrenergic receptor vs. TrEMBL
Match: A0A1J0F5Z2 (Alpha-1 adrenergic receptor OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 2.820e-76
Identity = 154/361 (42.66%), Postives = 215/361 (59.56%), Query Frame = 3
Query:  102 HQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGF--ILSNQGSEVVKMNVHYKSFIDRNK-----------------VITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYC--KRSP 1121
             +I +  +   T+ G+ L +++ +T+ GN++VL+A   N +L  +T + I NLA+ADLLLG  VLPFSA+  +   W FG   C+ W A+DV CCTASI SLC+ISIDRYIG+TRPL+ + I++++R  Y II +W +S  +S+AP        L       N     CEV    GYV+FS   SFY+P  II+I+Y  +Y  A  QSR L  G     +N     + + +H        K                    ++N   +   K A F++E+KAAKTLGIVVGVFI+CW PFF +LPL+ALCE+C I   LF  IFWLGYCNS+ NP+IY+C++RE+K AF ++L C  +R P
Sbjct:   69 EKINILGLIGMTLSGVTLGTIVLMTVCGNVLVLLAVFVNSHLRSTTNFFIVNLAIADLLLGTLVLPFSASLEIVNYWAFGQLFCDIWAAVDVLCCTASIMSLCVISIDRYIGVTRPLQHSTIVSEKRAFYTIISVWLLSSAISVAP--------LLGWKDPPNPDPRVCEVTKQLGYVLFSVAGSFYIPLAIILIVYFRVYREALLQSRCLATGMKTAKANDSKNEITLRIHTGKPSKVTKPSGPGFQSSSSSEHSEGSSKKNNSKLTLAGKMAKFKREKKAAKTLGIVVGVFILCWFPFFFILPLEALCEDCHIPGWLFKIIFWLGYCNSMMNPIIYACSSREFKRAFIRILRCQWRRRP 421          
BLAST of Alpha-1A adrenergic receptor vs. TrEMBL
Match: Q8BUE5 (Alpha-1A adrenergic receptor OS=Mus musculus OX=10090 GN=Adra1a PE=1 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.973e-74
Identity = 140/350 (40.00%), Postives = 214/350 (61.14%), Query Frame = 3
Query:   81 AKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQ 1130
            ++ S+C H     NI  + ++G+ L  +I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W FG   CN W A+DV CCTASI  LCIISIDRYIG++ PL+   I+T+RR + A++ +W++S V+S+ P      +   + ++        C++N   GYV+FS L SFYVP  II+++Y  +Y+ A ++SR LK G       SE V + +H K+       ++ + + +  + +   F +E+KAAKTLGIVVG F++CWLPFF+++P+ +   N K  + +F  +FWLGY NS  NP+IY C+++E+K AF  +L  +    RQ
Sbjct:    9 SEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETI--------CQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQ 350          
BLAST of Alpha-1A adrenergic receptor vs. TrEMBL
Match: A0A061QLS3 (Putative alpha-1A adrenergic receptor OS=Cupiennius salei OX=6928 GN=CSH_0218 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 2.156e-74
Identity = 151/339 (44.54%), Postives = 203/339 (59.88%), Query Frame = 3
Query:  144 GICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLF-KLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGF-ILSNQGSEVVK---MNVHYKSFIDRNKVITQSNHSSSSNRKCAI-------------FRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLY 1106
            G  L ++I LTI GN++VL+A     NL  +T   I NLAVADLLLG+ VLPFSA   L  K WIFG+  CN W A+DV CCTASI SLC+IS+DRY+G+TRPL  + I+T  R I A   +W +S  +S+ P          N  V        CEV    GYV+FS   SFY+P  II ++Y  IY AA KQ++ L+ G  ++ + G E  K   + VH  +    + V++ +  + +   K +I             F++++KAAKTLGIVVGVFI+CW PFF +LPL  LC  C I D LFD  FW GY NS  NP+IY+C++R++K AF  +L+
Sbjct:   62 GTVLATIILLTIFGNLLVLLAVGFTSNLRSTTNIFIVNLAVADLLLGLSVLPFSAFLELNNKQWIFGTTFCNIWAAVDVLCCTASIISLCVISVDRYVGVTRPLAYSNIVTHTRAIIACFAVWIVSTAISVGPLFGWKEPRPPNPYV--------CEVTKQLGYVLFSVTFSFYLPSAIIFLVYFRIYKAAVKQTKFLETGVKVVKSAGHETTKELTLRVHAGA----HHVLSAAARNGTYGDKTSIKMTVANLQGRLAKFKRQKKAAKTLGIVVGVFILCWFPFFFILPLGTLCRQCYIPDLLFDIFFWTGYFNSCLNPIIYACSSRDFKRAFRSVLH 388          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Cavefish
Match: ADRA1D (adrenoceptor alpha 1D [Source:NCBI gene;Acc:103027862])

HSP 1 Score: 235.728 bits (600), Expect = 5.016e-72
Identity = 139/333 (41.74%), Postives = 204/333 (61.26%), Query Frame = 3
Query:  138 VVGICLFSVIFLTIS--GNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFID------RNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCK 1112
            VV + +F  IF+T++  GNI+V+++   N++L   T + I NLA+ADLLLG+ VLPFSA+  +   W+FG   CN W A+DV CCTASI SLCIIS+DRY+G+   L+   I+T+R+    +++IW  S V+S+ P          + SV        C +    GY +FS+L SFY+P  +I+++Y  +Y+ A + SR L+ G       S  V + +H +S  +      R++   Q   SS S R    F +E+KAAKTL IVVG+F++CWLPFF +LPL +     K SD +F  IFWLGY NS  NP+IY C+++E++ AF +LL C+
Sbjct:   55 VVAVGVFLAIFITVAIVGNILVILSVLCNRHLRTVTNFFIVNLAIADLLLGVVVLPFSASLEVLGCWVFGRVFCNIWAAVDVLCCTASILSLCIISVDRYVGVKYCLRYPTIMTERKAGVILVVIWVASAVISIGPLLGWKEPPPADESV--------CSITEEPGYALFSSLFSFYLPLSVILVMYFRVYVVARRTSRSLEAGVKRERGTSTDVVLRIHCRSLPEEALEHSRSRGRGQPFRSSLSVRLMK-FSREKKAAKTLAIVVGMFVLCWLPFFFVLPLGSFFPALKPSDMVFKVIFWLGYFNSCINPIIYPCSSKEFQRAFTRLLRCQ 378          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Cavefish
Match: adra1aa (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:103024013])

HSP 1 Score: 231.106 bits (588), Expect = 1.317e-70
Identity = 145/373 (38.87%), Postives = 219/373 (58.71%), Query Frame = 3
Query:   57 SENFTKYIAKF--SDCFHQIQVE-NIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQG-FILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAI----FRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL--YCKRSPNRQRLPLH 1145
             EN T  I+    ++C   +  E N+  + V+GI L   I   + GNI+V+++   ++NL   T Y IANLAVADLLL   VLPFSA   +   W+FG A C+ W AMDV CCTASI SLC IS+DRYIG++ PL+   I+T+RR + A++ +W++S  +S+ P          + +V        C++    GY IFS + SFY+P ++I+++Y  +Y+ A +++R L++G     +  +E V + +H      R       + +  S    A+    F +E+KAAKTLGIVVG F++CWLPFF++LP+ ++    + SD +F   FWLGY NS  NP+IY C+++E+K AF  +L  +C R   R   P H
Sbjct:   12 GENMTPGISAQNCTNCSQVLVPELNVTKAVVLGIVLAIFIVFGVMGNILVILSVACHRNLRTVTHYFIANLAVADLLLSSTVLPFSAIFEMLGHWVFGRAFCDVWAAMDVLCCTASIMSLCAISVDRYIGVSYPLRYPTIVTERRALLALMGVWALSITISVGPLFGWKEPAPEDETV--------CKITEEPGYAIFSAVGSFYLPLVVILVMYCRVYVVARRETRGLRKGQKTEKSDHAEAVTLRIH------RGNTSASEDEALRSRTHFALRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPAYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVLGVHCLR---RTPTPTH 367          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Cavefish
Match: adra1ba (adrenoceptor alpha 1B [Source:NCBI gene;Acc:103033427])

HSP 1 Score: 223.787 bits (569), Expect = 1.518e-67
Identity = 128/326 (39.26%), Postives = 193/326 (59.20%), Query Frame = 3
Query:  141 VGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHS--SSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCK 1112
            + + L + I   I GNI+V+++   N++L   T Y I NLA+ADLLLG  VLP SA   +   W+FG   C+ W A+DV CCTASI SLC+ISIDRYIG+  PL+   I+T++R + A++ +W ++ V+S+ P        L       +  +  C +     Y +FS+L SFY+P  +I+ +Y  +Y+ A + +R L+ G +     S  + + +H K    + +       +  SS   K   F +E+KAAKTLG+VVG+FI+CWLPFF+ LP+ +   N +  +  F  IFWLGY NS  NP+IY C +RE+K AF ++L C+
Sbjct:   48 LAVVLGAFIVFAIVGNILVILSVVCNRHLRIPTNYFIINLAMADLLLGTTVLPVSATLEILNYWVFGRIFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPSIVTEKRALLAMLGVWVLATVISIGP--------LLGWKEPPSDDDTICPITEEPFYALFSSLGSFYIPLAVILAMYCRVYIVAKRTTRNLEAGVMKERMDSSELTLRIHCKGAQAQEECGGAGKGTIRSSLTVKLLKFSREKKAAKTLGVVVGMFILCWLPFFLALPIGSFNANLRPPETFFKVIFWLGYFNSCLNPIIYPCYSREFKQAFIRILRCQ 365          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Cavefish
Match: adra1ab (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:103037444])

HSP 1 Score: 209.534 bits (532), Expect = 2.030e-62
Identity = 127/329 (38.60%), Postives = 189/329 (57.45%), Query Frame = 3
Query:  120 NIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHY-KSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL 1103
            N+  +  +G+     +   + GNI+V+++   +++L   T Y IANLA+ADLLL   VLPFSA   L   W+FG  LC  WTA+DV CCTASI SL +ISIDR + ++ PL+   + T  R + A+  +W +S  +S+ P     F     +   E++    C VN   GY IFS   SFYVP  +I+++Y  +Y+ A ++SR L++G  L      +   N        D +  +     S  S  +   F +E+KAAKTLG+VVG FI+CWLPFF++LP+ ++  + +  + +F   FWLGY NS  NP+IY C ++E+K AF  LL
Sbjct:   29 NLPKAVAMGLVFTLFVIFGVMGNILVILSVACHRHLRSVTHYFIANLAMADLLLSSTVLPFSAFSELLGRWVFGRMLCCAWTALDVLCCTASILSLSVISIDRCVAVSYPLRYPSLATSGRGLGAVAAVWGLSAAISVGPL----FGWREPMPEDESV----CRVNEDPGYAIFSAACSFYVPLTVILVMYCRVYVVARRKSRSLREGRQLGGGSLRIHCGNTQRCSDHRDGHITVVGKCRSHFSLLRLLKFSREKKAAKTLGVVVGCFILCWLPFFLVLPISSIFPSHRPPETVFKITFWLGYFNSCLNPIIYPCFSQEFKKAFQNLL 349          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Cavefish
Match: htr7c (5-hydroxytryptamine (serotonin) receptor 7c [Source:ZFIN;Acc:ZDB-GENE-060526-5])

HSP 1 Score: 190.66 bits (483), Expect = 4.620e-56
Identity = 129/374 (34.49%), Postives = 197/374 (52.67%), Query Frame = 3
Query:   24 QNLIHLHNEMKSENFTKYIAKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFK-LWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFIL---LPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCK-RSPNRQ 1130
            Q+L   H   ++++  +   + + C  +  V       V+G+CL  V  LT+ GN +V+IA    K L   + YL+ +LA ADL +   V+PF+    L    W+FG   CN + AMDV CCTASI +LC+IS+DRY+GITRPL        + +   I  +W +S  ++L PF     +N+    V        C ++  + Y I+ST V+FY+P ++++ +Y+ I+ AA K     K  F    +  ++     H     +    +  S   S   +  +IF++E+KAA TLG++VGVF ICWLPFFIL    P     E   I   L   + W GY NSL NP IY+  NR+ ++ +  LL C+ R+ NR+
Sbjct:    5 QSLWSTHRPTRADS-ARAAMRNASCAEEPLVFGALERVVIGVCLGCVSALTVMGNALVVIAVCVVKKLRQPSNYLLVSLAAADLSVATVVMPFAIVTDLTGGQWLFGQVFCNIFIAMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMIFGVWLVSASITLPPFCGWA-KNINTAGV--------CLISQDFSYTIYSTAVAFYIPMLVMLFMYYKIFKAARKSGA--KHRFTSIVRSLDLPPPQHHGTGVAEECAAL--SRLLSPERQNMSIFKREQKAATTLGVIVGVFSICWLPFFILSTARPFICGVECSCIPIWLERMLLWFGYANSLVNPFIYAFFNRDLRSTYKDLLRCRYRNINRR 364          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Sea Lamprey
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 183.341 bits (464), Expect = 1.356e-54
Identity = 115/320 (35.94%), Postives = 173/320 (54.06%), Query Frame = 3
Query:  183 GNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILS-NQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLK--ALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQR 1133
              I+V+++   NK+L   T Y I NLA ADLLL   VLPFSA   +   W+FG   C+ W A+DV CCTASI SLC I +                     +  +I +W ++ V+S+ P          + +V        CE+    GY +FS + SFY+P +I++ +Y  +Y+AA +Q++ L++G     +  SE V +     + ++           SS + +   F +E+KAAKTLGIVVGVFI+CWLPFFI LP+   +   + + S  +F  +FWLGY NS  NP+IY C+++E+K AF + L C     ++R
Sbjct:   53 ATILVVLSVVCNKHLRTVTNYFIINLASADLLLSTTVLPFSATFEILGYWVFGRIFCDIWAALDVLCCTASIMSLCAIRV---------------------LLILIAVWVLAIVISVGPLLGWKEPAPPDETV--------CEITEVPGYALFSAMGSFYIPLVILLAMYCRVYVAARRQTKSLEEGIKRERSSSSEEVTLKEKKAAVLE-----IYGLFRSSLSVRFMKFSREKKAAKTLGIVVGVFILCWLPFFIALPIAPGSFFPSVRPSQTVFKVVFWLGYFNSCINPLIYPCSSQEFKRAFLRALRCHCREGQRR 338          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 155.221 bits (391), Expect = 4.535e-43
Identity = 115/373 (30.83%), Postives = 170/373 (45.58%), Query Frame = 3
Query:  186 NIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASK-----QSRQ-----------------------------------LKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSS----------------NRKCAIFR----QERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPN 1124
            N +V+ A    + L     YLI +LAVADLL+   V+P +AA  +   W  G ALC+ W ++DV CCTASI  LC I++DR+  IT   +     T  R    I   W ++  +S+ P             +IE+             Y I+ST  +FYVP  +++ LY  I+ AA +     +S+Q                                   L Q F +S   S    +    +S   +  V   +  S  S                 R C   R    +ER+AAKTLG+++G F++CWLPFFI   +  LC++C +S E+ D + WLGY NSL NP+IY+  N ++K+AF +L+   R P 
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLFWRRRDPAKPRCIIEHDHVL---------YTIYSTFGAFYVPLALLLALYCRIFRAAKRLYEKRESKQREKLSVSAESAVSLEQPSQSQHQQQQQQPAGKLFRLPQPFCMSETSSSDQTLAQAERSGQHQQSVSAVARRSKRSLRPPRSVRFMSARLDQRRPCLQERISGSRERRAAKTLGLILGAFVVCWLPFFIKELVVNLCKSCAVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLV--SRQPR 426          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Sea Lamprey
Match: si:dkey-247m21.3 (si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-249])

HSP 1 Score: 140.584 bits (353), Expect = 2.573e-38
Identity = 114/359 (31.75%), Postives = 169/359 (47.08%), Query Frame = 3
Query:  111 QVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVP-STVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGIT-RPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIE-------------NLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQ---LKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQR 1133
            Q E   ++ +  I    +I +TI GN++V++A  K+++L    T Y I +LAVADLL+ I V+PF A + +   W +G   C   T+ DV   TASI  LC I++DR+  I  +PL     +T  R+   +   W +  ++S  P       N  N+  IE             N  +C   VN    Y +  +LV+FY+P  ++   Y  IY+ A   +RQ   L++       G E                V TQS            FR E KAAKTL I++G F +CW PFFI   +     N     +L+D   WLGY NS  NP++Y+  NR ++ AF  +L C  +   +R
Sbjct:   16 QAEKYILAGIFSI----IIAVTILGNLLVVVAVCKDRHLRKIKTNYFIVSLAVADLLVAILVMPFGAVERVQNDWPYGDKFCIIRTSFDVMFTTASIMHLCCIALDRFYAICCKPLVYQNKMTPLRVGLMLGACWVVPSLISFIPIA-----NGWNIIGIEQQLELRLGQAKEANQTHCIFMVNKV--YAVACSLVAFYIPLGLMAAAYQRIYVTARAHARQIGSLQRAVSKDTTGDEA-------------TMVQTQSTR----------FRHETKAAKTLAIIMGCFCLCWAPFFINNVIDPFV-NYDTPQQLWDAWLWLGYANSALNPLLYAFLNRSFRRAFLAILCCWDAARYRR 339          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000271.1 (pep scaffold:Pmarinus_7.0:GL476504:17018:19617:1 gene:ENSPMAG00000000243.1 transcript:ENSPMAT00000000271.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.428 bits (350), Expect = 3.705e-38
Identity = 94/315 (29.84%), Postives = 157/315 (49.84%), Query Frame = 3
Query:  171 LTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFIL-LPLKAL-CENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYC 1109
            +T+ GN  VL+     + L   T   I +LA ADLL+   V+PFS    +  +WIFG   C  W + DV  CTASI +LC IS+DRY  +T P      ++ +R I   + IW  S ++S  P T    +    +  +   A   C   + W +V+ ++ ++FY+P + +  +Y  +Y A+     +LK   + S        +++HY             N    +N +      E KA +T+ I++  F++CWLP+F+  + + A   ++ ++   +F  + WLGYCNS  NPV+Y+  NR+++ A   L  C
Sbjct:   36 VTLFGNAAVLLCPLVERRLRTVTYMFIMSLATADLLVACLVMPFSIIYEVTGVWIFGELFCKVWISFDVMFCTASIVTLCFISLDRYCSVTTPNHYPTRMSGKRCIAMTVSIWVYSLLISFLPVT----QGWNEIPGVRFDARRECLFITNWAFVLVASTLAFYLPFLAMCTMYFFVYRAS-----RLKAARVASQ------TLDIHY-----------HPNSQRPNNPQL-----ENKATRTMSIIISAFVMCWLPYFVFNVAMNAYGSKHDRVVVTMFKIMTWLGYCNSAINPVLYAFLNRDFQHALKTLFLC 319          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006872.1 (pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1 gene:ENSPMAG00000006208.1 transcript:ENSPMAT00000006872.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 3.059e-35
Identity = 94/329 (28.57%), Postives = 160/329 (48.63%), Query Frame = 3
Query:  141 VGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXX-XXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDEL----FDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCK 1112
            VG  L  +  +T+ GN++V +     K L   T   I +LA ADLL+   V+PFS    +   W+FG   C  W + DV  CTASI +LC IS+DRY  ++ P +  +    ++I +     IW  S ++S  P      R    +  ++  ++  C   +   + + ++ ++FY+P +++  +Y  IY A+     +LK   I+S        +++HY              H  S  R+    + E KA +T+ I++  F++CWLP+F          N + S  +    F  I WLGYCNS  NP++Y+  NR+++ A  ++  C+
Sbjct:   21 VGSLLSVIDLVTLLGNLVVFVCPVLEKRLRTVTYMFIMSLATADLLVACLVMPFSIIYEVTGRWMFGRIFCKVWISFDVMFCTASIVTLCFISLDRYCSVSAPHRYTLPKEPKKICVAMTAAIWVYSSLISFLPV----MRGWNEIPGLDFDSSRECVFVTNRTFAVVASALAFYIPFLVMCTMYFFIYRAS-----RLKAARIMSQT------LDIHY--------------HPKS--RRPNNLQLEHKATRTMSIIISAFVLCWLPYFFFNVFIGFYSNNEDSAHVVQMAFKVITWLGYCNSAINPMLYAFLNRDFQHALRKIFICR 318          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Nematostella
Match: EDO37207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGH3])

HSP 1 Score: 143.665 bits (361), Expect = 1.090e-39
Identity = 100/315 (31.75%), Postives = 155/315 (49.21%), Query Frame = 3
Query:  174 TISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAP-FTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKR 1115
            +I GNI++L+A K+ ++L   T   IANLAVAD LL +  +PF+   ++   WIFG   C      +   C AS+ SL  +SIDRY  I  PLK  +++T R     +  +W  S +    P F    +  +TN S+      C  E  S+  Y +F     F+ P +++   Y+ I LAA + +RQ+           +V  +    K+ +        +N       + A F+ + KAAKTL IV+G F+ CW P FI +    L  +C+  D  F    WL   NS CNP++Y   NR ++ +F +++ C R
Sbjct:    1 SILGNILILLAIKRTRSLQSITSVFIANLAVADFLLAVIGMPFTMTSSITYDWIFGPFWCKLNGMANSVFCIASMLSLAAVSIDRYFAIITPLKYPMLMTPRMAFMLVAWVWLQSLLCGFLPIFGWCRYTYITNESI------CTAEWGSSIPYTMFIFGACFFAPLLVMFYSYYHILLAARRHARQM---------ALKVGDIATPLKTAVAITLPSADNNAKRKREEREAKFKSDTKAAKTLLIVMGTFLFCWSPHFIGMTC-LLFPSCQWPDWFFATTTWLAMMNSGCNPILYGVLNRRFRRSFIEIICCGR 299          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Nematostella
Match: EDO35278 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM06])

HSP 1 Score: 122.094 bits (305), Expect = 6.283e-32
Identity = 100/330 (30.30%), Postives = 153/330 (46.36%), Query Frame = 3
Query:  153 LFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKL-WIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAW------GYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALC--ENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKR 1115
            L  ++ +++SGNI+V++A K  + L   T Y + +LA+AD+L+ +  +P  AA  L    WIF   L   WT +D+ C  ASI +L  ISI+R I IT PL  +                           TMT  R +  + +    A     V   W       Y +  ++  F++P  I+   YH I+ AA  Q+RQ+          + VVK  V       RN  ++                 E +AAKTL +V+G FI+ W PFFI+  +   C  +NC I       + W+ Y NS  NP++Y+C N+E++ AF  +L C+R
Sbjct:    3 LLFIMIMSLSGNILVILAFKTYRKLRTKTNYFVVSLAIADILVSLFSMPIWAAYLLTGPNWIFSETLQRIWTGVDILCGVASIINLAAISIERCICITHPLTYHT--------------------------TMTSRRAINIIVINWIFAFIMSTVKIIWYTLERPYYELIISISCFFIPLFIMCFSYHLIFKAARYQARQI----------ALVVKGGV-------RNFFLS----------------TEVRAAKTLAVVMGTFIVSWGPFFIINLVWGFCGEDNC-IPPTTVMVVKWMHYSNSFYNPIVYACMNKEFRGAFANIL-CRR 271          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Nematostella
Match: EDO40999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M0])

HSP 1 Score: 119.783 bits (299), Expect = 2.377e-30
Identity = 107/345 (31.01%), Postives = 173/345 (50.14%), Query Frame = 3
Query:   99 FHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKL-WIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFD---------CIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL 1103
            FH   V NI IS      +  ++FL + GN++V +A  + + L   T YLI +LAV+DLL+    +PF    TL  + W  G ++C FW  +D  C  ASI +L +I+IDRY+ ++ P      + K R   AI+ +W  +FV+  A  ++T+  +        N +   C     + Y  F+  +SF++P +++II Y  ++  A KQ+  +++     +QG    +      S     +  T+ N      R+ +I R E KA KTL IV+G FI CW PFFI++ +   C +C  +  L            ++ L   NS  NP+IYS  N +++ AF  +L
Sbjct:   20 FHS-SVYNIIISQPKAGFVVVILFLDLFGNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVI--ASLSLTEPWSPDGF----NASFPACAKMDKYYYA-FAITMSFFLPLVVLIIAYSMVFKVARKQACLVRRA--NDSQGHLEYRTETSVVSSFRETQ--TRENTRKKRRRRKSIVR-ELKATKTLSIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQMTIGTVFVYVLPLLNSAANPIIYSKFNADFRLAFKDIL 351          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Nematostella
Match: EDO35213 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM59])

HSP 1 Score: 117.857 bits (294), Expect = 2.440e-30
Identity = 106/336 (31.55%), Postives = 149/336 (44.35%), Query Frame = 3
Query:  138 VVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGS----------ALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANC-NCEVNSAWGYV-IFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYC 1109
            V+ + L +VI L ++GN +V IA  ++ NL   TV  I +LAV D+L+    +P         +W++             L   W  +DV   TASI +LC ISIDR   IT+PL  + I                          MT  R L  L+ I   A   +  V + W Y  +F  +V+F  P I++I  Y  I+  A  Q+R++                                        R+   F++E KAAKTL IV+G FI CW PFF L  L    EN KIS +    I +L Y +S  NPVIYSCTNRE++   +++L C
Sbjct:   22 VISVALIAVIMLALAGNTVVCIAFYRSSNLQSLTVLFILSLAVTDILVASISMP---------IWLYFQFSHSSFTCLPDLFTAWKCLDVLFSTASIMNLCAISIDRQFAITKPLHYHTI--------------------------MTTKRALFALTGISLYAVVLSGLVATRWSYYPLFIFIVAFISPLIVMIQAYSHIFKTALMQARRVYP-------------------------------------IRQAYYFKKELKAAKTLAIVMGSFIACWAPFF-LANLIVQYENVKISPDTVTGIKFLHYVSSALNPVIYSCTNREFRLKIFRVLPC 284          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Nematostella
Match: EDO31890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM7])

HSP 1 Score: 116.701 bits (291), Expect = 1.350e-29
Identity = 93/343 (27.11%), Postives = 157/343 (45.77%), Query Frame = 3
Query:  147 ICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCN--------FWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANC-----------NCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQL-KQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCE-NCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCK 1112
            + L SV+ L++ GN +VL+A K+ + L   T Y + +LA ADLL+ +  +P     T+  L I  +   N         W  +++   TASI+SLC+I  DR++ I+ PL  +                            MT  R L  ++     A C           + +  S   Y  F +L +F++P +II+  Y  I++ A  Q+++L K+ ++    G+E                             + ++FR+E K  KTL +V+G F++CW PFF ++   ALC  +C     L     WL YC++  NP+IY+   R ++ AF ++L+C+
Sbjct:   26 VALASVMVLSVFGNSLVLVAFKRYRRLRTVTNYFLVSLAAADLLVSMLTMP--CWLTIRVLEISEAPRGNPNHVVPYYIWQYVEILGSTASITSLCVIGYDRHLAISAPLTYHAR--------------------------MTSRRALVAITCCWVYAACCAALSFVNISPSIQPTSGIFYAWFISLAAFFMPLVIILSFYCRIFIIAVGQAKKLSKEPYV---YGTE---------------------------KERRSVFRRELKITKTLAVVIGAFVVCWAPFFTIIIRFALCSPHCTTDPALISVSKWLHYCSTFINPIIYTLLTRGFRRAFTRVLWCR 310          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Medaka
Match: adra1aa (alpha-1A adrenergic receptor [Source:NCBI gene;Acc:101157705])

HSP 1 Score: 239.195 bits (609), Expect = 1.213e-73
Identity = 145/350 (41.43%), Postives = 211/350 (60.29%), Query Frame = 3
Query:   90 SDCFHQIQVE-NIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHY-KSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL--YCKRSPNR 1127
            S+C H +  E N   + V+G+ L   I   + GNI+V+++   +++L   T Y I NLAVADLLL   VLPFSA   +   W+FG   CN W A+DV CCTASI SLC+IS+DRYIG++ PL+   I+TKRR + A++L+W +S ++S+ P          + +V        C++    GY IFS + SFY+P  II+ +Y  +Y+ A K+SR LK+G       SE V + +H   + +  ++ +    H +    K   F +E+KAAKTLGIVVG F++CWLPFF++LP+ ++    + SD +F   FWLGY NS  NP+IY C+N+E+K AF  LL  +C R   R
Sbjct:   18 SNCSHVLAPELNTVKAVVLGMVLGIFILFGVIGNILVILSVVCHRHLQTVTYYFIVNLAVADLLLSSTVLPFSAIFEILDRWVFGRVFCNIWAAVDVLCCTASIMSLCVISVDRYIGVSYPLRYPAIMTKRRALLAVMLLWVLSVIISIGPLFGWKEPAPEDETV--------CKITEEPGYAIFSAVGSFYLPLAIILAMYCRVYVVAQKESRGLKEGQKTEKSDSEQVILRMHRGNTTVSEDEALRSRTHFALRLLK---FSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPAYRPSDTVFKITFWLGYFNSCINPIIYPCSNQEFKKAFQSLLGVHCLRMTPR 356          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Medaka
Match: ENSORLT00000006865.2 (alpha-1A adrenergic receptor [Source:NCBI gene;Acc:101159926])

HSP 1 Score: 239.195 bits (609), Expect = 2.420e-73
Identity = 130/331 (39.27%), Postives = 199/331 (60.12%), Query Frame = 3
Query:  138 VVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAI------FRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCK 1112
            V+ + L + I   I+GNI+V+++   N++L   T Y I NLA+ADLLLG  VLP SA K +   W+FG   C+ W A+DV CCTASI SLC+ISIDRYIG++ PL+   I+T++R + A++ +W +S V+S+ P        L       +  +  C +     Y +FS+L SFY+P  +I+ +Y  +Y+ A + +R L+ G +     +  + + +H  S +      + +        + ++      F +E+KAAKTLG+VVG+FI+CWLPFF+ LPL +  EN +  + LF  IFWLGY NS  NP+IY C +RE+K AF ++L C+
Sbjct:   49 VLALVLGAFIVFAIAGNILVILSVVCNRHLRTPTNYFIINLAMADLLLGTTVLPVSATKEILNYWVFGRIFCDIWAALDVLCCTASIMSLCVISIDRYIGVSHPLQYPGIVTEKRALLAMLGVWVLSVVISIGP--------LLGWKQPPSDDDMECLITEEPFYALFSSLGSFYIPLAVILAMYCRVYIVAKRTTRNLEAGVMRERMNTSELTLRIHKGSQMHEEPGTSNAGKGRGHQARSSLTVKLLKFSREKKAAKTLGVVVGMFILCWLPFFLTLPLGSFNENLRPPELLFRVIFWLGYFNSCLNPIIYPCYSREFKLAFIRILRCQ 371          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Medaka
Match: adra1d (adrenoceptor alpha 1D [Source:NCBI gene;Acc:101157273])

HSP 1 Score: 229.18 bits (583), Expect = 1.303e-69
Identity = 137/340 (40.29%), Postives = 210/340 (61.76%), Query Frame = 3
Query:  138 VVGICLFSVIFLTIS--GNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFI-DRNKVITQS--NHS--SSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQRL 1136
            VVG+ +F  +F+ ++  GNI+V+++   NK L   T + I NLA+ADLL+ I VLPFSA+  +   W+FG   CN W A+DV CCTASI SLC+ISIDRYIG+   LK   I+T+R+ +  ++L+W  S V+S+ P          + S+        C +    GY +FS+L SFY+P ++I+I+Y  +Y+ A + ++ L+ G       S  V + +H +S + D     ++S  NH   SS + +   F +E+KAAKTL +VVG+FI+CWLPFF+ LP+ ++    K S+ +F  +FWLGY NS  NP+IY C+++E++ AF +LL C+    R+ L
Sbjct:   42 VVGVGIFLSVFILVAIVGNILVILSVVCNKQLQTVTNFFIVNLAIADLLVSIIVLPFSASLEVLGCWMFGRVFCNVWAAVDVLCCTASILSLCMISIDRYIGVKHCLKYPSIMTERKAVAILMLVWVSSLVISVGPLLGWKEPPPVDESI--------CRITEEPGYALFSSLFSFYLPLLVILIMYFRVYVVARRTTKSLEAGVKRERDKSVEVVLRIHCRSVLGDARPASSKSSKNHPFRSSLSVRLMKFSREKKAAKTLAVVVGMFIVCWLPFFLFLPIGSVFPALKPSETVFKVVFWLGYFNSCINPMIYPCSSKEFQRAFIRLLKCQCHQKRRVL 373          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Medaka
Match: ENSORLT00000000867.2 (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:101159125])

HSP 1 Score: 217.238 bits (552), Expect = 1.174e-64
Identity = 135/324 (41.67%), Postives = 198/324 (61.11%), Query Frame = 3
Query:  141 VGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSN-QGSEVVKMNVHYKSFIDRNKVI----TQSNHSSSSNR-----KCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYK 1082
            VG+ L S I   I+GNI+V+++   N++L   T Y I NLA+ADLLL   VLP SA   +   W+FG   C+ W A+DV CCTASI SLC+ISIDRYIG+  PL+  +I+TKRR + A++ +W +SFV+S+ P        L       +  +  C + +   Y +FS+L SFY+P  +I+ +Y  +Y+ A + +R L+ G +    + S  + + +H      RN+ I    TQ    +SS R     K   F +E+KAAKTLG+VVG+FI+CWLPFF++LP+ ++  + +  + LF  IFWLGY NS  NP+IY C +RE+K
Sbjct:   54 VGMVLASFIAFAIAGNILVILSVVCNRHLRSPTNYFIINLAIADLLLSTTVLPVSATLEVLDYWVFGRIFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPMIVTKRRALLAMLGVWILSFVISIGP--------LLGWKEPPSQDDTVCLITAEPFYALFSSLGSFYIPLGVILAMYCRVYVVAKRTTRNLEAGMMKDRAENSNELTLRIHC-----RNQQIQELCTQGGGGASSGRSALTVKLLKFSREKKAAKTLGVVVGMFILCWLPFFLVLPIGSISSSLRPPETLFKVIFWLGYFNSCLNPIIYPCYSREFK 364          
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Medaka
Match: adra1ab (adrenoceptor alpha 1Ab [Source:ZFIN;Acc:ZDB-GENE-060503-384])

HSP 1 Score: 192.586 bits (488), Expect = 5.120e-56
Identity = 130/342 (38.01%), Postives = 190/342 (55.56%), Query Frame = 3
Query:  186 NIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEV--VKMNVHYKSFI-----DRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLY--CKRSP-NRQRLPLHVNMQISNTVETN 1181
            NI+V+++   +      T Y IANLA ADLLL   VLPFSA       W+FG +LCN W A+DV CCTASI SLC+ISIDR++ ++ PL+   I T RR + A+  +W +S  +S+ P       +  + +V        C +    GY +FS L SFY+P  II+ +Y  +Y  A + S+ L++      +G E+  V +  H          +  +  T     S    K   F  E KAAKTLGIVVG F++CWLPFF++LP+ ++  +CK S+ +F   FWLGY NS  NP+IY C ++E+K AF+ +L+  C R+     + P H +   S+   T+
Sbjct:   51 NILVILSVLLHHQWRSVTHYFIANLAAADLLLSSAVLPFSATSEALGRWVFGRSLCNVWAALDVLCCTASILSLCVISIDRFLAVSYPLRYPAIATGRRGLTAVAALWGLSAAISVGPLFGWKEPHPEDETV--------CRITEEPGYALFSALGSFYIPLAIILAMYCRVYTVAKRVSKSLQES---QREGVEMEGVMLRKHRGKAAHCGRQEDEEEATMHKRPSFPLPKLMKFSGEVKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPSCKPSETIFKITFWLGYLNSCINPIIYPCFSQEFKRAFHNVLHGRCLRTAVPTPKSPGHTSAHFSSPGPTS 381          
BLAST of Alpha-1A adrenergic receptor vs. Planmine SMEST
Match: SMESG000005640.1 (SMESG000005640.1)

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 379/380 (99.74%), Postives = 379/380 (99.74%), Query Frame = 3
Query:   51 MKSENFTKYIAKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQRLPLHVNMQISNTVETNFIN 1190
            MKSENFTKYIAKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKRNIIITKRRIIYAIILIW ISFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCIIIIILYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQRLPLHVNMQISNTVETNFIN
Sbjct:    1 MKSENFTKYIAKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKRNIIITKRRIIYAIILIWFISFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCIIIIILYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQRLPLHVNMQISNTVETNFIN 380          
BLAST of Alpha-1A adrenergic receptor vs. Planmine SMEST
Match: SMESG000005640.1 (SMESG000005640.1)

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 332/333 (99.70%), Postives = 332/333 (99.70%), Query Frame = 3
Query:  192 MVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQRLPLHVNMQISNTVETNFIN 1190
            MVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKRNIIITKRRIIYAIILIW ISFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCIIIIILYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQRLPLHVNMQISNTVETNFIN
Sbjct:    1 MVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKRNIIITKRRIIYAIILIWFISFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCIIIIILYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLYCKRSPNRQRLPLHVNMQISNTVETNFIN 333          
BLAST of Alpha-1A adrenergic receptor vs. Planmine SMEST
Match: SMESG000044639.1 (SMESG000044639.1)

HSP 1 Score: 176.407 bits (446), Expect = 1.109e-50
Identity = 123/352 (34.94%), Postives = 187/352 (53.12%), Query Frame = 3
Query:  180 SGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQ---LKQGFILSN----QGSEVVKMNVHYKS-----------------FIDRNKVITQSNHSSSSNRKCAIFR--------------------QERKAAKTLGIVVGVFIICWLPFFILLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLL 1103
            +GN +VLIA   +  L     + + +LA+ADLLLGI +LPFS    +F  WIFG  LC+ W A+DV  CTASI  LC+ISIDRY  I RP++     T  R++  II  W IS ++ L P       +L N S+  N   C    N A  YV++S++ SFY+P +IIII+Y  +++ A +++ +   +K+  +  N    +  EVV++++ Y                    +D +     +N    +++K  I R                    +ER+    LG+VVG FI+CWLPFF    +   C+ C +++ LF   FWLGYCNS  NP+IY+  NR+++ AF ++L
Sbjct:   38 AGNSLVLIAISTDYRLKNIQNWFLGSLAIADLLLGILILPFSLFNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWSSHSL-NFSISSNEQKCELTQNRA--YVLYSSIGSFYIPLLIIIIVYLQVFIEAKRRANRKYVVKKPEVKKNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLVRYRERRTIVVLGVVVGAFIVCWLPFFTSYLIVIFCK-C-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 384          
BLAST of Alpha-1A adrenergic receptor vs. Planmine SMEST
Match: SMESG000056795.1 (SMESG000056795.1)

HSP 1 Score: 169.088 bits (427), Expect = 2.180e-48
Identity = 122/348 (35.06%), Postives = 185/348 (53.16%), Query Frame = 3
Query:  162 VIFLTISGNIMVLIASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKSFIDR-----------------NKVITQSNHSSSSN-----------RKCAIFRQERKAAKTLGIVVGVFIICWLPFF---ILLPL--KALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLY 1106
            +IF+TI GNI+V+++   ++ L     +LI +LA ADL +   V+PF+    +   WIFGS LC+FW   DVFCCTASI +LC I++DRY  I  PL      T R I+  I   + +S ++S+ P        L     ++NL  C+   N    YV+FS   SF +P ++I  +Y  IY A  K+ R  K  FI  N    + K  V  K    +                 NKV  ++ + SS N           R+     +ERK+A+T+GI++GVF+ICW PFF   +++P    ++C+N     E+F  + WLGY NS  NP+IY+  N++++ AF++LL+
Sbjct:   25 IIFITIVGNILVILSVIYHRPLRKVQNFLIISLAAADLSVASLVMPFALINYILGRWIFGSVLCDFWLTSDVFCCTASILNLCAIALDRYWAINYPLDYVNKRTIRTILSVICGAYILSGLISIPPL-------LGWKEEMKNLYVCSLSDNRI--YVLFSAFGSFIIPTVVIFFVYIRIYFAIRKRLRD-KIKFINQNDRLLMKKETVKNKRKDSKENSSLENETCKITPTCSNKVNNENTNFSSVNNSDKLNQFWNERQKISLSKERKSARTMGIIMGVFVICWSPFFLMYVIVPFCSASVCQNRNQRVEVF--LVWLGYVNSALNPIIYTIFNKDFRDAFHKLLF 360          
BLAST of Alpha-1A adrenergic receptor vs. Planmine SMEST
Match: SMESG000011585.1 (SMESG000011585.1)

HSP 1 Score: 169.088 bits (427), Expect = 5.852e-48
Identity = 119/333 (35.74%), Postives = 182/333 (54.65%), Query Frame = 3
Query:  162 VIFLTISGNIMVLIASKKNKNLVPS-TVYLIANLAVADLLLGICVLPFSAAKTLFK-LWIFGSALCNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKXXXXXXXXXXXXXXXXXXXXSFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTLVSFYVPCXXXXXLYHSIYLAASKQSRQ--LKQGFILSNQGSEVVKMNVHYKSFIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFILLPLKALCE-NCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQLLY-----CKRSPNRQ 1130
            VIF    GN +V+I+  K   L    T + + +LA AD L+ I V+PF+  +T+    W+FG  LCN + + DVF  TAS+  +  I +DRYI I +P K  II+T  R+   + + W  S ++S  P     +    NL V+       C       Y I S+ +SF++P  I+ ++Y  I+  A  Q ++  L   +   N+ S  + MN+  ++FI +    +QS  S+ S R    F++E KAAKTLGI++G FI CWLPFFI   +  +C+ +C   + + D +FW+GY NS  NP+IY+  NRE++ AF Q+L      CK   +RQ
Sbjct:   34 VIFAASFGNGLVIISVWKYPRLRRQITNHFVFSLAFADFLVAILVMPFNLIQTVNNGRWLFGPVLCNIFNSNDVFFSTASLIHIGCIGLDRYIAIIKPFKYEIILTNSRVAIILTVSWITSLLISHIPIHSGIYTTEENL-VLLKFCRLVCHFKVNMIYAIVSSTISFWIPSSIMCVVYLKIFKEAKNQEKKIILATPYPKENRNSLTLDMNIQSQNFIKK----SQSVSSNMSKRN---FKREHKAAKTLGIIMGCFIACWLPFFIWYTVSNVCQSSCSFPEIIGDIVFWIGYVNSTLNPIIYAFYNREFRKAFKQVLKYNKWCCKNCTDRQ 358          
The following BLAST results are available for this feature:
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADRA1A9.281e-7539.66adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A9.696e-7539.66adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A3.278e-7439.66adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A3.373e-7439.66adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A4.097e-7439.66adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-59.081e-4428.95SERotonin/octopamine receptor family [Source:UniP... [more]
dop-13.705e-4334.80DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:Q8... [more]
dop-14.111e-4334.80DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:Q8... [more]
octr-17.489e-4130.69OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
octr-11.563e-4030.53OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Octbeta1R2.506e-5134.49gene:FBgn0038980 transcript:FBtr0100322[more]
Octbeta1R3.457e-5134.49gene:FBgn0038980 transcript:FBtr0301484[more]
Octbeta2R5.244e-5130.69gene:FBgn0038063 transcript:FBtr0304845[more]
Octbeta2R5.244e-5130.69gene:FBgn0038063 transcript:FBtr0347149[more]
Octbeta2R5.244e-5130.69gene:FBgn0038063 transcript:FBtr0100019[more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1d3.116e-7240.06adrenoceptor alpha 1D [Source:ZFIN;Acc:ZDB-GENE-09... [more]
adra1aa5.851e-7036.99adrenoceptor alpha 1Aa [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adra1bb8.284e-7038.42adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adra1bb2.897e-6938.42adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adra1ba5.443e-6939.56adrenoceptor alpha 1Ba [Source:ZFIN;Acc:ZDB-GENE-1... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efr3b5.879e-7440.75EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491... [more]
ENSXETT00000011711.16.532e-7441.13adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488... [more]
ADRA1D1.951e-7341.34adrenoceptor alpha 1D [Source:NCBI gene;Acc:100495... [more]
exd22.643e-5637.39exonuclease 3'-5' domain containing 2 [Source:Xenb... [more]
HTR1F6.426e-4931.645-hydroxytryptamine (serotonin) receptor 1F, G pro... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adra1a9.518e-7840.00adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
Adra1a2.823e-7740.00adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
Adra1a2.823e-7740.00adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
Adra1a2.823e-7740.00adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
Adra1b2.697e-7240.06adrenergic receptor, alpha 1b [Source:MGI Symbol;A... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P97718|ADA1A_MOUSE1.975e-7640.00Alpha-1A adrenergic receptor OS=Mus musculus OX=10... [more]
sp|P43140|ADA1A_RAT5.933e-7640.57Alpha-1A adrenergic receptor OS=Rattus norvegicus ... [more]
sp|P18130|ADA1A_BOVIN6.277e-7541.12Alpha-1A adrenergic receptor OS=Bos taurus OX=9913... [more]
sp|O02824|ADA1A_RABIT1.082e-7440.53Alpha-1A adrenergic receptor OS=Oryctolagus cunicu... [more]
sp|P35348|ADA1A_HUMAN1.967e-7339.66Alpha-1A adrenergic receptor OS=Homo sapiens OX=96... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AVH72.334e-8149.39G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
E9HUC11.413e-7944.35G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1J0F5Z22.820e-7642.66Alpha-1 adrenergic receptor OS=Platynereis dumeril... [more]
Q8BUE51.973e-7440.00Alpha-1A adrenergic receptor OS=Mus musculus OX=10... [more]
A0A061QLS32.156e-7444.54Putative alpha-1A adrenergic receptor OS=Cupienniu... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADRA1D5.016e-7241.74adrenoceptor alpha 1D [Source:NCBI gene;Acc:103027... [more]
adra1aa1.317e-7038.87alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
adra1ba1.518e-6739.26adrenoceptor alpha 1B [Source:NCBI gene;Acc:103033... [more]
adra1ab2.030e-6238.60alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
htr7c4.620e-5634.495-hydroxytryptamine (serotonin) receptor 7c [Sourc... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1bb1.356e-5435.94adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
HTR1F4.535e-4330.835-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
si:dkey-247m21.32.573e-3831.75si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
ENSPMAT00000000271.13.705e-3829.84pep scaffold:Pmarinus_7.0:GL476504:17018:19617:1 g... [more]
ENSPMAT00000006872.13.059e-3528.57pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372071.090e-3931.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352786.283e-3230.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409992.377e-3031.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352132.440e-3031.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318901.350e-2927.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1aa1.213e-7341.43alpha-1A adrenergic receptor [Source:NCBI gene;Acc... [more]
ENSORLT00000006865.22.420e-7339.27alpha-1A adrenergic receptor [Source:NCBI gene;Acc... [more]
adra1d1.303e-6940.29adrenoceptor alpha 1D [Source:NCBI gene;Acc:101157... [more]
ENSORLT00000000867.21.174e-6441.67alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
adra1ab5.120e-5638.01adrenoceptor alpha 1Ab [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Alpha-1A adrenergic receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005640.10.000e+099.74SMESG000005640.1[more]
SMESG000005640.10.000e+099.70SMESG000005640.1[more]
SMESG000044639.11.109e-5034.94SMESG000044639.1[more]
SMESG000056795.12.180e-4835.06SMESG000056795.1[more]
SMESG000011585.15.852e-4835.74SMESG000011585.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004401 ID=SMED30004401|Name=Alpha-1A adrenergic receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1279bp
CTTAAAATAATACATTTTAAATTCAAAATTTAATTCATTTACATAATGAA
ATGAAATCAGAGAATTTTACGAAATATATTGCCAAGTTTTCGGATTGTTT
TCATCAAATACAAGTGGAAAATATCTTTATTTCAACTGTTGTTGGTATAT
GCTTGTTCAGCGTGATTTTTCTAACTATCTCTGGTAACATAATGGTCTTG
ATAGCATCTAAGAAAAACAAAAATCTAGTCCCATCAACTGTTTATTTAAT
AGCAAATTTAGCAGTTGCAGATTTGTTGCTGGGGATTTGTGTTTTACCGT
TTTCAGCAGCAAAGACACTCTTTAAACTCTGGATATTTGGATCAGCGCTG
TGTAACTTTTGGACAGCCATGGATGTATTTTGCTGTACTGCAAGCATCAG
TAGTCTTTGTATTATTAGCATTGATAGATATATTGGTATTACTCGGCCAC
TAAAACGAAATATTATTATCACTAAAAGACGAATAATTTATGCAATAATT
TTAATCTGGTCCATCTCATTTGTTGTTAGCTTAGCTCCTTTCACAATGAC
TGATTTTAGAAATTTGACAAATTTATCCGTTATAGAAAACTTAGCTAATT
GTAACTGTGAAGTCAACAGTGCATGGGGTTACGTAATTTTTTCAACGCTT
GTCTCGTTCTATGTTCCATGTATCATAATTATTATATTGTATCACTCCAT
TTATCTGGCCGCTTCAAAACAATCAAGACAATTAAAACAAGGCTTTATTT
TATCAAATCAAGGATCAGAAGTTGTAAAAATGAATGTTCATTATAAGTCG
TTTATTGACAGAAATAAGGTAATTACTCAGAGCAACCATAGCTCAAGTAG
TAATAGAAAATGTGCAATTTTTCGGCAGGAAAGAAAAGCTGCAAAAACTC
TTGGAATTGTCGTGGGAGTTTTTATAATATGCTGGTTACCCTTTTTCATC
TTATTACCATTAAAAGCTCTCTGTGAAAACTGTAAAATTTCTGACGAATT
ATTCGACTGCATTTTTTGGCTAGGTTACTGTAACAGTTTATGCAATCCGG
TCATATACAGCTGTACGAATCGCGAATATAAAGCCGCTTTCTACCAGCTG
TTGTATTGTAAAAGATCGCCGAACAGACAACGGCTTCCTTTGCATGTCAA
TATGCAAATCTCAAATACTGTAGAAACAAACTTCATCAATTAGAAGTGAT
TGAAATCACTATTCTCTTTTATTCAATTAAAAACTTAATTTGATTTTGAA
ATAAATTTTCCTTTTGATTTGTTACGGAG
back to top

protein sequence of SMED30004401-orf-1

>SMED30004401-orf-1 ID=SMED30004401-orf-1|Name=SMED30004401-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MKSENFTKYIAKFSDCFHQIQVENIFISTVVGICLFSVIFLTISGNIMVL
IASKKNKNLVPSTVYLIANLAVADLLLGICVLPFSAAKTLFKLWIFGSAL
CNFWTAMDVFCCTASISSLCIISIDRYIGITRPLKRNIIITKRRIIYAII
LIWSISFVVSLAPFTMTDFRNLTNLSVIENLANCNCEVNSAWGYVIFSTL
VSFYVPCIIIIILYHSIYLAASKQSRQLKQGFILSNQGSEVVKMNVHYKS
FIDRNKVITQSNHSSSSNRKCAIFRQERKAAKTLGIVVGVFIICWLPFFI
LLPLKALCENCKISDELFDCIFWLGYCNSLCNPVIYSCTNREYKAAFYQL
LYCKRSPNRQRLPLHVNMQISNTVETNFIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005901caveola
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0030018Z disc
GO:0030315T-tubule
GO:0031965nuclear membrane
Vocabulary: biological process
TermDefinition
GO:0010507negative regulation of autophagy
GO:0010613positive regulation of cardiac muscle hypertrophy
GO:0061049cell growth involved in cardiac muscle cell development
GO:0071875adrenergic receptor signaling pathway
GO:0007186G-protein coupled receptor signaling pathway
GO:0045907positive regulation of vasoconstriction
GO:0045987positive regulation of smooth muscle contraction
GO:0055117regulation of cardiac muscle contraction
GO:0060073micturition
GO:0060402calcium ion transport into cytosol
GO:0060452positive regulation of cardiac muscle contraction
GO:0070374positive regulation of ERK1 and ERK2 cascade
GO:0071880adenylate cyclase-activating adrenergic receptor signaling pathway
GO:0097195pilomotor reflex
GO:0090037positive regulation of protein kinase C signaling
GO:0001985negative regulation of heart rate involved in baroreceptor response to increased systemic arterial blood pressure
GO:0001994norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure
GO:0001996positive regulation of heart rate by epinephrine-norepinephrine
GO:0001997positive regulation of the force of heart contraction by epinephrine-norepinephrine
GO:0003084positive regulation of systemic arterial blood pressure
GO:0006937regulation of muscle contraction
GO:0007165signal transduction
GO:0007200phospholipase C-activating G-protein coupled receptor signaling pathway
GO:0007202activation of phospholipase C activity
GO:0007204positive regulation of cytosolic calcium ion concentration
GO:0007267cell-cell signaling
GO:0007512adult heart development
GO:0007568aging
GO:0009725response to hormone
GO:0010460positive regulation of heart rate
GO:0016049cell growth
GO:0019229regulation of vasoconstriction
GO:0032230positive regulation of synaptic transmission, GABAergic
GO:0035024negative regulation of Rho protein signal transduction
GO:0035265organ growth
GO:0042493response to drug
GO:0043410positive regulation of MAPK cascade
GO:0045760positive regulation of action potential
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0046982protein heterodimerization activity
GO:0004871signal transducer activity
GO:0004935adrenergic receptor activity
GO:0004937alpha1-adrenergic receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 30..54
score: 21.09
coord: 280..304
score: 38.65
coord: 144..165
score: 22.72
coord: 108..130
score: 37.72
coord: 195..218
score: 27.55
coord: 318..344
score: 29.92
coord: 63..84
score: 37.55
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 39..351
e-value: 3.6E-4
score: -48.1
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 45..336
e-value: 8.3E-72
score: 241.7
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 114..130
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 38..225
e-value: 1.8E-48
score: 167.5
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 269..350
e-value: 2.9E-31
score: 111.0
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 259..268
e-value: 2.9E-31
score: 111.0
NoneNo IPR availablePANTHERPTHR24248ADRENERGIC RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTORcoord: 11..358
NoneNo IPR availablePANTHERPTHR24248:SF16ALPHA-1A ADRENERGIC RECEPTORcoord: 11..358
NoneNo IPR availableCDDcd149677tmA_amine_R-likecoord: 30..347
e-value: 8.07885E-75
score: 230.913
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 18..363
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 102..124
NoneNo IPR availableTMHMMTMhelixcoord: 195..217
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 145..167
NoneNo IPR availableTMHMMTMhelixcoord: 280..302
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 45..336
score: 44.986