scna-1

Overview
Namescna-1 (AIX99549.1)
Smed IDSMED30004389
Length (bp)5748
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of scna-1 (SMED30004389) t-SNE clustered cells

Violin plots show distribution of expression levels for scna-1 (SMED30004389) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of scna-1 (SMED30004389) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for scna-1 (SMED30004389) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004389

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004389SMESG000017743.1 SMESG000017744.1 Contig5428uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004389SMESG000017743.1 SMESG000017744.1 Contig5428newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004389SMESG000011690.1 Contig5428uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004389SMESG000011690.1 Contig5428newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30004389SMESG000017743.1 SMESG000017742.1 dd_Smed_v4_13973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004389SMESG000017743.1 SMESG000017742.1 dd_Smed_v4_13973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004389SMESG000017743.1 SMESG000017742.1 dd_Smed_v4_13973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004389SMESG000017743.1 SMESG000017742.1 dd_Smed_v6_13973_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30004389SMESG000017743.1 KJ187191smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30004389SMESG000017743.1 KJ187191smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30004389SMESG000017743.1 KJ187191smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30004389SMESG000017743.1 KJ187191smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30004389SMESG000017743.1 KJ187193smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30004389SMESG000017743.1 KJ187193smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of scna-1 vs. Ensembl Human
Match: SCN9A (sodium voltage-gated channel alpha subunit 9 [Source:HGNC Symbol;Acc:HGNC:10597])

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 593/1242 (47.75%), Postives = 787/1242 (63.37%), Query Frame = 3
Query: 2205 IKNPEL-QSALSALSIYD---AETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAI--------KLSKEIF-GRCIVKKRKKLIKSHP---MWNAHNIKCEKSYYE-LSVSNDVKIPEEQ-----LSNPELWFKYSLKETEVP---------KFDEDPEINEVEIIYSTS--------------------------PEDCLPNFISKLLR-KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEK--------GTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            + +P L Q A+S  SI      E +  +++    W      F  W C P + KF+  +  I++DPFV+L IT+CIV+NT+ M+++    + E  + L   N  FT  F  E  LKLIA+ P +YFQ  WN+FD +IV LSLVE+ L D  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      +     PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  ++M M++GNLV+LNLFLALLLSSF S++L   E+D  + N LQ A+ RI + I +VK  +R  I        K+S+EI     +  K++  I +H    M   HN   EK        S D  + E+      + NP L     +   E             D D E ++V +  S+S                          PE C  +    + R  C  V  E+  G++WWN R    K+VEH +FE+FI+LMI++SS  L  ED  +  +  +K+ LE  DK+FT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LV+LV + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY+C+N     R  A  +PN++ C  +  +  NV W+N ++NFDNV  GYL L QVATFKGW  IM  AVDS  +  QP Y +S   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK++GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  KI   IF +  NQ FDI IM +I LN + M +E   Q + +   L  IN VFI++FTGE +LKLI+ R YYF V WN+FDFV+VI+SIV   +  ++    VSPT  RV+R+ RIGRILRLVK AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     I+++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ +K        G CG+  + + Y +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D+  + + +        KV    ++ TLKR++E+ +A VI +  + Y  RL+QN K
Sbjct:  680 LNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVLNLFLALLLSSFSSDNLTAIEEDP-DANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEEAEAEPMNSDEPEACFTD--GCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCWLDFLIVDVSLVTLVANTLGYS--DLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNVRWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRY--RLRQNVK 1910          

HSP 2 Score: 331.643 bits (849), Expect = 6.462e-91
Identity = 181/374 (48.40%), Postives = 253/374 (67.65%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSF--NHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            +P+  LE GK LP   GD  P   +   PL +LDP+Y  K+TF+V+   KTIFRF+ T A Y+LSP +P+R+ +I++L H +FS L++ TI+ NC+FM  N+  D    VEY FT IYT E  +K ++RG  + EFT+LRD WNWLDF+VI  AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC ++   N+  L    N  E+  D  K+     F+     +L+  +      ++  +  CPEGY C++    NP+YGYT+FD F  + L  FRLMTQDYWENLYQ T+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++
Sbjct:   48 KPSSDLEAGKQLPFIYGDIPP--GMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYVTEFVD-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKY-----FY-----YLEGSKDALLCGFSTDSGQCPEGYTCVKIGR-NPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEE 407          

HSP 3 Score: 84.7297 bits (208), Expect = 1.973e-15
Identity = 71/274 (25.91%), Postives = 122/274 (44.53%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV-----NNDTFERI-----SAE--------IIPNKNACLIMKAMYGNVSWEN------------SQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K  A G       + +D W WLDF+++  A V+  +         +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G   +KC      NN+T E I     S E        +  +K+A L   +       E                +FD     +L LF++ T   W  +    + + G            Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  155 VEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYVTEFVD--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAG----------KTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQ 410          

HSP 4 Score: 67.781 bits (164), Expect = 2.477e-10
Identity = 54/202 (26.73%), Postives = 97/202 (48.02%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPFVEL---------------FITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF-GD-KYSNFKN 2837
            KTF         F+F +  AL +L PF  L                I   I+ N + M+++ P +      + K   Y FT  +  E+ +K++A    +G   + ++ WN  DF++++ + V   +D   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF G+ K+  F+N
Sbjct:   86 KTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPD------WTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYVTEFVDLGNVSALRTFRVLRAL---KTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRN 278          

HSP 5 Score: 60.8474 bits (146), Expect = 3.430e-8
Identity = 73/335 (21.79%), Postives = 142/335 (42.39%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWE-NLYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            IRKT  +++ H  F   ++  I+++   +A        K +    +EY   +FT I+ LE  +K I+ G      TY  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    +C+                N TD  ++        N +     +   QN  +                          NFDN  +  L   ++ T   W   +Y      N D            +YF++ I FGSF+ +N+ + ++  +++  +  +  ++
Sbjct: 1181 IRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYK----TYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY-ECI----------------NTTDGSRFPASQ--VPNRSECFALMNVSQNVRWKNLK---------------------VNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQD 1471          
BLAST of scna-1 vs. Ensembl Human
Match: SCN9A (sodium voltage-gated channel alpha subunit 9 [Source:HGNC Symbol;Acc:HGNC:10597])

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 593/1242 (47.75%), Postives = 787/1242 (63.37%), Query Frame = 3
Query: 2205 IKNPEL-QSALSALSIYD---AETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAI--------KLSKEIF-GRCIVKKRKKLIKSHP---MWNAHNIKCEKSYYE-LSVSNDVKIPEEQ-----LSNPELWFKYSLKETEVP---------KFDEDPEINEVEIIYSTS--------------------------PEDCLPNFISKLLR-KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEK--------GTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            + +P L Q A+S  SI      E +  +++    W      F  W C P + KF+  +  I++DPFV+L IT+CIV+NT+ M+++    + E  + L   N  FT  F  E  LKLIA+ P +YFQ  WN+FD +IV LSLVE+ L D  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      +     PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  ++M M++GNLV+LNLFLALLLSSF S++L   E+D  + N LQ A+ RI + I +VK  +R  I        K+S+EI     +  K++  I +H    M   HN   EK        S D  + E+      + NP L     +   E             D D E ++V +  S+S                          PE C  +    + R  C  V  E+  G++WWN R    K+VEH +FE+FI+LMI++SS  L  ED  +  +  +K+ LE  DK+FT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LV+LV + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY+C+N     R  A  +PN++ C  +  +  NV W+N ++NFDNV  GYL L QVATFKGW  IM  AVDS  +  QP Y +S   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK++GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  KI   IF +  NQ FDI IM +I LN + M +E   Q + +   L  IN VFI++FTGE +LKLI+ R YYF V WN+FDFV+VI+SIV   +  ++    VSPT  RV+R+ RIGRILRLVK AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     I+++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ +K        G CG+  + + Y +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D+  + + +        KV    ++ TLKR++E+ +A VI +  + Y  RL+QN K
Sbjct:  680 LNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVLNLFLALLLSSFSSDNLTAIEEDP-DANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEEAEAEPMNSDEPEACFTD--GCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCWLDFLIVDVSLVTLVANTLGYS--DLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNVRWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRY--RLRQNVK 1910          

HSP 2 Score: 332.413 bits (851), Expect = 3.420e-91
Identity = 182/374 (48.66%), Postives = 253/374 (67.65%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSF--NHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            +P+  LE GK LP   GD  P   +   PL +LDP+Y  K+TF+V+   KTIFRF+ T A Y+LSP +P+R+ +I++L H +FS L++ TI+ NC+FM  N+  D    VEY FT IYT E  +K ++RG  + EFT+LRD WNWLDF+VI  AYL  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC ++   N+  L    N  E+  D  K+     F+     +L+  +      ++  +  CPEGY C++    NP+YGYT+FD F  + L  FRLMTQDYWENLYQ T+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++
Sbjct:   48 KPSSDLEAGKQLPFIYGDIPP--GMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKY-----FY-----YLEGSKDALLCGFSTDSGQCPEGYTCVKIGR-NPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEE 407          

HSP 3 Score: 83.5741 bits (205), Expect = 3.935e-15
Identity = 70/274 (25.55%), Postives = 123/274 (44.89%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV-----NNDTFERI-----SAE--------IIPNKNACLIMKAMYGNVSWEN------------SQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K  A G       + +D W WLDF+++  A ++  ++        +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G   +KC      NN+T E I     S E        +  +K+A L   +       E                +FD     +L LF++ T   W  +    + + G            Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  155 VEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVN--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAG----------KTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQ 410          

HSP 4 Score: 64.6994 bits (156), Expect = 2.342e-9
Identity = 52/202 (25.74%), Postives = 97/202 (48.02%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPFVEL---------------FITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF-GD-KYSNFKN 2837
            KTF         F+F +  AL +L PF  L                I   I+ N + M+++ P +      + K   Y FT  +  E+ +K++A    +G   + ++ WN  DF++++ + +   ++   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF G+ K+  F+N
Sbjct:   86 KTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPD------WTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRAL---KTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRN 278          

HSP 5 Score: 60.8474 bits (146), Expect = 3.488e-8
Identity = 73/335 (21.79%), Postives = 142/335 (42.39%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWE-NLYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            IRKT  +++ H  F   ++  I+++   +A        K +    +EY   +FT I+ LE  +K I+ G      TY  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    +C+                N TD  ++        N +     +   QN  +                          NFDN  +  L   ++ T   W   +Y      N D            +YF++ I FGSF+ +N+ + ++  +++  +  +  ++
Sbjct: 1181 IRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYK----TYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY-ECI----------------NTTDGSRFPASQ--VPNRSECFALMNVSQNVRWKNLK---------------------VNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQD 1471          
BLAST of scna-1 vs. Ensembl Human
Match: SCN9A (sodium voltage-gated channel alpha subunit 9 [Source:HGNC Symbol;Acc:HGNC:10597])

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 593/1242 (47.75%), Postives = 787/1242 (63.37%), Query Frame = 3
Query: 2205 IKNPEL-QSALSALSIYD---AETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAI--------KLSKEIF-GRCIVKKRKKLIKSHP---MWNAHNIKCEKSYYE-LSVSNDVKIPEEQ-----LSNPELWFKYSLKETEVP---------KFDEDPEINEVEIIYSTS--------------------------PEDCLPNFISKLLR-KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEK--------GTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            + +P L Q A+S  SI      E +  +++    W      F  W C P + KF+  +  I++DPFV+L IT+CIV+NT+ M+++    + E  + L   N  FT  F  E  LKLIA+ P +YFQ  WN+FD +IV LSLVE+ L D  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      +     PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  ++M M++GNLV+LNLFLALLLSSF S++L   E+D  + N LQ A+ RI + I +VK  +R  I        K+S+EI     +  K++  I +H    M   HN   EK        S D  + E+      + NP L     +   E             D D E ++V +  S+S                          PE C  +    + R  C  V  E+  G++WWN R    K+VEH +FE+FI+LMI++SS  L  ED  +  +  +K+ LE  DK+FT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LV+LV + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY+C+N     R  A  +PN++ C  +  +  NV W+N ++NFDNV  GYL L QVATFKGW  IM  AVDS  +  QP Y +S   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK++GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  KI   IF +  NQ FDI IM +I LN + M +E   Q + +   L  IN VFI++FTGE +LKLI+ R YYF V WN+FDFV+VI+SIV   +  ++    VSPT  RV+R+ RIGRILRLVK AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     I+++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ +K        G CG+  + + Y +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D+  + + +        KV    ++ TLKR++E+ +A VI +  + Y  RL+QN K
Sbjct:  680 LNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVLNLFLALLLSSFSSDNLTAIEEDP-DANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEEAEAEPMNSDEPEACFTD--GCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCWLDFLIVDVSLVTLVANTLGYS--DLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNVRWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRY--RLRQNVK 1910          

HSP 2 Score: 332.413 bits (851), Expect = 3.420e-91
Identity = 182/374 (48.66%), Postives = 253/374 (67.65%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSF--NHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            +P+  LE GK LP   GD  P   +   PL +LDP+Y  K+TF+V+   KTIFRF+ T A Y+LSP +P+R+ +I++L H +FS L++ TI+ NC+FM  N+  D    VEY FT IYT E  +K ++RG  + EFT+LRD WNWLDF+VI  AYL  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC ++   N+  L    N  E+  D  K+     F+     +L+  +      ++  +  CPEGY C++    NP+YGYT+FD F  + L  FRLMTQDYWENLYQ T+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++
Sbjct:   48 KPSSDLEAGKQLPFIYGDIPP--GMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKY-----FY-----YLEGSKDALLCGFSTDSGQCPEGYTCVKIGR-NPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEE 407          

HSP 3 Score: 83.5741 bits (205), Expect = 3.935e-15
Identity = 70/274 (25.55%), Postives = 123/274 (44.89%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV-----NNDTFERI-----SAE--------IIPNKNACLIMKAMYGNVSWEN------------SQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K  A G       + +D W WLDF+++  A ++  ++        +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G   +KC      NN+T E I     S E        +  +K+A L   +       E                +FD     +L LF++ T   W  +    + + G            Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  155 VEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVN--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAG----------KTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQ 410          

HSP 4 Score: 64.6994 bits (156), Expect = 2.342e-9
Identity = 52/202 (25.74%), Postives = 97/202 (48.02%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPFVEL---------------FITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF-GD-KYSNFKN 2837
            KTF         F+F +  AL +L PF  L                I   I+ N + M+++ P +      + K   Y FT  +  E+ +K++A    +G   + ++ WN  DF++++ + +   ++   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF G+ K+  F+N
Sbjct:   86 KTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPD------WTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRAL---KTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRN 278          

HSP 5 Score: 60.8474 bits (146), Expect = 3.488e-8
Identity = 73/335 (21.79%), Postives = 142/335 (42.39%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWE-NLYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            IRKT  +++ H  F   ++  I+++   +A        K +    +EY   +FT I+ LE  +K I+ G      TY  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    +C+                N TD  ++        N +     +   QN  +                          NFDN  +  L   ++ T   W   +Y      N D            +YF++ I FGSF+ +N+ + ++  +++  +  +  ++
Sbjct: 1181 IRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYK----TYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY-ECI----------------NTTDGSRFPASQ--VPNRSECFALMNVSQNVRWKNLK---------------------VNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQD 1471          
BLAST of scna-1 vs. Ensembl Human
Match: SCN9A (sodium voltage-gated channel alpha subunit 9 [Source:HGNC Symbol;Acc:HGNC:10597])

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 593/1242 (47.75%), Postives = 787/1242 (63.37%), Query Frame = 3
Query: 2205 IKNPEL-QSALSALSIYD---AETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAI--------KLSKEIF-GRCIVKKRKKLIKSHP---MWNAHNIKCEKSYYE-LSVSNDVKIPEEQ-----LSNPELWFKYSLKETEVP---------KFDEDPEINEVEIIYSTS--------------------------PEDCLPNFISKLLR-KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEK--------GTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            + +P L Q A+S  SI      E +  +++    W      F  W C P + KF+  +  I++DPFV+L IT+CIV+NT+ M+++    + E  + L   N  FT  F  E  LKLIA+ P +YFQ  WN+FD +IV LSLVE+ L D  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      +     PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  ++M M++GNLV+LNLFLALLLSSF S++L   E+D  + N LQ A+ RI + I +VK  +R  I        K+S+EI     +  K++  I +H    M   HN   EK        S D  + E+      + NP L     +   E             D D E ++V +  S+S                          PE C  +    + R  C  V  E+  G++WWN R    K+VEH +FE+FI+LMI++SS  L  ED  +  +  +K+ LE  DK+FT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LV+LV + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY+C+N     R  A  +PN++ C  +  +  NV W+N ++NFDNV  GYL L QVATFKGW  IM  AVDS  +  QP Y +S   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK++GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  KI   IF +  NQ FDI IM +I LN + M +E   Q + +   L  IN VFI++FTGE +LKLI+ R YYF V WN+FDFV+VI+SIV   +  ++    VSPT  RV+R+ RIGRILRLVK AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     I+++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ +K        G CG+  + + Y +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D+  + + +        KV    ++ TLKR++E+ +A VI +  + Y  RL+QN K
Sbjct:  669 LNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVLNLFLALLLSSFSSDNLTAIEEDP-DANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEEAEAEPMNSDEPEACFTD--GCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCWLDFLIVDVSLVTLVANTLGYS--DLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNVRWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRY--RLRQNVK 1899          

HSP 2 Score: 332.413 bits (851), Expect = 3.542e-91
Identity = 182/375 (48.53%), Postives = 253/375 (67.47%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSF---NHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            +P+  LE GK LP   GD  P   +   PL +LDP+Y  K+TF+V+   KTIFRF+ T A Y+LSP +P+R+ +I++L H +FS L++ TI+ NC+FM  N+  D    VEY FT IYT E  +K ++RG  + EFT+LRD WNWLDF+VI  AYL  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC ++    N TL         N  ++E+   KY ++      L+  +      ++  +  CPEGY C++    NP+YGYT+FD F  + L  FRLMTQDYWENLYQ T+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++
Sbjct:   48 KPSSDLEAGKQLPFIYGDIPP--GMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETL-----ESIMNTLESEEDFRKYFYY------LEGSKDALLCGFSTDSGQCPEGYTCVKIGR-NPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEE 407          

HSP 3 Score: 83.5741 bits (205), Expect = 3.897e-15
Identity = 70/274 (25.55%), Postives = 123/274 (44.89%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV-----NNDTFERI-----SAE--------IIPNKNACLIMKAMYGNVSWEN------------SQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K  A G       + +D W WLDF+++  A ++  ++        +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G   +KC      NN+T E I     S E        +  +K+A L   +       E                +FD     +L LF++ T   W  +    + + G            Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  155 VEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVN--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAG----------KTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQ 410          

HSP 4 Score: 64.3142 bits (155), Expect = 2.567e-9
Identity = 52/202 (25.74%), Postives = 97/202 (48.02%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPFVEL---------------FITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF-GD-KYSNFKN 2837
            KTF         F+F +  AL +L PF  L                I   I+ N + M+++ P +      + K   Y FT  +  E+ +K++A    +G   + ++ WN  DF++++ + +   ++   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF G+ K+  F+N
Sbjct:   86 KTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPD------WTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRAL---KTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRN 278          

HSP 5 Score: 60.8474 bits (146), Expect = 3.370e-8
Identity = 73/335 (21.79%), Postives = 142/335 (42.39%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWE-NLYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            IRKT  +++ H  F   ++  I+++   +A        K +    +EY   +FT I+ LE  +K I+ G      TY  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    +C+                N TD  ++        N +     +   QN  +                          NFDN  +  L   ++ T   W   +Y      N D            +YF++ I FGSF+ +N+ + ++  +++  +  +  ++
Sbjct: 1170 IRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYK----TYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY-ECI----------------NTTDGSRFPASQ--VPNRSECFALMNVSQNVRWKNLK---------------------VNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQD 1460          
BLAST of scna-1 vs. Ensembl Human
Match: SCN9A (sodium voltage-gated channel alpha subunit 9 [Source:HGNC Symbol;Acc:HGNC:10597])

HSP 1 Score: 949.118 bits (2452), Expect = 0.000e+0
Identity = 593/1242 (47.75%), Postives = 787/1242 (63.37%), Query Frame = 3
Query: 2205 IKNPEL-QSALSALSIYD---AETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAI--------KLSKEIF-GRCIVKKRKKLIKSHP---MWNAHNIKCEKSYYE-LSVSNDVKIPEEQ-----LSNPELWFKYSLKETEVP---------KFDEDPEINEVEIIYSTS--------------------------PEDCLPNFISKLLR-KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEK--------GTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            + +P L Q A+S  SI      E +  +++    W      F  W C P + KF+  +  I++DPFV+L IT+CIV+NT+ M+++    + E  + L   N  FT  F  E  LKLIA+ P +YFQ  WN+FD +IV LSLVE+ L D  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      +     PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  ++M M++GNLV+LNLFLALLLSSF S++L   E+D  + N LQ A+ RI + I +VK  +R  I        K+S+EI     +  K++  I +H    M   HN   EK        S D  + E+      + NP L     +   E             D D E ++V +  S+S                          PE C  +    + R  C  V  E+  G++WWN R    K+VEH +FE+FI+LMI++SS  L  ED  +  +  +K+ LE  DK+FT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LV+LV + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY+C+N     R  A  +PN++ C  +  +  NV W+N ++NFDNV  GYL L QVATFKGW  IM  AVDS  +  QP Y +S   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK++GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  KI   IF +  NQ FDI IM +I LN + M +E   Q + +   L  IN VFI++FTGE +LKLI+ R YYF V WN+FDFV+VI+SIV   +  ++    VSPT  RV+R+ RIGRILRLVK AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     I+++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ +K        G CG+  + + Y +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D+  + + +        KV    ++ TLKR++E+ +A VI +  + Y  RL+QN K
Sbjct:  669 LNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVLNLFLALLLSSFSSDNLTAIEEDP-DANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEEAEAEPMNSDEPEACFTD--GCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCWLDFLIVDVSLVTLVANTLGYS--DLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNVRWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRY--RLRQNVK 1899          

HSP 2 Score: 331.257 bits (848), Expect = 7.293e-91
Identity = 181/375 (48.27%), Postives = 253/375 (67.47%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSF---NHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            +P+  LE GK LP   GD  P   +   PL +LDP+Y  K+TF+V+   KTIFRF+ T A Y+LSP +P+R+ +I++L H +FS L++ TI+ NC+FM  N+  D    VEY FT IYT E  +K ++RG  + EFT+LRD WNWLDF+VI  AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC ++    N TL         N  ++E+   KY ++      L+  +      ++  +  CPEGY C++    NP+YGYT+FD F  + L  FRLMTQDYWENLYQ T+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++
Sbjct:   48 KPSSDLEAGKQLPFIYGDIPP--GMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYVTEFVD-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETL-----ESIMNTLESEEDFRKYFYY------LEGSKDALLCGFSTDSGQCPEGYTCVKIGR-NPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEE 407          

HSP 3 Score: 84.3445 bits (207), Expect = 2.126e-15
Identity = 71/274 (25.91%), Postives = 122/274 (44.53%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV-----NNDTFERI-----SAE--------IIPNKNACLIMKAMYGNVSWEN------------SQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K  A G       + +D W WLDF+++  A V+  +         +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G   +KC      NN+T E I     S E        +  +K+A L   +       E                +FD     +L LF++ T   W  +    + + G            Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  155 VEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYVTEFVD--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAG----------KTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQ 410          

HSP 4 Score: 67.781 bits (164), Expect = 2.808e-10
Identity = 54/202 (26.73%), Postives = 97/202 (48.02%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPFVEL---------------FITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF-GD-KYSNFKN 2837
            KTF         F+F +  AL +L PF  L                I   I+ N + M+++ P +      + K   Y FT  +  E+ +K++A    +G   + ++ WN  DF++++ + V   +D   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF G+ K+  F+N
Sbjct:   86 KTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPD------WTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYVTEFVDLGNVSALRTFRVLRAL---KTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRN 278          

HSP 5 Score: 60.8474 bits (146), Expect = 3.635e-8
Identity = 73/335 (21.79%), Postives = 142/335 (42.39%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWE-NLYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            IRKT  +++ H  F   ++  I+++   +A        K +    +EY   +FT I+ LE  +K I+ G      TY  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    +C+                N TD  ++        N +     +   QN  +                          NFDN  +  L   ++ T   W   +Y      N D            +YF++ I FGSF+ +N+ + ++  +++  +  +  ++
Sbjct: 1170 IRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYK----TYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY-ECI----------------NTTDGSRFPASQ--VPNRSECFALMNVSQNVRWKNLK---------------------VNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQD 1460          
BLAST of scna-1 vs. Ensembl Celegans
Match: egl-19 (Voltage-dependent L-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:W6RY76])

HSP 1 Score: 244.588 bits (623), Expect = 1.452e-64
Identity = 215/700 (30.71%), Postives = 359/700 (51.29%), Query Frame = 3
Query: 3543 RCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKC--VNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIA-QRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAY--SHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE-----DPKVCNKEKG-----TCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPK--PNSV---QLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENN 5570
            R   + +V H +F   ++  I++SS  L  ED  L +     + L   D  FT +FT E+ LK   FGL      + ++A+  LD ++V ++L S VL         M   K +R LR LRPLRA++R +G++ VV  +I A+ +I N++LV  +   +F+IIG+QLF G F+ C  ++  T      E I  ++     K +     W N+  NFDNV +  + LF V+TF+GW +++  A+DS      P +N       +F++FII  AFF +N+F+G +I  F  + +R   + E+   ++Q+K      K  +   ++ IPR +L+    ++    ++ F+  I  +I++NT+ +  +H+      +  LD  N +F  +F  E +LK++A     Y    WN+FD ++V+ S +       LN    +   I   R+FR+ R+++L+   +GIRTLL++ + S  AL  +ALL++++ FIYA++GM FF  VA   S SI    NF +F  A+++LF+ +T   W  ++    +      DP   +  KG      CG+   A  Y IS+ ++   ++IN+++AVI++NF   T+D    L     + F   W EYD  A+G I    +   + KI  PLG  K  P+ +   +L  + +P+  + TV     L  L R  L    E +  E N
Sbjct:  788 RVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDP-LQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLR-----TDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYEDGD-PTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCEL--DKNQRKCIEFALK--AKPHRRYIPRNRLQYR--VWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITY-GKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNF-AYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRD-WSILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTVCFNATLFALVRTNLKIYTEGNIDEAN 1471          

HSP 2 Score: 147.132 bits (370), Expect = 7.297e-35
Identity = 169/609 (27.75%), Postives = 288/609 (47.29%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYK-CVNNDTFERISAEIIP-------NKNACLIMKAMYG-NVSWE-----------NSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFN--VQKKRVGGSLEMF-----MTEDQKKYYNAMKKMSSTAP-------QKPIP-------------------RPKLKIANI-------------IFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRW-YYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNV--AYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQA 5282
            LE ++ VF ++FT E +LK  A G     + Y ++AW  LDFIIV I LVS +LS +      +   KA+R  R LRPLR VS    +++V+NA+++A+  + ++ L+ L   LI++IIG++LF GK +  C++  T +    +  P       +   C    ++    V WE           N   NFDN     L +FQ  + +GW ++M    D+ G             + YFV+ +I G+FF LNL +GV+   F+   +K R  G  + F     + ED K Y + + +     P        +P+                    RP    A +                +  +Q F   ++ +++LNT+V+  EH+ Q E L       N  F+++F+ E LLK+ +  +  Y    +N FD  +VI SI+ +    ++    + P  + V+R  R+ RI ++ K    +R L+ SL+ SL +++++ LLL + + I+A++GM  F               NF+TF +A++ +FQI T   WN V+   +     V     GT G  +I  +Y I   I    +++N+++A+ ++N + A
Sbjct:  123 LETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDV---KALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVG---------REWPWIYFVTLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLEEDLKGYLDWITQAEDIEPVNEDEQEDEPVAQTVVGEEADEEGEERVEDVRPSKWAARMKRLEKLNRRCRRACRRLVKSQTFYWLVILLVLLNTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFV---LVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGV-----GTLG--VIVCIYYIVLFICGNYILLNVFLAIAVDNLADA 709          

HSP 3 Score: 127.487 bits (319), Expect = 6.179e-29
Identity = 107/355 (30.14%), Postives = 185/355 (52.11%), Query Frame = 3
Query:  468 KQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMA------------KNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFI--VIGL-AYLMFFFPVLG-NXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWEN-LYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            +QT VV  S++++           LS  NPIRK  I ++    F FL+L  I  NC+ +A            KN+  +T+EYVF  ++T+E  +K ++ G + +   YLR+AWN LDFI  VIGL + ++    + G ++ ALR+ RVLR L+ V+ VP ++ V+ A+L A+  L    +L +F++ I+ +IGL+L+ G L   C+      L   +P      TD E    K +  ++ TN +    +C +      NT+ P            PN G TNFDNF +++L  F+ ++ + W + +Y +      +   +YF+ ++  GSF+++N++L +++  +   R   +A 
Sbjct:   56 RQTNVVERSERSLL---------CLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCG--TDTEGSAFKCQPSDSLTN-MGVRWECSS------NTTWP-----------GPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEFSKEREKARAR 381          

HSP 4 Score: 100.908 bits (250), Expect = 8.692e-21
Identity = 67/215 (31.16%), Postives = 105/215 (48.84%), Query Frame = 3
Query: 2388 ELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEI---PLDSSGMSLL-----RAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFG-----DKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGE-WIESMWDCMLVNGYQCVP 2990
            E  I L IVMNTV ++     +S     FL   N  FT  F  EA LK++AL P+ Y  + WNVFD ++V+ S ++I    L+  G +L+     R FR++R+ KL    + +  L      +  A+  + +++ ++ FI+AV+GMQ FG     D  S  +N              NF+ F  + +++FR   GE W + M  C      +C P
Sbjct: 1120 EYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNN-------------NFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDP 1321          

HSP 5 Score: 84.3445 bits (207), Expect = 7.929e-16
Identity = 84/346 (24.28%), Postives = 160/346 (46.24%), Query Frame = 3
Query:  486 IASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAK------NSNSDTV----EYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFF--PVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTN----GDIH------ILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            + +  T+       + ++LS  N  R     ++ H  F+  VL  I+++   +A       NS  + +    +Y FT+++T+E T+K I  GL+ ++ ++ R+A+N LD +V+ ++   F      +  +  LR LRVLR L+ +    G+K VV  ++ AVK + + M++T  L  +F +IG+QL++GT              +F  N+   +T+AE                     C+   Y  +    P   V  +    N ++   NFDN   +++  F + T + W  L  + I +N    G IH       L+F+  I   +F+++N+ +  V +++ +
Sbjct:  763 VPAASTVKPIPKASSLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGT--------------FFLCNDLSKMTEAE---------------------CRG-EYIHYEDGDPTKPVSKKRVWSNNDF---NFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQN 1069          

HSP 6 Score: 84.3445 bits (207), Expect = 1.012e-15
Identity = 61/179 (34.08%), Postives = 101/179 (56.42%), Query Frame = 3
Query: 2463 MNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL------DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ 2981
            ++HF   AN FF   F +E  LK+ +LG   Y    +N FD  +VI S++E  L         G+S+LR+ RLLR+FK+ K W ++  L   +  ++ +I +L ++L + I IFA++GMQ+FG K+ NF  +         +PR NF+ F  + + VF++L GE     W+ ++ +G +
Sbjct:  501 LDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKF-NFNPQQ-------PKPRANFDTFVQALLTVFQILTGE----DWNTVMYHGIE 667          

HSP 7 Score: 81.2629 bits (199), Expect = 7.139e-15
Identity = 141/619 (22.78%), Postives = 262/619 (42.33%), Query Frame = 3
Query: 3660 WLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDS-TGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLE------------------------MFMTEDQKKYYNAMKKMSSTAPQ----KPIPRPKLKIANIIFSITINQKFDIFIMSVI----MLNTIVMCI---------EHWDQPEKLKTA-LDQINKVFIVIFTGEFLLKLIA-----QRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNV-----------------AYSHSID---------------EVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAV-VYLISYLIISFLVIINMYIAVILENF 5273
            WL     + +  F I+F+ EMLLK ++ G   Y    +   D  +V  +++  VL Y       +G    +R+ R LR  +    W  +R +V++L+ ++ SI ++LL+  +F +IF+++GMQ+FGGKF        F                      N      + NFD  +   L +FQ+ T + W  +M   ++S  G+G         I   Y++   I G +  LN+F+ + +DN            E                        M   E  ++  +A  +  S  P     KPIP+     A+ +F ++    F +F   V+      N ++ CI         E   Q    +   L+  +  F  +FT E  LK+I       +  + +  +N+ D ++V +S+  + + +   ++      ++++RV R+ R LR +  AKG++ ++  +IV++  + NI L+  M+ F++AI+G+  F                     Y H  D                 FNF+  G AMI LF +ST  GW  +L   ++ +     ++KG   +   AV ++ I+++I+    ++N+++  ++  F
Sbjct:  500 WLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDL-MKPLGV-SVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKF-------NF----------------------NPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTL-----GVIVCIYYIVLFICGNYILLNVFLAIAVDNLADADSLTNAEKEEEQQEIEGEDEEFEEGEDEGEEHGMDEPEGDEEMTSARPRRMSEVPAASTVKPIPK-----ASSLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSV------VKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSN----EEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTF 1067          

HSP 8 Score: 78.5666 bits (192), Expect = 5.120e-14
Identity = 63/218 (28.90%), Postives = 111/218 (50.92%), Query Frame = 3
Query: 2220 LQSALSALSIYDAETK--VRKKELIKQWLL-KTFCSWTCCPCYFKFQSL-VALIILDPFVELFITLCIVMNTVLMSIDTP---DNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSL-------LRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDK 2819
            LQ+A++A S  DA  K   ++K L +  ++ ++  S  C       + L ++++   PF E  I   I  N + ++I  P    +S   N  L+   Y F   F +E  LK++A+G    P  Y +  WN+ DFIIV++ LV   L  S MS+       LRAFR+LR  +L     ++ ++   I   +  + ++ +++  +I I+A++G++LF  K
Sbjct:   32 LQAAVAASSSQDATKKRPAQRKPLRQTNVVERSERSLLCLSLNNPIRKLCISIVEWKPF-EFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTIL--SKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGK 246          

HSP 9 Score: 67.3958 bits (163), Expect = 1.411e-10
Identity = 40/150 (26.67%), Postives = 81/150 (54.00%), Query Frame = 3
Query: 2397 ITLCIVMNTVLMSIDTP-DNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGA---IGNLCIVLGIIIFIFAVVGMQLFGDKY 2822
            +  CI++++ +++ + P   +   N  L   +YFFT+ F +E  LK+I  G       + +  +N+ D ++V +SL    L +  MS+++  R+LRV +  ++      L  ++   + A   IGN+ +V  ++ F+FA++G+QLF   +
Sbjct:  804 VLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTF 953          
BLAST of scna-1 vs. Ensembl Celegans
Match: egl-19 (Voltage-dependent L-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:W6RY76])

HSP 1 Score: 243.817 bits (621), Expect = 1.818e-64
Identity = 215/700 (30.71%), Postives = 359/700 (51.29%), Query Frame = 3
Query: 3543 RCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKC--VNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIA-QRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAY--SHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE-----DPKVCNKEKG-----TCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPK--PNSV---QLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENN 5570
            R   + +V H +F   ++  I++SS  L  ED  L +     + L   D  FT +FT E+ LK   FGL      + ++A+  LD ++V ++L S VL         M   K +R LR LRPLRA++R +G++ VV  +I A+ +I N++LV  +   +F+IIG+QLF G F+ C  ++  T      E I  ++     K +     W N+  NFDNV +  + LF V+TF+GW +++  A+DS      P +N       +F++FII  AFF +N+F+G +I  F  + +R   + E+   ++Q+K      K  +   ++ IPR +L+    ++    ++ F+  I  +I++NT+ +  +H+      +  LD  N +F  +F  E +LK++A     Y    WN+FD ++V+ S +       LN    +   I   R+FR+ R+++L+   +GIRTLL++ + S  AL  +ALL++++ FIYA++GM FF  VA   S SI    NF +F  A+++LF+ +T   W  ++    +      DP   +  KG      CG+   A  Y IS+ ++   ++IN+++AVI++NF   T+D    L     + F   W EYD  A+G I    +   + KI  PLG  K  P+ +   +L  + +P+  + TV     L  L R  L    E +  E N
Sbjct:  788 RVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDP-LQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLR-----TDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYEDGD-PTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCEL--DKNQRKCIEFALK--AKPHRRYIPRNRLQYR--VWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITY-GKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNF-AYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRD-WSILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTVCFNATLFALVRTNLKIYTEGNIDEAN 1471          

HSP 2 Score: 145.976 bits (367), Expect = 1.502e-34
Identity = 169/609 (27.75%), Postives = 288/609 (47.29%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYK-CVNNDTFERISAEIIP-------NKNACLIMKAMYG-NVSWE-----------NSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFN--VQKKRVGGSLEMF-----MTEDQKKYYNAMKKMSSTAP-------QKPIP-------------------RPKLKIANI-------------IFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRW-YYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNV--AYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQA 5282
            LE ++ VF ++FT E +LK  A G     + Y ++AW  LDFIIV I LVS +LS +      +   KA+R  R LRPLR VS    +++V+NA+++A+  + ++ L+ L   LI++IIG++LF GK +  C++  T +    +  P       +   C    ++    V WE           N   NFDN     L +FQ  + +GW ++M    D+ G             + YFV+ +I G+FF LNL +GV+   F+   +K R  G  + F     + ED K Y + + +     P        +P+                    RP    A +                +  +Q F   ++ +++LNT+V+  EH+ Q E L       N  F+++F+ E LLK+ +  +  Y    +N FD  +VI SI+ +    ++    + P  + V+R  R+ RI ++ K    +R L+ SL+ SL +++++ LLL + + I+A++GM  F               NF+TF +A++ +FQI T   WN V+   +     V     GT G  +I  +Y I   I    +++N+++A+ ++N + A
Sbjct:  123 LETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDV---KALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVG---------REWPWIYFVTLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLEEDLKGYLDWITQAEDIEPVNEDEQEDEPVAQTVVGEEADEEGEERVEDVRPSKWAARMKRLEKLNRRCRRACRRLVKSQTFYWLVILLVLLNTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFV---LVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGV-----GTLG--VIVCIYYIVLFICGNYILLNVFLAIAVDNLADA 709          

HSP 3 Score: 127.102 bits (318), Expect = 9.764e-29
Identity = 107/355 (30.14%), Postives = 185/355 (52.11%), Query Frame = 3
Query:  468 KQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMA------------KNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFI--VIGL-AYLMFFFPVLG-NXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWEN-LYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            +QT VV  S++++           LS  NPIRK  I ++    F FL+L  I  NC+ +A            KN+  +T+EYVF  ++T+E  +K ++ G + +   YLR+AWN LDFI  VIGL + ++    + G ++ ALR+ RVLR L+ V+ VP ++ V+ A+L A+  L    +L +F++ I+ +IGL+L+ G L   C+      L   +P      TD E    K +  ++ TN +    +C +      NT+ P            PN G TNFDNF +++L  F+ ++ + W + +Y +      +   +YF+ ++  GSF+++N++L +++  +   R   +A 
Sbjct:   56 RQTNVVERSERSLL---------CLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCG--TDTEGSAFKCQPSDSLTN-MGVRWECSS------NTTWP-----------GPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEFSKEREKARAR 381          

HSP 4 Score: 100.138 bits (248), Expect = 1.292e-20
Identity = 67/215 (31.16%), Postives = 105/215 (48.84%), Query Frame = 3
Query: 2388 ELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEI---PLDSSGMSLL-----RAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFG-----DKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGE-WIESMWDCMLVNGYQCVP 2990
            E  I L IVMNTV ++     +S     FL   N  FT  F  EA LK++AL P+ Y  + WNVFD ++V+ S ++I    L+  G +L+     R FR++R+ KL    + +  L      +  A+  + +++ ++ FI+AV+GMQ FG     D  S  +N              NF+ F  + +++FR   GE W + M  C      +C P
Sbjct: 1120 EYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNN-------------NFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDP 1321          

HSP 5 Score: 83.9593 bits (206), Expect = 1.025e-15
Identity = 84/346 (24.28%), Postives = 160/346 (46.24%), Query Frame = 3
Query:  486 IASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAK------NSNSDTV----EYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFF--PVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTN----GDIH------ILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            + +  T+       + ++LS  N  R     ++ H  F+  VL  I+++   +A       NS  + +    +Y FT+++T+E T+K I  GL+ ++ ++ R+A+N LD +V+ ++   F      +  +  LR LRVLR L+ +    G+K VV  ++ AVK + + M++T  L  +F +IG+QL++GT              +F  N+   +T+AE                     C+   Y  +    P   V  +    N ++   NFDN   +++  F + T + W  L  + I +N    G IH       L+F+  I   +F+++N+ +  V +++ +
Sbjct:  763 VPAASTVKPIPKASSLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGT--------------FFLCNDLSKMTEAE---------------------CRG-EYIHYEDGDPTKPVSKKRVWSNNDF---NFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQN 1069          

HSP 6 Score: 83.5741 bits (205), Expect = 1.354e-15
Identity = 61/179 (34.08%), Postives = 101/179 (56.42%), Query Frame = 3
Query: 2463 MNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL------DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ 2981
            ++HF   AN FF   F +E  LK+ +LG   Y    +N FD  +VI S++E  L         G+S+LR+ RLLR+FK+ K W ++  L   +  ++ +I +L ++L + I IFA++GMQ+FG K+ NF  +         +PR NF+ F  + + VF++L GE     W+ ++ +G +
Sbjct:  501 LDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKF-NFNPQQ-------PKPRANFDTFVQALLTVFQILTGE----DWNTVMYHGIE 667          

HSP 7 Score: 80.1073 bits (196), Expect = 1.544e-14
Identity = 141/619 (22.78%), Postives = 262/619 (42.33%), Query Frame = 3
Query: 3660 WLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDS-TGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLE------------------------MFMTEDQKKYYNAMKKMSSTAPQ----KPIPRPKLKIANIIFSITINQKFDIFIMSVI----MLNTIVMCI---------EHWDQPEKLKTA-LDQINKVFIVIFTGEFLLKLIA-----QRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNV-----------------AYSHSID---------------EVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAV-VYLISYLIISFLVIINMYIAVILENF 5273
            WL     + +  F I+F+ EMLLK ++ G   Y    +   D  +V  +++  VL Y       +G    +R+ R LR  +    W  +R +V++L+ ++ SI ++LL+  +F +IF+++GMQ+FGGKF        F                      N      + NFD  +   L +FQ+ T + W  +M   ++S  G+G         I   Y++   I G +  LN+F+ + +DN            E                        M   E  ++  +A  +  S  P     KPIP+     A+ +F ++    F +F   V+      N ++ CI         E   Q    +   L+  +  F  +FT E  LK+I       +  + +  +N+ D ++V +S+  + + +   ++      ++++RV R+ R LR +  AKG++ ++  +IV++  + NI L+  M+ F++AI+G+  F                     Y H  D                 FNF+  G AMI LF +ST  GW  +L   ++ +     ++KG   +   AV ++ I+++I+    ++N+++  ++  F
Sbjct:  500 WLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDL-MKPLGV-SVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKF-------NF----------------------NPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTL-----GVIVCIYYIVLFICGNYILLNVFLAIAVDNLADADSLTNAEKEEEQQEIEGEDEEFEEGEDEGEEHGMDEPEGDEEMTSARPRRMSEVPAASTVKPIPK-----ASSLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSV------VKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSN----EEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTF 1067          

HSP 8 Score: 77.7962 bits (190), Expect = 8.825e-14
Identity = 63/218 (28.90%), Postives = 111/218 (50.92%), Query Frame = 3
Query: 2220 LQSALSALSIYDAETK--VRKKELIKQWLL-KTFCSWTCCPCYFKFQSL-VALIILDPFVELFITLCIVMNTVLMSIDTP---DNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSL-------LRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDK 2819
            LQ+A++A S  DA  K   ++K L +  ++ ++  S  C       + L ++++   PF E  I   I  N + ++I  P    +S   N  L+   Y F   F +E  LK++A+G    P  Y +  WN+ DFIIV++ LV   L  S MS+       LRAFR+LR  +L     ++ ++   I   +  + ++ +++  +I I+A++G++LF  K
Sbjct:   32 LQAAVAASSSQDATKKRPAQRKPLRQTNVVERSERSLLCLSLNNPIRKLCISIVEWKPF-EFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTIL--SKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGK 246          

HSP 9 Score: 67.0106 bits (162), Expect = 1.725e-10
Identity = 40/150 (26.67%), Postives = 81/150 (54.00%), Query Frame = 3
Query: 2397 ITLCIVMNTVLMSIDTP-DNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGA---IGNLCIVLGIIIFIFAVVGMQLFGDKY 2822
            +  CI++++ +++ + P   +   N  L   +YFFT+ F +E  LK+I  G       + +  +N+ D ++V +SL    L +  MS+++  R+LRV +  ++      L  ++   + A   IGN+ +V  ++ F+FA++G+QLF   +
Sbjct:  804 VLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTF 953          
BLAST of scna-1 vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 229.565 bits (584), Expect = 4.462e-60
Identity = 192/581 (33.05%), Postives = 314/581 (54.04%), Query Frame = 3
Query: 3633 EDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFA----FGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGG--MGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQK--------PIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRW-YYFKVPWNMFDFVIVILS---IVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYS--HSID---EVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNK-EKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEG 5303
            E  ++P   + +  L I   +FT+IFT EM++K  A     G   YFKD W  LD I+V I+L+++    + TG      G  + +R LRALRPLR ++R  G+++VV  LI ++  I N++L+C  F++IF I+G+QLF G  Y C+  +         +  K  C+     Y N  W N + NFDN+    + LF +++  GW+ IM   +D+ G+  QP  N++     YF+SF++   FF LN+F+GV+++NF+  K+ +   +     E + K     +K   +   K        P           +  I  ++ FD+ I +VI +N I M +E +  P  LK  L  +N  F  +FT E  +KLIA  +  +F   WN  D  IVILS   I+F   E++   +P++PT IRV+RV RI R+L+L+K AKGIR+LL ++  +LP + N+  L  ++ FI+A +G+  F  +  S  H  D   E  +F+ FG A + LF+I+T   WNG++   + +D    +  E   C   I+A  + + +++IS  V++N+ +AV++++  ++ K   EG
Sbjct: 1138 ERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGN------VTTKADCI---EDYRN-KWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEAL--ELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQFVLVNVVVAVLMKHLEESNKRDAEG 1706          

HSP 2 Score: 94.7449 bits (234), Expect = 5.936e-19
Identity = 74/253 (29.25%), Postives = 122/253 (48.22%), Query Frame = 3
Query: 2244 SIYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAE--------PRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNG 2975
             +YD E   +K    K W  +              + +   +I D F    I + I++NT+ M ++       +   L+ +N FFT  F LE  LK+IA G   Y  + +N+FD  IV LS++E+  +   G+S+LR FRLLR+ KL +    +    +++  T+  +     +L + IFIF+ +GM LFG K+ N  +  L      A+         R NF++F  + + VF++L  E     W+ +L NG
Sbjct:  623 QVYDGEEAKKKSTPSKLWWFR--------------EKIQKFVICDHFTR-GILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCNHPDTGL--QCTSAQVISSICECDRMNFDNFLFATVTVFQILTQE----DWNMVLFNG 854          

HSP 3 Score: 91.6633 bits (226), Expect = 4.876e-18
Identity = 86/314 (27.39%), Postives = 146/314 (46.50%), Query Frame = 3
Query: 3510 ETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDT-FERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKK 4448
            ++ P +LWW  R K  K V    F   I++ I++++L++ +E    P    L + LE  +  FT +F  EMLLK  A GL  Y  D +   D  IV ++++ L          G G    +RT R LR L+ V     +R  +  +++ + ++     + ++F  IFS +GM LFG KF  C + DT  +  SA++I +   C               ++NFDN L   + +FQ+ T + W  ++ + +  T          +     YFV+ + FG +   NL + ++++ F   K+     LE    ED +K
Sbjct:  633 KSTPSKLWW-FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPE--ILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQE-------GKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKF--CNHPDTGLQCTSAQVISSICEC--------------DRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT----------NPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLE----EDARK 906          

HSP 4 Score: 90.5077 bits (223), Expect = 1.123e-17
Identity = 65/210 (30.95%), Postives = 110/210 (52.38%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSL----------VEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGE-WIESMWDCM 2963
            I+   + +L I   I +N + M+++       + + LK  NYFFT  F LEA +KLIALG +++F E WN  D  IVILS+          +E+P++ + + ++R  R+ RV KL K  + +  L   +G  +  +GNL  +  ++ FIFA +G++LFG    +  +        G     +F +F  +F+ +FR+  G+ W   M D +
Sbjct: 1444 IVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPC-----DGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDAL 1648          

HSP 5 Score: 90.1225 bits (222), Expect = 1.640e-17
Identity = 91/366 (24.86%), Postives = 158/366 (43.17%), Query Frame = 3
Query:  465 KKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNS---DTVE--------YVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVL---------GNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWEN-LYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAI 1472
            K+ TFV     KT     T  + +L+ P NP+R   ++      F + VL  I INC+ +A    S   D+ E        Y+FT I+T E  +K I+ G  I +  Y +D WN LD I++ ++ +   F +L         G +  LR LR LR L+ +   PG+K VV  L+ ++K + + +++      IFG++G+QL++G ++  C+             E  N+T        Y                     N+W                  N+ Y NFDN   +L+  F L ++D W + +YQ       D+          ++YF+  +    F+++N+ + +V  ++   + A+
Sbjct: 1076 KQNTFVRKLLKKTCLHNRTEFSLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKG-MMYHCIGP-----------EVGNVTTKADCIEDYR--------------------NKW-----------------VNHRY-NFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEAL 1391          

HSP 6 Score: 79.7221 bits (195), Expect = 2.292e-14
Identity = 56/135 (41.48%), Postives = 76/135 (56.30%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFAFGL---NKYFKDAWCWLDFIIVTIALVSLVL-SYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCVNN 4064
            L+I+D    + F  EM++K  A G      Y  D W  LDF IV   +   VL  Y+G    G     A+RT+R LRPLRAV+R   MRI+VN L+  +P + NVLL+C   + IF I+G+QL+ G    +CV N
Sbjct:  167 LDIIDNCIFVYFAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLG----GNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVIN 297          

HSP 7 Score: 74.7146 bits (182), Expect = 8.562e-13
Identity = 81/343 (23.62%), Postives = 153/343 (44.61%), Query Frame = 3
Query:  555 PIRKTAIRLLTHPVFSFLVLTTIIINCVFMA------KNSNSDT--------VEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVI--GLAYLMFFFPVLGNXXXXXXXXXXXXX--KTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDA-----EKWTVKYEFFNNETNWLDPLR----------QCQNYTYNEW----NTSCPEG---YVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            P RK A++++  P F  + +  I+INCV +          + DT        ++      +  E  IK ++ G       Y+ D WN LDF ++  G+A  +    + GN++      V      + V  +P M+ +V  LL+ +  L + ++L  F+  IFG++G+QL+ G L  +CV +   T+   +   F N+        E  +++Y     + N L              +C N T +E+    N SC      Y   Q    NP  G  +FDN   + +  F +++ + W ++       +   + +YF+++I  G+F++IN+ L ++A  + + +
Sbjct:  118 PPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFY-GPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVDGVKC-NLTLDEYDKVTNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETK 458          

HSP 8 Score: 65.0846 bits (157), Expect = 5.882e-10
Identity = 78/293 (26.62%), Postives = 142/293 (48.46%), Query Frame = 3
Query: 4500 PRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWD-QPEKLKTALDQINK-VFIVIFTGEFLLKLIAQRWY-----YFKVPWNMFDFVIVILSIVFWAIESML-NNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEV---------------------FNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSY-IIAVVYLISYLIISFLVIINMYIAVILENFSQATK 5288
            P+  L+I       T  + FD  ++  I +N I + +E     P+  +     I+  +F VIFTGE ++K+IA   +     YFK  WN+ D ++V++S++  A E +   + P     IRV+R+ R  R LR++  A G++ ++ +LI SL  + NI L+      I+ I+G+  F  + Y     EV                     +NF+  G+A++ LF +S+  GW  +    M +       +     +Y    ++Y IS+L++    ++NM++ V++ENF +  +
Sbjct: 1103 PKNPLRIK--CLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSI----MYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKE 1389          

HSP 9 Score: 58.5362 bits (140), Expect = 5.445e-8
Identity = 58/223 (26.01%), Postives = 104/223 (46.64%), Query Frame = 3
Query: 2409 IVMNTVLMSIDTPDNSPEM--NHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLD--SSGMS--------LLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLF-GDKYSNFKNETLFPSFKG----------AEPRWNFNDFTHSFMIVFRVLCGE--WIESMWDCMLVNGYQCVP 2990
            I +N + ++++ P   P+     FL  + Y FT  F  E  +K+IA    +G   YF++ WN+ D I+V++SL+ I  +  ++G S        +LR  R LR  ++      + L+ M + +++  IGN+ ++      IF ++G+QLF G  Y     E    + K              R+NF++   + M +F VL  +  W+  M+  +   G    P
Sbjct: 1128 IGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLF-VLSSKDGWVSIMYQGIDAVGVDVQP 1349          
BLAST of scna-1 vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 229.565 bits (584), Expect = 4.462e-60
Identity = 192/581 (33.05%), Postives = 314/581 (54.04%), Query Frame = 3
Query: 3633 EDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFA----FGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGG--MGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQK--------PIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRW-YYFKVPWNMFDFVIVILS---IVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYS--HSID---EVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNK-EKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEG 5303
            E  ++P   + +  L I   +FT+IFT EM++K  A     G   YFKD W  LD I+V I+L+++    + TG      G  + +R LRALRPLR ++R  G+++VV  LI ++  I N++L+C  F++IF I+G+QLF G  Y C+  +         +  K  C+     Y N  W N + NFDN+    + LF +++  GW+ IM   +D+ G+  QP  N++     YF+SF++   FF LN+F+GV+++NF+  K+ +   +     E + K     +K   +   K        P           +  I  ++ FD+ I +VI +N I M +E +  P  LK  L  +N  F  +FT E  +KLIA  +  +F   WN  D  IVILS   I+F   E++   +P++PT IRV+RV RI R+L+L+K AKGIR+LL ++  +LP + N+  L  ++ FI+A +G+  F  +  S  H  D   E  +F+ FG A + LF+I+T   WNG++   + +D    +  E   C   I+A  + + +++IS  V++N+ +AV++++  ++ K   EG
Sbjct: 1138 ERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGN------VTTKADCI---EDYRN-KWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEAL--ELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQFVLVNVVVAVLMKHLEESNKRDAEG 1706          

HSP 2 Score: 94.7449 bits (234), Expect = 5.936e-19
Identity = 74/253 (29.25%), Postives = 122/253 (48.22%), Query Frame = 3
Query: 2244 SIYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAE--------PRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNG 2975
             +YD E   +K    K W  +              + +   +I D F    I + I++NT+ M ++       +   L+ +N FFT  F LE  LK+IA G   Y  + +N+FD  IV LS++E+  +   G+S+LR FRLLR+ KL +    +    +++  T+  +     +L + IFIF+ +GM LFG K+ N  +  L      A+         R NF++F  + + VF++L  E     W+ +L NG
Sbjct:  623 QVYDGEEAKKKSTPSKLWWFR--------------EKIQKFVICDHFTR-GILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCNHPDTGL--QCTSAQVISSICECDRMNFDNFLFATVTVFQILTQE----DWNMVLFNG 854          

HSP 3 Score: 91.6633 bits (226), Expect = 4.876e-18
Identity = 86/314 (27.39%), Postives = 146/314 (46.50%), Query Frame = 3
Query: 3510 ETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDT-FERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKK 4448
            ++ P +LWW  R K  K V    F   I++ I++++L++ +E    P    L + LE  +  FT +F  EMLLK  A GL  Y  D +   D  IV ++++ L          G G    +RT R LR L+ V     +R  +  +++ + ++     + ++F  IFS +GM LFG KF  C + DT  +  SA++I +   C               ++NFDN L   + +FQ+ T + W  ++ + +  T          +     YFV+ + FG +   NL + ++++ F   K+     LE    ED +K
Sbjct:  633 KSTPSKLWW-FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPE--ILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQE-------GKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKF--CNHPDTGLQCTSAQVISSICEC--------------DRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT----------NPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLE----EDARK 906          

HSP 4 Score: 90.5077 bits (223), Expect = 1.123e-17
Identity = 65/210 (30.95%), Postives = 110/210 (52.38%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSL----------VEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGE-WIESMWDCM 2963
            I+   + +L I   I +N + M+++       + + LK  NYFFT  F LEA +KLIALG +++F E WN  D  IVILS+          +E+P++ + + ++R  R+ RV KL K  + +  L   +G  +  +GNL  +  ++ FIFA +G++LFG    +  +        G     +F +F  +F+ +FR+  G+ W   M D +
Sbjct: 1444 IVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPC-----DGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDAL 1648          

HSP 5 Score: 90.1225 bits (222), Expect = 1.640e-17
Identity = 91/366 (24.86%), Postives = 158/366 (43.17%), Query Frame = 3
Query:  465 KKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNS---DTVE--------YVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVL---------GNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWEN-LYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAI 1472
            K+ TFV     KT     T  + +L+ P NP+R   ++      F + VL  I INC+ +A    S   D+ E        Y+FT I+T E  +K I+ G  I +  Y +D WN LD I++ ++ +   F +L         G +  LR LR LR L+ +   PG+K VV  L+ ++K + + +++      IFG++G+QL++G ++  C+             E  N+T        Y                     N+W                  N+ Y NFDN   +L+  F L ++D W + +YQ       D+          ++YF+  +    F+++N+ + +V  ++   + A+
Sbjct: 1076 KQNTFVRKLLKKTCLHNRTEFSLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKG-MMYHCIGP-----------EVGNVTTKADCIEDYR--------------------NKW-----------------VNHRY-NFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEAL 1391          

HSP 6 Score: 79.7221 bits (195), Expect = 2.292e-14
Identity = 56/135 (41.48%), Postives = 76/135 (56.30%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFAFGL---NKYFKDAWCWLDFIIVTIALVSLVL-SYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCVNN 4064
            L+I+D    + F  EM++K  A G      Y  D W  LDF IV   +   VL  Y+G    G     A+RT+R LRPLRAV+R   MRI+VN L+  +P + NVLL+C   + IF I+G+QL+ G    +CV N
Sbjct:  167 LDIIDNCIFVYFAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLG----GNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVIN 297          

HSP 7 Score: 74.7146 bits (182), Expect = 8.562e-13
Identity = 81/343 (23.62%), Postives = 153/343 (44.61%), Query Frame = 3
Query:  555 PIRKTAIRLLTHPVFSFLVLTTIIINCVFMA------KNSNSDT--------VEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVI--GLAYLMFFFPVLGNXXXXXXXXXXXXX--KTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDA-----EKWTVKYEFFNNETNWLDPLR----------QCQNYTYNEW----NTSCPEG---YVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            P RK A++++  P F  + +  I+INCV +          + DT        ++      +  E  IK ++ G       Y+ D WN LDF ++  G+A  +    + GN++      V      + V  +P M+ +V  LL+ +  L + ++L  F+  IFG++G+QL+ G L  +CV +   T+   +   F N+        E  +++Y     + N L              +C N T +E+    N SC      Y   Q    NP  G  +FDN   + +  F +++ + W ++       +   + +YF+++I  G+F++IN+ L ++A  + + +
Sbjct:  118 PPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFY-GPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVDGVKC-NLTLDEYDKVTNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETK 458          

HSP 8 Score: 65.0846 bits (157), Expect = 5.882e-10
Identity = 78/293 (26.62%), Postives = 142/293 (48.46%), Query Frame = 3
Query: 4500 PRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWD-QPEKLKTALDQINK-VFIVIFTGEFLLKLIAQRWY-----YFKVPWNMFDFVIVILSIVFWAIESML-NNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEV---------------------FNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSY-IIAVVYLISYLIISFLVIINMYIAVILENFSQATK 5288
            P+  L+I       T  + FD  ++  I +N I + +E     P+  +     I+  +F VIFTGE ++K+IA   +     YFK  WN+ D ++V++S++  A E +   + P     IRV+R+ R  R LR++  A G++ ++ +LI SL  + NI L+      I+ I+G+  F  + Y     EV                     +NF+  G+A++ LF +S+  GW  +    M +       +     +Y    ++Y IS+L++    ++NM++ V++ENF +  +
Sbjct: 1103 PKNPLRIK--CLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSI----MYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKE 1389          

HSP 9 Score: 58.5362 bits (140), Expect = 5.445e-8
Identity = 58/223 (26.01%), Postives = 104/223 (46.64%), Query Frame = 3
Query: 2409 IVMNTVLMSIDTPDNSPEM--NHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLD--SSGMS--------LLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLF-GDKYSNFKNETLFPSFKG----------AEPRWNFNDFTHSFMIVFRVLCGE--WIESMWDCMLVNGYQCVP 2990
            I +N + ++++ P   P+     FL  + Y FT  F  E  +K+IA    +G   YF++ WN+ D I+V++SL+ I  +  ++G S        +LR  R LR  ++      + L+ M + +++  IGN+ ++      IF ++G+QLF G  Y     E    + K              R+NF++   + M +F VL  +  W+  M+  +   G    P
Sbjct: 1128 IGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLF-VLSSKDGWVSIMYQGIDAVGVDVQP 1349          
BLAST of scna-1 vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 229.565 bits (584), Expect = 4.462e-60
Identity = 192/581 (33.05%), Postives = 314/581 (54.04%), Query Frame = 3
Query: 3633 EDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFA----FGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGG--MGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQK--------PIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRW-YYFKVPWNMFDFVIVILS---IVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYS--HSID---EVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNK-EKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEG 5303
            E  ++P   + +  L I   +FT+IFT EM++K  A     G   YFKD W  LD I+V I+L+++    + TG      G  + +R LRALRPLR ++R  G+++VV  LI ++  I N++L+C  F++IF I+G+QLF G  Y C+  +         +  K  C+     Y N  W N + NFDN+    + LF +++  GW+ IM   +D+ G+  QP  N++     YF+SF++   FF LN+F+GV+++NF+  K+ +   +     E + K     +K   +   K        P           +  I  ++ FD+ I +VI +N I M +E +  P  LK  L  +N  F  +FT E  +KLIA  +  +F   WN  D  IVILS   I+F   E++   +P++PT IRV+RV RI R+L+L+K AKGIR+LL ++  +LP + N+  L  ++ FI+A +G+  F  +  S  H  D   E  +F+ FG A + LF+I+T   WNG++   + +D    +  E   C   I+A  + + +++IS  V++N+ +AV++++  ++ K   EG
Sbjct: 1138 ERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGN------VTTKADCI---EDYRN-KWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEAL--ELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQFVLVNVVVAVLMKHLEESNKRDAEG 1706          

HSP 2 Score: 94.7449 bits (234), Expect = 5.936e-19
Identity = 74/253 (29.25%), Postives = 122/253 (48.22%), Query Frame = 3
Query: 2244 SIYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAE--------PRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNG 2975
             +YD E   +K    K W  +              + +   +I D F    I + I++NT+ M ++       +   L+ +N FFT  F LE  LK+IA G   Y  + +N+FD  IV LS++E+  +   G+S+LR FRLLR+ KL +    +    +++  T+  +     +L + IFIF+ +GM LFG K+ N  +  L      A+         R NF++F  + + VF++L  E     W+ +L NG
Sbjct:  623 QVYDGEEAKKKSTPSKLWWFR--------------EKIQKFVICDHFTR-GILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCNHPDTGL--QCTSAQVISSICECDRMNFDNFLFATVTVFQILTQE----DWNMVLFNG 854          

HSP 3 Score: 91.6633 bits (226), Expect = 4.876e-18
Identity = 86/314 (27.39%), Postives = 146/314 (46.50%), Query Frame = 3
Query: 3510 ETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDT-FERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKK 4448
            ++ P +LWW  R K  K V    F   I++ I++++L++ +E    P    L + LE  +  FT +F  EMLLK  A GL  Y  D +   D  IV ++++ L          G G    +RT R LR L+ V     +R  +  +++ + ++     + ++F  IFS +GM LFG KF  C + DT  +  SA++I +   C               ++NFDN L   + +FQ+ T + W  ++ + +  T          +     YFV+ + FG +   NL + ++++ F   K+     LE    ED +K
Sbjct:  633 KSTPSKLWW-FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPE--ILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQE-------GKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKF--CNHPDTGLQCTSAQVISSICEC--------------DRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT----------NPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLE----EDARK 906          

HSP 4 Score: 90.5077 bits (223), Expect = 1.123e-17
Identity = 65/210 (30.95%), Postives = 110/210 (52.38%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSL----------VEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGE-WIESMWDCM 2963
            I+   + +L I   I +N + M+++       + + LK  NYFFT  F LEA +KLIALG +++F E WN  D  IVILS+          +E+P++ + + ++R  R+ RV KL K  + +  L   +G  +  +GNL  +  ++ FIFA +G++LFG    +  +        G     +F +F  +F+ +FR+  G+ W   M D +
Sbjct: 1444 IVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPC-----DGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDAL 1648          

HSP 5 Score: 90.1225 bits (222), Expect = 1.640e-17
Identity = 91/366 (24.86%), Postives = 158/366 (43.17%), Query Frame = 3
Query:  465 KKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNS---DTVE--------YVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVL---------GNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWEN-LYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAI 1472
            K+ TFV     KT     T  + +L+ P NP+R   ++      F + VL  I INC+ +A    S   D+ E        Y+FT I+T E  +K I+ G  I +  Y +D WN LD I++ ++ +   F +L         G +  LR LR LR L+ +   PG+K VV  L+ ++K + + +++      IFG++G+QL++G ++  C+             E  N+T        Y                     N+W                  N+ Y NFDN   +L+  F L ++D W + +YQ       D+          ++YF+  +    F+++N+ + +V  ++   + A+
Sbjct: 1076 KQNTFVRKLLKKTCLHNRTEFSLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKG-MMYHCIGP-----------EVGNVTTKADCIEDYR--------------------NKW-----------------VNHRY-NFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEAL 1391          

HSP 6 Score: 79.7221 bits (195), Expect = 2.292e-14
Identity = 56/135 (41.48%), Postives = 76/135 (56.30%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFAFGL---NKYFKDAWCWLDFIIVTIALVSLVL-SYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCVNN 4064
            L+I+D    + F  EM++K  A G      Y  D W  LDF IV   +   VL  Y+G    G     A+RT+R LRPLRAV+R   MRI+VN L+  +P + NVLL+C   + IF I+G+QL+ G    +CV N
Sbjct:  167 LDIIDNCIFVYFAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLG----GNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVIN 297          

HSP 7 Score: 74.7146 bits (182), Expect = 8.562e-13
Identity = 81/343 (23.62%), Postives = 153/343 (44.61%), Query Frame = 3
Query:  555 PIRKTAIRLLTHPVFSFLVLTTIIINCVFMA------KNSNSDT--------VEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVI--GLAYLMFFFPVLGNXXXXXXXXXXXXX--KTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDA-----EKWTVKYEFFNNETNWLDPLR----------QCQNYTYNEW----NTSCPEG---YVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            P RK A++++  P F  + +  I+INCV +          + DT        ++      +  E  IK ++ G       Y+ D WN LDF ++  G+A  +    + GN++      V      + V  +P M+ +V  LL+ +  L + ++L  F+  IFG++G+QL+ G L  +CV +   T+   +   F N+        E  +++Y     + N L              +C N T +E+    N SC      Y   Q    NP  G  +FDN   + +  F +++ + W ++       +   + +YF+++I  G+F++IN+ L ++A  + + +
Sbjct:  118 PPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFY-GPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVDGVKC-NLTLDEYDKVTNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETK 458          

HSP 8 Score: 65.0846 bits (157), Expect = 5.882e-10
Identity = 78/293 (26.62%), Postives = 142/293 (48.46%), Query Frame = 3
Query: 4500 PRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWD-QPEKLKTALDQINK-VFIVIFTGEFLLKLIAQRWY-----YFKVPWNMFDFVIVILSIVFWAIESML-NNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEV---------------------FNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSY-IIAVVYLISYLIISFLVIINMYIAVILENFSQATK 5288
            P+  L+I       T  + FD  ++  I +N I + +E     P+  +     I+  +F VIFTGE ++K+IA   +     YFK  WN+ D ++V++S++  A E +   + P     IRV+R+ R  R LR++  A G++ ++ +LI SL  + NI L+      I+ I+G+  F  + Y     EV                     +NF+  G+A++ LF +S+  GW  +    M +       +     +Y    ++Y IS+L++    ++NM++ V++ENF +  +
Sbjct: 1103 PKNPLRIK--CLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSI----MYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKE 1389          

HSP 9 Score: 58.5362 bits (140), Expect = 5.445e-8
Identity = 58/223 (26.01%), Postives = 104/223 (46.64%), Query Frame = 3
Query: 2409 IVMNTVLMSIDTPDNSPEM--NHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLD--SSGMS--------LLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLF-GDKYSNFKNETLFPSFKG----------AEPRWNFNDFTHSFMIVFRVLCGE--WIESMWDCMLVNGYQCVP 2990
            I +N + ++++ P   P+     FL  + Y FT  F  E  +K+IA    +G   YF++ WN+ D I+V++SL+ I  +  ++G S        +LR  R LR  ++      + L+ M + +++  IGN+ ++      IF ++G+QLF G  Y     E    + K              R+NF++   + M +F VL  +  W+  M+  +   G    P
Sbjct: 1128 IGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLF-VLSSKDGWVSIMYQGIDAVGVDVQP 1349          
BLAST of scna-1 vs. Ensembl Fly
Match: para (gene:FBgn0285944 transcript:FBtr0303685)

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 410/767 (53.46%), Postives = 547/767 (71.32%), Query Frame = 3
Query: 3426 EIIYSTSPEDCLPN-FISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVN-NDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE---DPKVCNKE-KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQK--PEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTER 5702
            E I    P DC P+ +  K      D   ++P  + W N R K  +L+E+++FET +I MI++SSL L LED +LP RP L+  L  +D++FT+IF  EML+KW A G   YF +AWCWLDF+IV ++L++ V S +G  AGG+ AFK MRTLRALRPLRA+SR +GMR+VVNAL+QAIPSIFNVLLVCL+FWLIF+I+G+QLF GK++KC + N T  ++S EIIPN+NAC        N +W NS +NFD+V N YLCLFQVATFKGWI+IM DA+DS  +  QP    +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GGSLEMFMTEDQKKYYNAMKKM S  P K IPRP+ +   I+F I  ++KFDI IM  I LN   M ++ +D  +     LD +N +F+VIF+ E LLK+ A R++YF  PWN+FD V+VILSI+   +  ++    VSPT +RVVRV ++GR+LRLVK AKGIRTLLF+L +SLPAL NI LLL ++MFI+AI GMSFF +V     I++V+NF+TFG++MI+LFQ+STS GW+GVL+ ++NE   DP   +K   G CGS  + + +L+SYL+ISFL++INMYIAVILEN+SQAT+DVQEGLT DDYD++YE W+++D +   +I    L +F++ ++ PL I KPN  ++  ++IPIC+ D +YCVD+L+ LT+ F  +K  P  +TGE      +PD +  +     VS+TL RQRE + A++I    + +  R
Sbjct: 1208 EDILDEYPADCCPDSYYKKFPILAGDD--DSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVG--AGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGT--KLSHEIIPNRNAC-----ESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEP----VSSTLWRQREEYCARLIQHAWRKHKAR 1959          

HSP 2 Score: 343.584 bits (880), Expect = 7.052e-95
Identity = 190/388 (48.97%), Postives = 260/388 (67.01%), Query Frame = 3
Query:  330 KQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFM--AKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFN-NETNWLD-------PLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            + +D   +P+P LE G  +P  L   FP  +L+  PL ++DP+Y    TFVV++  K IFRFS +KA ++L P NPIR+ AI +L HP+FS  ++TTI++NC+ M        ++ E +FT IYT E  +K ++RG I+  FTYLRDAWNWLDF+VI LAY+      LGNL+ALR+ RVLRALKTV  VPG+KT+VGA++E+VK LRD ++LT+F LS+F L+GLQ+Y G L +KC+K F           + NLTD E W    ++ N N +NW         PL  C N +       C + YVC+Q    NPNYGYT+FD+F  + L AFRLMTQD+WE+LYQL +R  G  H+L+F+++IF GSFYL+N+ILAIVAMSYD+++
Sbjct:   56 EDEDEGPQPDPTLEQGVPIPVRLQGSFP-PELASTPLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID-LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLD------GSWGNLTD-ENW----DYHNRNSSNWYSEDEGISFPL--CGNIS---GAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 425          

HSP 3 Score: 310.457 bits (794), Expect = 1.045e-84
Identity = 184/298 (61.74%), Postives = 221/298 (74.16%), Query Frame = 3
Query: 2301 LKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKL 3191
            +  FC W CC  + KFQ  V+LI+ DPFVELFITLCIV+NT+ M++D  D + EM   LK  NYFFT TF +EA +KL+A+ P+ YFQE WN+FDFIIV LSL+E+ L+   G+S+LR+FRLLRVFKLAKSW T+NLL  I+G T+GA+GNL  VL IIIFIFAV+GMQLFG  Y + K+   FP   G  PRWNF DF HSFMIVFRVLCGEWIESMWDCM V    C+PFFL T+++GNLV+LNLFLALLLS+FGS SL     D N+TNK+ EA +RI R   WVK  I    KL
Sbjct:  760 IDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKDR--FPD--GDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTAD-NDTNKIAEAFNRIGRFKSWVKRNIADCFKL 1052          

HSP 4 Score: 86.6557 bits (213), Expect = 2.082e-16
Identity = 62/223 (27.80%), Postives = 110/223 (49.33%), Query Frame = 3
Query: 2349 QSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS---------SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVP 2990
            Q++V  I+ D   ++ I L I +N   M++D  D S   N  L   N  F   F  E  LK+ AL    YF E WN+FD ++VILS++ + L           + + ++R  ++ RV +L K  + +  L   +  ++ A+ N+C++L +++FIFA+ GM  F     + K ++      G    +NF  F  S +++F++      + + D  ++N   C P
Sbjct: 1564 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL-RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFF----MHVKEKS------GINDVYNFKTFGQSMILLFQMSTSAGWDGVLDA-IINEEACDP 1774          

HSP 5 Score: 76.6406 bits (187), Expect = 2.683e-13
Identity = 57/232 (24.57%), Postives = 108/232 (46.55%), Query Frame = 3
Query: 3645 LPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGY---------LCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHST 4298
            +P+ P     +E  + +FT I+T E  +K  A G       Y +DAW WLDF+++ +A V++ +         +G   A+RT R LR L+ V+   G++ +V A+I+++ ++ +V+++ +    +F+++G+Q++ G    KC+                     +   +GN++ EN   +  N  N Y         LC        G  +   D V   G G  P+Y +++
Sbjct:  161 MPTTP----TVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID--------LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKK-----------------FPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLC----GNISGAGQCDDDYVCLQGFGPNPNYGYTS 359          

HSP 6 Score: 67.3958 bits (163), Expect = 1.852e-10
Identity = 44/155 (28.39%), Postives = 83/155 (53.55%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            I++ P   LFI   I++N +LM + T   +P     ++     FT  +  E+ +K++A G    P  Y ++ WN  DF+++ L+ V + +D   ++ LR FR+LR  K       +  L  I+G  + ++ NL  V+ + +F   +FA++G+Q++
Sbjct:  138 ILVHPLFSLFIITTILVNCILMIMPT---TPT----VESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVA---IVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIY 282          

HSP 7 Score: 67.0106 bits (162), Expect = 1.884e-10
Identity = 58/225 (25.78%), Postives = 107/225 (47.56%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPD--NSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIP---LDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIG---NLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETL---------FPSFKGAEPR---W-----NFNDFTHSFMIVFRVLCGE-WIESMWDCM 2963
            +I + + E  +   I+M+++ ++++       P +   L   +  FT  F LE  +K +ALG + YF   W   DF+IV++SL+      + + G+   +  R LR  +  ++   M  + +++   V AI    N+ +V  I   IFA++G+QLF  KY  FK E +          P+    E     W     NF+   ++++ +F+V   + WI+ M D +
Sbjct: 1252 LIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKY--FKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAI 1474          

HSP 8 Score: 65.855 bits (159), Expect = 5.437e-10
Identity = 69/328 (21.04%), Postives = 136/328 (41.46%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXX-----KTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYW----------ENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            +R    +L+ +  F   V+T I+++ + +A        +    D + Y   +FT I+ LE  IK ++ G  +    Y  +AW WLDF+++ ++ + F   ++G         +         + ++ + GM+ VV AL++A+  + + +++ +    IF ++G+QL+ G    KC +  N T L  E     N  ++E +T                          W  S                    NFD+   + LC F++ T   W            + +  IR       LYF+  I FGSF+ +N+ + ++  ++++ +
Sbjct: 1245 LRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKV----YFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYF-KC-EDMNGTKLSHEIIPNRNACESENYT--------------------------WVNSA------------------MNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQK 1522          

HSP 9 Score: 57.3806 bits (137), Expect = 1.729e-7
Identity = 45/186 (24.19%), Postives = 83/186 (44.62%), Query Frame = 3
Query: 3696 FTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAV 4253
            FT  F  E  +K  A     YF++ W   DFIIV ++L+ L L  +            +R+ R LR  +    W  + ++++ + + + ++ N+  V  +   IF+++GMQLFG  ++     D  +R     +P                W     NF + ++ ++ +F+V   + WIE M D +
Sbjct:  825 FTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQ-------GLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYH-----DHKDRFPDGDLPR---------------W-----NFTDFMHSFMIVFRVLCGE-WIESMWDCM 977          
BLAST of scna-1 vs. Ensembl Fly
Match: para (gene:FBgn0285944 transcript:FBtr0303657)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 410/767 (53.46%), Postives = 547/767 (71.32%), Query Frame = 3
Query: 3426 EIIYSTSPEDCLPN-FISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVN-NDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE---DPKVCNKE-KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQK--PEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTER 5702
            E I    P DC P+ +  K      D   ++P  + W N R K  +L+E+++FET +I MI++SSL L LED +LP RP L+  L  +D++FT+IF  EML+KW A G   YF +AWCWLDF+IV ++L++ V S +G  AGG+ AFK MRTLRALRPLRA+SR +GMR+VVNAL+QAIPSIFNVLLVCL+FWLIF+I+G+QLF GK++KC + N T  ++S EIIPN+NAC        N +W NS +NFD+V N YLCLFQVATFKGWI+IM DA+DS  +  QP    +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GGSLEMFMTEDQKKYYNAMKKM S  P K IPRP+ +   I+F I  ++KFDI IM  I LN   M ++ +D  +     LD +N +F+VIF+ E LLK+ A R++YF  PWN+FD V+VILSI+   +  ++    VSPT +RVVRV ++GR+LRLVK AKGIRTLLF+L +SLPAL NI LLL ++MFI+AI GMSFF +V     I++V+NF+TFG++MI+LFQ+STS GW+GVL+ ++NE   DP   +K   G CGS  + + +L+SYL+ISFL++INMYIAVILEN+SQAT+DVQEGLT DDYD++YE W+++D +   +I    L +F++ ++ PL I KPN  ++  ++IPIC+ D +YCVD+L+ LT+ F  +K  P  +TGE      +PD +  +     VS+TL RQRE + A++I    + +  R
Sbjct: 1209 EDILDEYPADCCPDSYYKKFPILAGDD--DSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVG--AGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGT--KLSHEIIPNRNAC-----ESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEP----VSSTLWRQREEYCARLIQHAWRKHKAR 1960          

HSP 2 Score: 343.199 bits (879), Expect = 8.606e-95
Identity = 190/388 (48.97%), Postives = 260/388 (67.01%), Query Frame = 3
Query:  330 KQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFM--AKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFN-NETNWLD-------PLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            + +D   +P+P LE G  +P  L   FP  +L+  PL ++DP+Y    TFVV++  K IFRFS +KA ++L P NPIR+ AI +L HP+FS  ++TTI++NC+ M        ++ E +FT IYT E  +K ++RG I+  FTYLRDAWNWLDF+VI LAY+      LGNL+ALR+ RVLRALKTV  VPG+KT+VGA++E+VK LRD ++LT+F LS+F L+GLQ+Y G L +KC+K F           + NLTD E W    ++ N N +NW         PL  C N +       C + YVC+Q    NPNYGYT+FD+F  + L AFRLMTQD+WE+LYQL +R  G  H+L+F+++IF GSFYL+N+ILAIVAMSYD+++
Sbjct:   67 EDEDEGPQPDPTLEQGVPIPVRLQGSFP-PELASTPLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID-LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLD------GSWGNLTD-ENW----DYHNRNSSNWYSEDEGISFPL--CGNIS---GAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 436          

HSP 3 Score: 310.457 bits (794), Expect = 1.169e-84
Identity = 184/298 (61.74%), Postives = 221/298 (74.16%), Query Frame = 3
Query: 2301 LKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKL 3191
            +  FC W CC  + KFQ  V+LI+ DPFVELFITLCIV+NT+ M++D  D + EM   LK  NYFFT TF +EA +KL+A+ P+ YFQE WN+FDFIIV LSL+E+ L+   G+S+LR+FRLLRVFKLAKSW T+NLL  I+G T+GA+GNL  VL IIIFIFAV+GMQLFG  Y + K+   FP   G  PRWNF DF HSFMIVFRVLCGEWIESMWDCM V    C+PFFL T+++GNLV+LNLFLALLLS+FGS SL     D N+TNK+ EA +RI R   WVK  I    KL
Sbjct:  771 IDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKDR--FPD--GDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTAD-NDTNKIAEAFNRIGRFKSWVKRNIADCFKL 1063          

HSP 4 Score: 87.0409 bits (214), Expect = 1.963e-16
Identity = 62/223 (27.80%), Postives = 110/223 (49.33%), Query Frame = 3
Query: 2349 QSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS---------SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVP 2990
            Q++V  I+ D   ++ I L I +N   M++D  D S   N  L   N  F   F  E  LK+ AL    YF E WN+FD ++VILS++ + L           + + ++R  ++ RV +L K  + +  L   +  ++ A+ N+C++L +++FIFA+ GM  F     + K ++      G    +NF  F  S +++F++      + + D  ++N   C P
Sbjct: 1565 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL-RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFF----MHVKEKS------GINDVYNFKTFGQSMILLFQMSTSAGWDGVLDA-IINEEACDP 1775          

HSP 5 Score: 76.6406 bits (187), Expect = 2.551e-13
Identity = 57/232 (24.57%), Postives = 108/232 (46.55%), Query Frame = 3
Query: 3645 LPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGY---------LCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHST 4298
            +P+ P     +E  + +FT I+T E  +K  A G       Y +DAW WLDF+++ +A V++ +         +G   A+RT R LR L+ V+   G++ +V A+I+++ ++ +V+++ +    +F+++G+Q++ G    KC+                     +   +GN++ EN   +  N  N Y         LC        G  +   D V   G G  P+Y +++
Sbjct:  172 MPTTP----TVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID--------LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKK-----------------FPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLC----GNISGAGQCDDDYVCLQGFGPNPNYGYTS 370          

HSP 6 Score: 67.3958 bits (163), Expect = 1.703e-10
Identity = 44/155 (28.39%), Postives = 83/155 (53.55%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            I++ P   LFI   I++N +LM + T   +P     ++     FT  +  E+ +K++A G    P  Y ++ WN  DF+++ L+ V + +D   ++ LR FR+LR  K       +  L  I+G  + ++ NL  V+ + +F   +FA++G+Q++
Sbjct:  149 ILVHPLFSLFIITTILVNCILMIMPT---TPT----VESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVA---IVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIY 293          

HSP 7 Score: 67.3958 bits (163), Expect = 1.791e-10
Identity = 58/225 (25.78%), Postives = 106/225 (47.11%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPD--NSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIP---LDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIG---NLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETL---------FPSFKGAEPR---W-----NFNDFTHSFMIVFRVLC-GEWIESMWDCM 2963
            +I + + E  +   I+M+++ ++++       P +   L   +  FT  F LE  +K +ALG + YF   W   DF+IV++SL+      + + G+   +  R LR  +  ++   M  + +++   V AI    N+ +V  I   IFA++G+QLF  KY  FK E +          P+    E     W     NF+   ++++ +F+V     WI+ M D +
Sbjct: 1253 LIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKY--FKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAI 1475          

HSP 8 Score: 65.855 bits (159), Expect = 4.915e-10
Identity = 69/328 (21.04%), Postives = 136/328 (41.46%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXX-----KTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYW----------ENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            +R    +L+ +  F   V+T I+++ + +A        +    D + Y   +FT I+ LE  IK ++ G  +    Y  +AW WLDF+++ ++ + F   ++G         +         + ++ + GM+ VV AL++A+  + + +++ +    IF ++G+QL+ G    KC +  N T L  E     N  ++E +T                          W  S                    NFD+   + LC F++ T   W            + +  IR       LYF+  I FGSF+ +N+ + ++  ++++ +
Sbjct: 1246 LRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKV----YFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYF-KC-EDMNGTKLSHEIIPNRNACESENYT--------------------------WVNSA------------------MNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQK 1523          

HSP 9 Score: 57.3806 bits (137), Expect = 1.729e-7
Identity = 45/186 (24.19%), Postives = 83/186 (44.62%), Query Frame = 3
Query: 3696 FTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAV 4253
            FT  F  E  +K  A     YF++ W   DFIIV ++L+ L L  +            +R+ R LR  +    W  + ++++ + + + ++ N+  V  +   IF+++GMQLFG  ++     D  +R     +P                W     NF + ++ ++ +F+V   + WIE M D +
Sbjct:  836 FTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQ-------GLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYH-----DHKDRFPDGDLPR---------------W-----NFTDFMHSFMIVFRVLCGE-WIESMWDCM 988          
BLAST of scna-1 vs. Ensembl Fly
Match: para (gene:FBgn0285944 transcript:FBtr0303662)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 410/767 (53.46%), Postives = 547/767 (71.32%), Query Frame = 3
Query: 3426 EIIYSTSPEDCLPN-FISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVN-NDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE---DPKVCNKE-KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQK--PEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTER 5702
            E I    P DC P+ +  K      D   ++P  + W N R K  +L+E+++FET +I MI++SSL L LED +LP RP L+  L  +D++FT+IF  EML+KW A G   YF +AWCWLDF+IV ++L++ V S +G  AGG+ AFK MRTLRALRPLRA+SR +GMR+VVNAL+QAIPSIFNVLLVCL+FWLIF+I+G+QLF GK++KC + N T  ++S EIIPN+NAC        N +W NS +NFD+V N YLCLFQVATFKGWI+IM DA+DS  +  QP    +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GGSLEMFMTEDQKKYYNAMKKM S  P K IPRP+ +   I+F I  ++KFDI IM  I LN   M ++ +D  +     LD +N +F+VIF+ E LLK+ A R++YF  PWN+FD V+VILSI+   +  ++    VSPT +RVVRV ++GR+LRLVK AKGIRTLLF+L +SLPAL NI LLL ++MFI+AI GMSFF +V     I++V+NF+TFG++MI+LFQ+STS GW+GVL+ ++NE   DP   +K   G CGS  + + +L+SYL+ISFL++INMYIAVILEN+SQAT+DVQEGLT DDYD++YE W+++D +   +I    L +F++ ++ PL I KPN  ++  ++IPIC+ D +YCVD+L+ LT+ F  +K  P  +TGE      +PD +  +     VS+TL RQRE + A++I    + +  R
Sbjct: 1209 EDILDEYPADCCPDSYYKKFPILAGDD--DSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVG--AGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGT--KLSHEIIPNRNAC-----ESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEP----VSSTLWRQREEYCARLIQHAWRKHKAR 1960          

HSP 2 Score: 343.199 bits (879), Expect = 9.299e-95
Identity = 190/388 (48.97%), Postives = 260/388 (67.01%), Query Frame = 3
Query:  330 KQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFM--AKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFN-NETNWLD-------PLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            + +D   +P+P LE G  +P  L   FP  +L+  PL ++DP+Y    TFVV++  K IFRFS +KA ++L P NPIR+ AI +L HP+FS  ++TTI++NC+ M        ++ E +FT IYT E  +K ++RG I+  FTYLRDAWNWLDF+VI LAY+      LGNL+ALR+ RVLRALKTV  VPG+KT+VGA++E+VK LRD ++LT+F LS+F L+GLQ+Y G L +KC+K F           + NLTD E W    ++ N N +NW         PL  C N +       C + YVC+Q    NPNYGYT+FD+F  + L AFRLMTQD+WE+LYQL +R  G  H+L+F+++IF GSFYL+N+ILAIVAMSYD+++
Sbjct:   67 EDEDEGPQPDPTLEQGVPIPVRLQGSFP-PELASTPLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID-LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLD------GSWGNLTD-ENW----DYHNRNSSNWYSEDEGISFPL--CGNIS---GAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 436          

HSP 3 Score: 312.383 bits (799), Expect = 3.027e-85
Identity = 185/298 (62.08%), Postives = 222/298 (74.50%), Query Frame = 3
Query: 2301 LKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKL 3191
            +  FC W CC  + KFQ  V+LI+ DPFVELFITLCIV+NT+ M++D  D + EM   LK  NYFFT TF +EA +KL+A+ P+ YFQE WN+FDFIIV LSL+E+ L+   G+S+LR+FRLLRVFKLAKSW T+NLL  I+G TVGA+GNL  VL IIIFIFAV+GMQLFG  Y++ K+   FP   G  PRWNF DF HSFMIVFRVLCGEWIESMWDCM V    C+PFFL T+++GNLV+LNLFLALLLS+FGS SL     D N+TNK+ EA +RI R   WVK  I    KL
Sbjct:  771 IDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDR--FPD--GDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTAD-NDTNKIAEAFNRIGRFKSWVKRNIADCFKL 1063          

HSP 4 Score: 87.0409 bits (214), Expect = 1.947e-16
Identity = 62/223 (27.80%), Postives = 110/223 (49.33%), Query Frame = 3
Query: 2349 QSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS---------SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVP 2990
            Q++V  I+ D   ++ I L I +N   M++D  D S   N  L   N  F   F  E  LK+ AL    YF E WN+FD ++VILS++ + L           + + ++R  ++ RV +L K  + +  L   +  ++ A+ N+C++L +++FIFA+ GM  F     + K ++      G    +NF  F  S +++F++      + + D  ++N   C P
Sbjct: 1565 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL-RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFF----MHVKEKS------GINDVYNFKTFGQSMILLFQMSTSAGWDGVLDA-IINEEACDP 1775          

HSP 5 Score: 76.6406 bits (187), Expect = 2.617e-13
Identity = 57/232 (24.57%), Postives = 108/232 (46.55%), Query Frame = 3
Query: 3645 LPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGY---------LCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHST 4298
            +P+ P     +E  + +FT I+T E  +K  A G       Y +DAW WLDF+++ +A V++ +         +G   A+RT R LR L+ V+   G++ +V A+I+++ ++ +V+++ +    +F+++G+Q++ G    KC+                     +   +GN++ EN   +  N  N Y         LC        G  +   D V   G G  P+Y +++
Sbjct:  172 MPTTP----TVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID--------LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKK-----------------FPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLC----GNISGAGQCDDDYVCLQGFGPNPNYGYTS 370          

HSP 6 Score: 67.3958 bits (163), Expect = 1.747e-10
Identity = 44/155 (28.39%), Postives = 83/155 (53.55%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            I++ P   LFI   I++N +LM + T   +P     ++     FT  +  E+ +K++A G    P  Y ++ WN  DF+++ L+ V + +D   ++ LR FR+LR  K       +  L  I+G  + ++ NL  V+ + +F   +FA++G+Q++
Sbjct:  149 ILVHPLFSLFIITTILVNCILMIMPT---TPT----VESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVA---IVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIY 293          

HSP 7 Score: 67.3958 bits (163), Expect = 1.806e-10
Identity = 58/225 (25.78%), Postives = 106/225 (47.11%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPD--NSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIP---LDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIG---NLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETL---------FPSFKGAEPR---W-----NFNDFTHSFMIVFRVLC-GEWIESMWDCM 2963
            +I + + E  +   I+M+++ ++++       P +   L   +  FT  F LE  +K +ALG + YF   W   DF+IV++SL+      + + G+   +  R LR  +  ++   M  + +++   V AI    N+ +V  I   IFA++G+QLF  KY  FK E +          P+    E     W     NF+   ++++ +F+V     WI+ M D +
Sbjct: 1253 LIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKY--FKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAI 1475          

HSP 8 Score: 65.855 bits (159), Expect = 5.214e-10
Identity = 69/328 (21.04%), Postives = 136/328 (41.46%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXX-----KTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYW----------ENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            +R    +L+ +  F   V+T I+++ + +A        +    D + Y   +FT I+ LE  IK ++ G  +    Y  +AW WLDF+++ ++ + F   ++G         +         + ++ + GM+ VV AL++A+  + + +++ +    IF ++G+QL+ G    KC +  N T L  E     N  ++E +T                          W  S                    NFD+   + LC F++ T   W            + +  IR       LYF+  I FGSF+ +N+ + ++  ++++ +
Sbjct: 1246 LRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKV----YFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYF-KC-EDMNGTKLSHEIIPNRNACESENYT--------------------------WVNSA------------------MNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQK 1523          

HSP 9 Score: 56.9954 bits (136), Expect = 2.282e-7
Identity = 45/186 (24.19%), Postives = 82/186 (44.09%), Query Frame = 3
Query: 3696 FTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAV 4253
            FT  F  E  +K  A     YF++ W   DFIIV ++L+ L L  +            +R+ R LR  +    W  + ++++ + + + ++ N+  V  +   IF+++GMQLFG  +      D  +R     +P                W     NF + ++ ++ +F+V   + WIE M D +
Sbjct:  836 FTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQ-------GLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNY-----TDHKDRFPDGDLPR---------------W-----NFTDFMHSFMIVFRVLCGE-WIESMWDCM 988          
BLAST of scna-1 vs. Ensembl Fly
Match: para (gene:FBgn0285944 transcript:FBtr0303672)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 410/767 (53.46%), Postives = 547/767 (71.32%), Query Frame = 3
Query: 3426 EIIYSTSPEDCLPN-FISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVN-NDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE---DPKVCNKE-KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQK--PEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTER 5702
            E I    P DC P+ +  K      D   ++P  + W N R K  +L+E+++FET +I MI++SSL L LED +LP RP L+  L  +D++FT+IF  EML+KW A G   YF +AWCWLDF+IV ++L++ V S +G  AGG+ AFK MRTLRALRPLRA+SR +GMR+VVNAL+QAIPSIFNVLLVCL+FWLIF+I+G+QLF GK++KC + N T  ++S EIIPN+NAC        N +W NS +NFD+V N YLCLFQVATFKGWI+IM DA+DS  +  QP    +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GGSLEMFMTEDQKKYYNAMKKM S  P K IPRP+ +   I+F I  ++KFDI IM  I LN   M ++ +D  +     LD +N +F+VIF+ E LLK+ A R++YF  PWN+FD V+VILSI+   +  ++    VSPT +RVVRV ++GR+LRLVK AKGIRTLLF+L +SLPAL NI LLL ++MFI+AI GMSFF +V     I++V+NF+TFG++MI+LFQ+STS GW+GVL+ ++NE   DP   +K   G CGS  + + +L+SYL+ISFL++INMYIAVILEN+SQAT+DVQEGLT DDYD++YE W+++D +   +I    L +F++ ++ PL I KPN  ++  ++IPIC+ D +YCVD+L+ LT+ F  +K  P  +TGE      +PD +  +     VS+TL RQRE + A++I    + +  R
Sbjct: 1219 EDILDEYPADCCPDSYYKKFPILAGDD--DSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVG--AGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGT--KLSHEIIPNRNAC-----ESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEP----VSSTLWRQREEYCARLIQHAWRKHKAR 1970          

HSP 2 Score: 343.199 bits (879), Expect = 8.569e-95
Identity = 190/388 (48.97%), Postives = 260/388 (67.01%), Query Frame = 3
Query:  330 KQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFM--AKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFN-NETNWLD-------PLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            + +D   +P+P LE G  +P  L   FP  +L+  PL ++DP+Y    TFVV++  K IFRFS +KA ++L P NPIR+ AI +L HP+FS  ++TTI++NC+ M        ++ E +FT IYT E  +K ++RG I+  FTYLRDAWNWLDF+VI LAY+      LGNL+ALR+ RVLRALKTV  VPG+KT+VGA++E+VK LRD ++LT+F LS+F L+GLQ+Y G L +KC+K F           + NLTD E W    ++ N N +NW         PL  C N +       C + YVC+Q    NPNYGYT+FD+F  + L AFRLMTQD+WE+LYQL +R  G  H+L+F+++IF GSFYL+N+ILAIVAMSYD+++
Sbjct:   67 EDEDEGPQPDPTLEQGVPIPVRLQGSFP-PELASTPLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID-LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLD------GSWGNLTD-ENW----DYHNRNSSNWYSEDEGISFPL--CGNIS---GAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 436          

HSP 3 Score: 310.457 bits (794), Expect = 1.285e-84
Identity = 184/298 (61.74%), Postives = 221/298 (74.16%), Query Frame = 3
Query: 2301 LKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKL 3191
            +  FC W CC  + KFQ  V+LI+ DPFVELFITLCIV+NT+ M++D  D + EM   LK  NYFFT TF +EA +KL+A+ P+ YFQE WN+FDFIIV LSL+E+ L+   G+S+LR+FRLLRVFKLAKSW T+NLL  I+G T+GA+GNL  VL IIIFIFAV+GMQLFG  Y + K+   FP   G  PRWNF DF HSFMIVFRVLCGEWIESMWDCM V    C+PFFL T+++GNLV+LNLFLALLLS+FGS SL     D N+TNK+ EA +RI R   WVK  I    KL
Sbjct:  771 IDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKDR--FPD--GDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTAD-NDTNKIAEAFNRIGRFKSWVKRNIADCFKL 1063          

HSP 4 Score: 87.0409 bits (214), Expect = 2.015e-16
Identity = 62/223 (27.80%), Postives = 110/223 (49.33%), Query Frame = 3
Query: 2349 QSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS---------SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVP 2990
            Q++V  I+ D   ++ I L I +N   M++D  D S   N  L   N  F   F  E  LK+ AL    YF E WN+FD ++VILS++ + L           + + ++R  ++ RV +L K  + +  L   +  ++ A+ N+C++L +++FIFA+ GM  F     + K ++      G    +NF  F  S +++F++      + + D  ++N   C P
Sbjct: 1575 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL-RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFF----MHVKEKS------GINDVYNFKTFGQSMILLFQMSTSAGWDGVLDA-IINEEACDP 1785          

HSP 5 Score: 76.6406 bits (187), Expect = 2.554e-13
Identity = 57/232 (24.57%), Postives = 108/232 (46.55%), Query Frame = 3
Query: 3645 LPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGY---------LCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHST 4298
            +P+ P     +E  + +FT I+T E  +K  A G       Y +DAW WLDF+++ +A V++ +         +G   A+RT R LR L+ V+   G++ +V A+I+++ ++ +V+++ +    +F+++G+Q++ G    KC+                     +   +GN++ EN   +  N  N Y         LC        G  +   D V   G G  P+Y +++
Sbjct:  172 MPTTP----TVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID--------LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKK-----------------FPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLC----GNISGAGQCDDDYVCLQGFGPNPNYGYTS 370          

HSP 6 Score: 67.3958 bits (163), Expect = 1.748e-10
Identity = 44/155 (28.39%), Postives = 83/155 (53.55%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            I++ P   LFI   I++N +LM + T   +P     ++     FT  +  E+ +K++A G    P  Y ++ WN  DF+++ L+ V + +D   ++ LR FR+LR  K       +  L  I+G  + ++ NL  V+ + +F   +FA++G+Q++
Sbjct:  149 ILVHPLFSLFIITTILVNCILMIMPT---TPT----VESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVA---IVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIY 293          

HSP 7 Score: 67.0106 bits (162), Expect = 1.885e-10
Identity = 58/225 (25.78%), Postives = 107/225 (47.56%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPD--NSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIP---LDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIG---NLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETL---------FPSFKGAEPR---W-----NFNDFTHSFMIVFRVLCGE-WIESMWDCM 2963
            +I + + E  +   I+M+++ ++++       P +   L   +  FT  F LE  +K +ALG + YF   W   DF+IV++SL+      + + G+   +  R LR  +  ++   M  + +++   V AI    N+ +V  I   IFA++G+QLF  KY  FK E +          P+    E     W     NF+   ++++ +F+V   + WI+ M D +
Sbjct: 1263 LIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKY--FKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAI 1485          

HSP 8 Score: 65.855 bits (159), Expect = 4.919e-10
Identity = 69/328 (21.04%), Postives = 136/328 (41.46%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXX-----KTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYW----------ENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            +R    +L+ +  F   V+T I+++ + +A        +    D + Y   +FT I+ LE  IK ++ G  +    Y  +AW WLDF+++ ++ + F   ++G         +         + ++ + GM+ VV AL++A+  + + +++ +    IF ++G+QL+ G    KC +  N T L  E     N  ++E +T                          W  S                    NFD+   + LC F++ T   W            + +  IR       LYF+  I FGSF+ +N+ + ++  ++++ +
Sbjct: 1256 LRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKV----YFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYF-KC-EDMNGTKLSHEIIPNRNACESENYT--------------------------WVNSA------------------MNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQK 1533          

HSP 9 Score: 57.3806 bits (137), Expect = 1.730e-7
Identity = 45/186 (24.19%), Postives = 83/186 (44.62%), Query Frame = 3
Query: 3696 FTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAV 4253
            FT  F  E  +K  A     YF++ W   DFIIV ++L+ L L  +            +R+ R LR  +    W  + ++++ + + + ++ N+  V  +   IF+++GMQLFG  ++     D  +R     +P                W     NF + ++ ++ +F+V   + WIE M D +
Sbjct:  836 FTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQ-------GLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYH-----DHKDRFPDGDLPR---------------W-----NFTDFMHSFMIVFRVLCGE-WIESMWDCM 988          
BLAST of scna-1 vs. Ensembl Fly
Match: para (gene:FBgn0285944 transcript:FBtr0303655)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 410/767 (53.46%), Postives = 547/767 (71.32%), Query Frame = 3
Query: 3426 EIIYSTSPEDCLPN-FISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVN-NDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE---DPKVCNKE-KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQK--PEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTER 5702
            E I    P DC P+ +  K      D   ++P  + W N R K  +L+E+++FET +I MI++SSL L LED +LP RP L+  L  +D++FT+IF  EML+KW A G   YF +AWCWLDF+IV ++L++ V S +G  AGG+ AFK MRTLRALRPLRA+SR +GMR+VVNAL+QAIPSIFNVLLVCL+FWLIF+I+G+QLF GK++KC + N T  ++S EIIPN+NAC        N +W NS +NFD+V N YLCLFQVATFKGWI+IM DA+DS  +  QP    +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GGSLEMFMTEDQKKYYNAMKKM S  P K IPRP+ +   I+F I  ++KFDI IM  I LN   M ++ +D  +     LD +N +F+VIF+ E LLK+ A R++YF  PWN+FD V+VILSI+   +  ++    VSPT +RVVRV ++GR+LRLVK AKGIRTLLF+L +SLPAL NI LLL ++MFI+AI GMSFF +V     I++V+NF+TFG++MI+LFQ+STS GW+GVL+ ++NE   DP   +K   G CGS  + + +L+SYL+ISFL++INMYIAVILEN+SQAT+DVQEGLT DDYD++YE W+++D +   +I    L +F++ ++ PL I KPN  ++  ++IPIC+ D +YCVD+L+ LT+ F  +K  P  +TGE      +PD +  +     VS+TL RQRE + A++I    + +  R
Sbjct: 1230 EDILDEYPADCCPDSYYKKFPILAGDD--DSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVG--AGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGT--KLSHEIIPNRNAC-----ESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEP----VSSTLWRQREEYCARLIQHAWRKHKAR 1981          

HSP 2 Score: 343.199 bits (879), Expect = 7.702e-95
Identity = 190/388 (48.97%), Postives = 260/388 (67.01%), Query Frame = 3
Query:  330 KQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFM--AKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFN-NETNWLD-------PLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            + +D   +P+P LE G  +P  L   FP  +L+  PL ++DP+Y    TFVV++  K IFRFS +KA ++L P NPIR+ AI +L HP+FS  ++TTI++NC+ M        ++ E +FT IYT E  +K ++RG I+  FTYLRDAWNWLDF+VI LAY+      LGNL+ALR+ RVLRALKTV  VPG+KT+VGA++E+VK LRD ++LT+F LS+F L+GLQ+Y G L +KC+K F           + NLTD E W    ++ N N +NW         PL  C N +       C + YVC+Q    NPNYGYT+FD+F  + L AFRLMTQD+WE+LYQL +R  G  H+L+F+++IF GSFYL+N+ILAIVAMSYD+++
Sbjct:   67 EDEDEGPQPDPTLEQGVPIPVRLQGSFP-PELASTPLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID-LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLD------GSWGNLTD-ENW----DYHNRNSSNWYSEDEGISFPL--CGNIS---GAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 436          

HSP 3 Score: 310.457 bits (794), Expect = 1.095e-84
Identity = 184/298 (61.74%), Postives = 221/298 (74.16%), Query Frame = 3
Query: 2301 LKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKL 3191
            +  FC W CC  + KFQ  V+LI+ DPFVELFITLCIV+NT+ M++D  D + EM   LK  NYFFT TF +EA +KL+A+ P+ YFQE WN+FDFIIV LSL+E+ L+   G+S+LR+FRLLRVFKLAKSW T+NLL  I+G T+GA+GNL  VL IIIFIFAV+GMQLFG  Y + K+   FP   G  PRWNF DF HSFMIVFRVLCGEWIESMWDCM V    C+PFFL T+++GNLV+LNLFLALLLS+FGS SL     D N+TNK+ EA +RI R   WVK  I    KL
Sbjct:  792 IDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKDR--FPD--GDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTAD-NDTNKIAEAFNRIGRFKSWVKRNIADCFKL 1084          

HSP 4 Score: 87.0409 bits (214), Expect = 1.855e-16
Identity = 62/223 (27.80%), Postives = 110/223 (49.33%), Query Frame = 3
Query: 2349 QSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS---------SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVP 2990
            Q++V  I+ D   ++ I L I +N   M++D  D S   N  L   N  F   F  E  LK+ AL    YF E WN+FD ++VILS++ + L           + + ++R  ++ RV +L K  + +  L   +  ++ A+ N+C++L +++FIFA+ GM  F     + K ++      G    +NF  F  S +++F++      + + D  ++N   C P
Sbjct: 1586 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL-RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFF----MHVKEKS------GINDVYNFKTFGQSMILLFQMSTSAGWDGVLDA-IINEEACDP 1796          

HSP 5 Score: 77.0258 bits (188), Expect = 2.234e-13
Identity = 57/232 (24.57%), Postives = 108/232 (46.55%), Query Frame = 3
Query: 3645 LPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGY---------LCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHST 4298
            +P+ P     +E  + +FT I+T E  +K  A G       Y +DAW WLDF+++ +A V++ +         +G   A+RT R LR L+ V+   G++ +V A+I+++ ++ +V+++ +    +F+++G+Q++ G    KC+                     +   +GN++ EN   +  N  N Y         LC        G  +   D V   G G  P+Y +++
Sbjct:  172 MPTTP----TVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID--------LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKK-----------------FPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLC----GNISGAGQCDDDYVCLQGFGPNPNYGYTS 370          

HSP 6 Score: 67.3958 bits (163), Expect = 1.542e-10
Identity = 44/155 (28.39%), Postives = 83/155 (53.55%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            I++ P   LFI   I++N +LM + T   +P     ++     FT  +  E+ +K++A G    P  Y ++ WN  DF+++ L+ V + +D   ++ LR FR+LR  K       +  L  I+G  + ++ NL  V+ + +F   +FA++G+Q++
Sbjct:  149 ILVHPLFSLFIITTILVNCILMIMPT---TPT----VESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVA---IVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIY 293          

HSP 7 Score: 67.3958 bits (163), Expect = 1.824e-10
Identity = 58/225 (25.78%), Postives = 107/225 (47.56%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPD--NSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIP---LDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIG---NLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETL---------FPSFKGAEPR---W-----NFNDFTHSFMIVFRVLCGE-WIESMWDCM 2963
            +I + + E  +   I+M+++ ++++       P +   L   +  FT  F LE  +K +ALG + YF   W   DF+IV++SL+      + + G+   +  R LR  +  ++   M  + +++   V AI    N+ +V  I   IFA++G+QLF  KY  FK E +          P+    E     W     NF+   ++++ +F+V   + WI+ M D +
Sbjct: 1274 LIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKY--FKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAI 1496          

HSP 8 Score: 65.855 bits (159), Expect = 4.800e-10
Identity = 69/328 (21.04%), Postives = 136/328 (41.46%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXX-----KTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYW----------ENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            +R    +L+ +  F   V+T I+++ + +A        +    D + Y   +FT I+ LE  IK ++ G  +    Y  +AW WLDF+++ ++ + F   ++G         +         + ++ + GM+ VV AL++A+  + + +++ +    IF ++G+QL+ G    KC +  N T L  E     N  ++E +T                          W  S                    NFD+   + LC F++ T   W            + +  IR       LYF+  I FGSF+ +N+ + ++  ++++ +
Sbjct: 1267 LRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKV----YFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYF-KC-EDMNGTKLSHEIIPNRNACESENYT--------------------------WVNSA------------------MNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQK 1544          

HSP 9 Score: 57.7658 bits (138), Expect = 1.488e-7
Identity = 45/186 (24.19%), Postives = 83/186 (44.62%), Query Frame = 3
Query: 3696 FTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAV 4253
            FT  F  E  +K  A     YF++ W   DFIIV ++L+ L L  +            +R+ R LR  +    W  + ++++ + + + ++ N+  V  +   IF+++GMQLFG  ++     D  +R     +P                W     NF + ++ ++ +F+V   + WIE M D +
Sbjct:  857 FTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQ-------GLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYH-----DHKDRFPDGDLPR---------------W-----NFTDFMHSFMIVFRVLCGE-WIESMWDCM 1009          
BLAST of scna-1 vs. Ensembl Zebrafish
Match: scn12aa (sodium channel, voltage gated, type XII, alpha a [Source:ZFIN;Acc:ZDB-GENE-060908-2])

HSP 1 Score: 1214.13 bits (3140), Expect = 0.000e+0
Identity = 784/1896 (41.35%), Postives = 1121/1896 (59.12%), Query Frame = 3
Query:  237 DAYTEISKPEVIISNENIESDLHSHYTPIKKKQDDVPKEPNPR--LEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQ-TFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNW--LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDXXXXXXXXXXXXXIIDRIDEELGVESSEDLNYQNPVRPNS-KDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSICDYDSTDRNLDSTRLVCPLESYFKGKIK-FNYADKSESEATTPILPRSPRSIA-VGKRIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNL-SFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIY----DAETKVRKK------ELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLK--------------------------ETEVPKFDEDPEIN-----EVEIIYS------TSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNR 5717
            D     ++  +    + I  +   +    K    DV +EP PR  LEVGK LP   G+      L G+PL ++DPFY++ Q TF+V+   K IFRFS T A Y+ SP + IR+ +IR+L H +FS  ++ TI+ NC FMA +     +  +EY FT IYT E  IK ++RG     FT+LRD WNWLDF VI +AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L +KCV+S  H +    P     + + + W    +F  NE N+  ++  +      Y+     CP+G+ C++T + NPNYGYT+FD F  + L  FRLMTQDYWE+LY  T+R+ G  ++++F++VIF GSFYL+N+ILA+VAM+Y++   A  AE    E E +   E   K    + ++   E+   L       P S KD    ++  R    +   + D F               P+F   D +     L +T    PL +    ++  F +  ++ SEA          S+A  G+   GS+++  P    R+         + + +S++F     T     G +   L QN    +  +  +   +   E +      +   +   +  ++ + +  P  +  LS++S +    D   + R+K      E  +++L+     WTC P + + +  + ++++DPF++L IT+CIV+NT+ M+++    + E N  L   N  FT  F  E  LK+ AL P  YFQ+ WN+FD IIV LSL+E+ L +  G+S+LR+FRLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y +   +    S+    PRW+  DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F++ M++GNLV+LNLFLALLLSSF S++L   ++D  E N LQ AI RI+    W+   I       K++F   + + R+K  ++    N  + +C      L      +  +  ++NP L     +                           + EV    E   ++     E E  YS        PE+C P F  +   KC ++      G++WW  R    ++VEH +FETFII MI++SS  L  ED  +  R  +K+ LE  DKVF+ IF  EM LKW A+G  KYF + WCWLDF+IV ++L+SLV + +G      GA K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKF KCVN   F   +A I+ NK  CL M        W   ++NFDNV  GYL L QVATFKGW+EIM  AVDS G+ +QP    +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK+ +GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP   +    F +   Q FDI IM +I+LN I M +E  +Q  +++T L+ IN  FIVIFT E L+K+ A R Y+F + WN+FDFV+VILSIV   +  ++    VSPT  RV+R+ RIGR+LRL+++AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GM+ F+ V     ID++FNFETFG +MI LFQI+TS GWN +L+ ++N  P+ C+          KG CG   + + + +SY+IISFL+++NMYIA+ILENFS AT++  E L++DD+++FYE WE++D +A  FI    L +F + + +PL I KPN ++L  +++P+   D ++C+D+L   T+R LG+  E D  +  + +        K+    ++ TL+R++E  +A +I +  +A+  R +  +
Sbjct:   11 DGLRPFTRESLAAIEQRISEERARNTKDYKADPGDV-EEPKPRADLEVGKVLPRIFGEI--PAGLVGVPLEDIDPFYFRNQKTFIVLNKGKAIFRFSATSALYIFSPFHCIRRISIRILVHSLFSLFIMCTILTNCCFMAMSDPPLWTKYLEYTFTGIYTFESLIKILARGFCTECFTFLRDPWNWLDFSVIVMAYVTEFVD-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGILRQKCVRSIGHCVNSTYPGNGSFVCNNKTWLSVKDFLTNEDNFYKIEGSKDALICGYSSDAGKCPDGFDCLKT-SRNPNYGYTSFDTFGWAFLGLFRLMTQDYWESLYHQTLRSAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIAEAWAKEREFQLAMEHLRKEQRALAKQRRKEAEMALAADFCPSPFSRKDSIKCRTRTRSHRTLSEEIEDSF--------------LPKFEPLD-EKPAHPLLATLSSHPLSTRRGSQMSIFTFRPRNSSEAD---FADDEHSVADYGRSRAGSMAT--PWHKHRTGS-------IRSHSSQVF-----TPTLANGRLNISLEQNGITGIGLHTPTTGPKFSMEKVKEGTEPECQNEQVKLTVDVQEEVLPPRRKRGLSSVSFFSDAMDELEEARQKCPPCWYEFAQKYLI-----WTCSPAWLRVKEGLKVMVMDPFLDLAITICIVLNTLFMALEHYPMTDEFNSMLSIGNLVFTGIFTAEMVLKIFALDPYYYFQQGWNIFDGIIVCLSLMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDCVCKI---SYDCTLPRWHMKDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCILVFMLVMVIGNLVVLNLFLALLLSSFSSDNLSAPDED-GEMNNLQIAIARIHCGFSWLLNGI-------KDLFSGNLTRHRRKSKEAQVTLN--HTECNGGLGSLEKYVFPETEDSYMTNPNLTICVPIAPGESDVEFLEEEEEEEDTESSEDEEEKQEVISLSEGSTVDLRKPGEDEEEYSEMADDGMDPEECFPEFCMQRC-KCCNINTTQGLGQMWWRLRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIEQRKVVKVVLEYADKVFSYIFVLEMFLKWIAYGFKKYFTNYWCWLDFLIVDVSLISLVANSLGYS--DFGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGKCVNRTGFIH-NASIVNNKTECLSMNDT--QFYWTKVKVNFDNVGLGYLSLLQVATFKGWMEIMYAAVDSRGVEDQPIKEINLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKRMIGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPMNILQGFFFDLVSKQAFDITIMMLIILNMITMMVETDEQSARMETILNNINLAFIVIFTTECLIKIFALRCYFFTISWNIFDFVVVILSIVGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMANFAYVKKQGGIDDMFNFETFGNSMICLFQITTSAGWNNLLDPILNNSPEECSSSFANTGTNTKGNCGHPSVGITFFVSYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFEMFYEVWEKFDVEATHFIEYAKLSNFADSLSEPLRIAKPNKIKLIHMDLPMVNGDRIHCLDILFAFTKRVLGETGEMDALKQQMEEKFMVTNPSKISHEPITTTLRRKQEEISATLIQRAYRAHLIRRQMKQ 1844          
BLAST of scna-1 vs. Ensembl Zebrafish
Match: scn4ab (sodium channel, voltage-gated, type IV, alpha, b [Source:NCBI gene;Acc:564977])

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 552/1197 (46.12%), Postives = 764/1197 (63.83%), Query Frame = 3
Query: 2178 NMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKV----QIRFAIKL-----SKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYS---TSPEDCLPNFISKLLRKC--YDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE----DPKVCN---KEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY 5693
            N +   +  I+ P + SA+   S  DA+  + ++     W      F  W CC  + KF+ +V L ++DPFV+L ITLCIV+NTV M+++    S  +   L   N  FT  F  E  LKLIAL P  YFQ  WN+FD IIV +SLVE+ L D  G+S+LR+FRL+RVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y++   +    S     PRW+  DF H+F+I+FRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF  ++L   +DD    N LQ AI RI R I W+K      +R  + L       ++ G    K    +  S  M        E    + + S++ +  +++  +  +  K   + +     D+ PE+ ++        TSPEDC   +    +R+C   D+      G+ WWN R     +VEH +FETFII MI++SS  L  ED  +  R  +K+ LE  D+VFT +F  EMLLKW A+G   YF +AWCWLDF+IV ++L+SL  + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSIFNVLLVCL+FWLIFSI+G+ LF GKFY C N  + E     ++ NK  C  +   +  V W N ++NFDNV  GYL L QVATFKGW++IM  AVDS  + +QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK ++GG+ ++FMTE+QKKYYNAMKK+ S  PQKPIPRP      ++F     Q FDIFIM +I LN + M +E  DQ  +++  L  IN  FI++FTGE +LK+ A R++YF + WN+FDFV+VILSI+   +  ++    VSPT  RV+R+ RIGR+LRL++ AKGIRTLLF+L++SLPAL NI LLL +IMFI++I GMS F+ V     ID++ NFETFG ++I +F I+TS GW+G+L  ++N     DP V N     +G CG+  + +V+  SY+++SFLV++NMYIA+ILENF+ AT++  + L +DD+++FYE WE++D  A  FI    L +F + +  PL IPKPN+++L  ++IP+   D ++C+DLL  LT   LG   + D  +  + +        K     +++TLKR++E  AA  I +  +++
Sbjct:  554 NYLEVPDSQIRKPSVVSAVE--SALDAQEDI-ERPCPPGWYKFADIFLKWDCCIPWVKFKRIVYLFVMDPFVDLGITLCIVLNTVFMAMEHYPMSVHVEEVLAIGNLVFTGIFAAEMVLKLIALDPYYYFQVGWNIFDSIIVTMSLVELMLADVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYTDSVCKI---SSDCELPRWHMADFFHAFLIIFRVLCGEWIETMWDCMEVAGQGMCIIVFMMVMVIGNLVVLNLFLALLLSSFSGDNLSASDDDGE--NNLQIAISRITRGIDWIKAFVNKHVRQCLNLKPKEEGAKVNGEGDAKMNAIMNSSSSMVKVPIANGESDDDDGNGSSEDE--DDEGRDINMKKKNGDESSTCSTVDKPPEVEDLVEEEEEDLTSPEDC---YTENCIRRCPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYYCFNETSEEVFDHNVVNNKTDCYELMEFHPEVRWMNGKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKAKLGGT-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPTNCCQGLVFDFVTQQFFDIFIMVMICLNMVTMMVETDDQSAEIEEILFYINFAFIILFTGECVLKITALRYHYFSIGWNIFDFVVVILSILGIGLADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEVGIDDMMNFETFGNSIICMFMITTSAGWDGLLAPILNSPPDCDPDVDNPGSTTRGNCGNAAVGIVFFCSYIVMSFLVVVNMYIAIILENFNVATEESSDPLCEDDFEMFYETWEKFDPTASQFIDYNRLSEFCDTLKDPLRIPKPNTLKLITMDIPMVTGDKIHCLDLLLALTGEVLGGSDQMDGMKATMEEKFMANNPSKASYEPITSTLKRKQEEVAASTIQRAYRSH 1734          

HSP 2 Score: 344.354 bits (882), Expect = 3.165e-95
Identity = 199/399 (49.87%), Postives = 267/399 (66.92%), Query Frame = 3
Query:  321 IKKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCV-------KSFNHTLLYFEPNEFENLTD-----AEKWTVKYE-FFNNETNW------LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSY 1451
            +K  ++D+PK P   LE GK LP   GD  P   L  +P+ ELDP+Y  ++TF+VI    TI+RF+T  A Y LSP NP+R+ AIR+L H +FS +++ TI+ NCVFMA +     S  +EYVFT IYT E  +K +SRG  I +FT+LRD WNWLDF+VI +AYL  F   LGN+SALR+ RVLRALKT+T +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L +KCV        S N T+L        N TD         T  Y+ + N+E N+      +DPL  C N +       CPEGY+C++    NPNYGYT++DNF  + L  FRLMTQD+WENL+QLT+R  G  ++++F+++IF GSFYLIN+ILA+VAM+Y
Sbjct:   95 VKVAEEDLPK-PTSDLEAGKVLPFIYGD--PPPNLLNVPIEELDPYYKAQKTFIVIDKKNTIYRFNTEPACYCLSPFNPVRRAAIRILIHSLFSLVIMLTILTNCVFMAMSDPPGWSKILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD-LGNISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVLWPPVGWYSDNLTVL-------SNYTDINGNGTANSTFDYQKYINSEENYYYVPGQMDPL-VCGNSSDAGL---CPEGYICLKAGR-NPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAY 477          

HSP 3 Score: 78.1814 bits (191), Expect = 9.907e-14
Identity = 43/132 (32.58%), Postives = 78/132 (59.09%), Query Frame = 3
Query: 3678 EILDKVFTIIFTAEMLLK----WFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV 4058
            +IL+ VFT I+T E ++K     F  G   + +D W WLDF+++++A ++  +         +G   A+RT R LR L+ ++   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV
Sbjct:  209 KILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD--------LGNISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCV 332          

HSP 4 Score: 62.003 bits (149), Expect = 8.614e-9
Identity = 73/322 (22.67%), Postives = 142/322 (44.10%), Query Frame = 3
Query:  561 RKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTL-LYFEPNEFENLTDAEKWTVKYEF--FNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRT---------NGDIHI-LYFMMVIFFGSFYLINVILAIV 1439
            RKT   ++ H  F   ++  I+++   +A        +      +EY   VFT ++ +E  +K ++ G  +    Y  +AW WLDF+++ ++ +     +  +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    K    FN T    F+ N   N TD       YE   F+ E  W++                                 G  NFDN  +  L   ++ T   W ++    + +           ++++ +YF++ I FGSF+ +N+ + ++
Sbjct: 1014 RKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKV----YFTNAWCWLDFLIVDVSLISLTANILGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAG----KFYYCFNETSEEVFDHNVVNNKTDC------YELMEFHPEVRWMN---------------------------------GKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVI 1288          

HSP 5 Score: 61.6178 bits (148), Expect = 1.196e-8
Identity = 66/294 (22.45%), Postives = 128/294 (43.54%), Query Frame = 3
Query: 2031 TEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFCSWTC---CPC------------YFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTP--DNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIP---LDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIG---NLCIVLGIIIFIFAVVGMQLFGDKYSNFKNET 2843
             +++G+G+ K     N     S +   +  + N   + D     ++D+D+   +IN   KN +  S  S +        + ++E       +   +  C   CPC            ++ F+     I+   + E FI   I++++  ++ +    +    +   L+ A+  FT  F +E  LK +A G + YF   W   DF+IV +SL+ +    L  S +  +++ R LR  +  ++      + +++   VGAI    N+ +V  I   IF+++G+ LF  K+    NET
Sbjct:  898 AKVNGEGDAKMNAIMN-----SSSSMVKVPIANGESDDDDGNGSSEDEDDEGRDINMKKKNGDESSTCSTVDKPPEVEDLVEEEEEDLTSPEDCYTENCIRRCPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYYCFNET 1186          

HSP 6 Score: 61.2326 bits (147), Expect = 1.777e-8
Identity = 69/311 (22.19%), Postives = 140/311 (45.02%), Query Frame = 3
Query: 1947 LDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLS----QNLRRRVSKNLSFRHRMENESINSDIFIKINQDD------DNMISEINQYIKNPELQSALSA-LSIYDAETKVRKKELI--KQWLLKTFCSWTCCPCYFKFQSL---VALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            L  R      DP ++     +   M R+    G  ++ R L+      + RR+++  + + RM+ +++      K+ ++D      D    ++  +I      + L+  +   D   K +K  ++  K+  +  F +   C C   F  +      I++     L I L I+ N V M++  P   P  +  L+   Y FT  +  EA +K+++    +G   + ++ WN  DF+++ ++ +   +D   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF
Sbjct:   29 LSPRQLAQLRDPEVVAALVQQNVKMARLLPPTGT-DVFRPLTLESLAEIDRRMAEEAAEQERMKEQNV------KVAEEDLPKPTSDLEAGKVLPFIYGDPPPNLLNVPIEELDPYYKAQKTFIVIDKKNTIYRFNTEPACYCLSPFNPVRRAAIRILIHSLFSLVIMLTILTNCVFMAMSDP---PGWSKILE---YVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLGNISALRTFRVLRAL---KTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLF 323          
BLAST of scna-1 vs. Ensembl Zebrafish
Match: scn4ab (sodium channel, voltage-gated, type IV, alpha, b [Source:NCBI gene;Acc:564977])

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 552/1197 (46.12%), Postives = 764/1197 (63.83%), Query Frame = 3
Query: 2178 NMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKV----QIRFAIKL-----SKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYS---TSPEDCLPNFISKLLRKC--YDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE----DPKVCN---KEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY 5693
            N +   +  I+ P + SA+   S  DA+  + ++     W      F  W CC  + KF+ +V L ++DPFV+L ITLCIV+NTV M+++    S  +   L   N  FT  F  E  LKLIAL P  YFQ  WN+FD IIV +SLVE+ L D  G+S+LR+FRL+RVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y++   +    S     PRW+  DF H+F+I+FRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF  ++L   +DD    N LQ AI RI R I W+K      +R  + L       ++ G    K    +  S  M        E    + + S++ +  +++  +  +  K   + +     D+ PE+ ++        TSPEDC   +    +R+C   D+      G+ WWN R     +VEH +FETFII MI++SS  L  ED  +  R  +K+ LE  D+VFT +F  EMLLKW A+G   YF +AWCWLDF+IV ++L+SL  + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSIFNVLLVCL+FWLIFSI+G+ LF GKFY C N  + E     ++ NK  C  +   +  V W N ++NFDNV  GYL L QVATFKGW++IM  AVDS  + +QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK ++GG+ ++FMTE+QKKYYNAMKK+ S  PQKPIPRP      ++F     Q FDIFIM +I LN + M +E  DQ  +++  L  IN  FI++FTGE +LK+ A R++YF + WN+FDFV+VILSI+   +  ++    VSPT  RV+R+ RIGR+LRL++ AKGIRTLLF+L++SLPAL NI LLL +IMFI++I GMS F+ V     ID++ NFETFG ++I +F I+TS GW+G+L  ++N     DP V N     +G CG+  + +V+  SY+++SFLV++NMYIA+ILENF+ AT++  + L +DD+++FYE WE++D  A  FI    L +F + +  PL IPKPN+++L  ++IP+   D ++C+DLL  LT   LG   + D  +  + +        K     +++TLKR++E  AA  I +  +++
Sbjct:  502 NYLEVPDSQIRKPSVVSAVE--SALDAQEDI-ERPCPPGWYKFADIFLKWDCCIPWVKFKRIVYLFVMDPFVDLGITLCIVLNTVFMAMEHYPMSVHVEEVLAIGNLVFTGIFAAEMVLKLIALDPYYYFQVGWNIFDSIIVTMSLVELMLADVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYTDSVCKI---SSDCELPRWHMADFFHAFLIIFRVLCGEWIETMWDCMEVAGQGMCIIVFMMVMVIGNLVVLNLFLALLLSSFSGDNLSASDDDGE--NNLQIAISRITRGIDWIKAFVNKHVRQCLNLKPKEEGAKVNGEGDAKMNAIMNSSSSMVKVPIANGESDDDDGNGSSEDE--DDEGRDINMKKKNGDESSTCSTVDKPPEVEDLVEEEEEDLTSPEDC---YTENCIRRCPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYYCFNETSEEVFDHNVVNNKTDCYELMEFHPEVRWMNGKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKAKLGGT-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPTNCCQGLVFDFVTQQFFDIFIMVMICLNMVTMMVETDDQSAEIEEILFYINFAFIILFTGECVLKITALRYHYFSIGWNIFDFVVVILSILGIGLADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEVGIDDMMNFETFGNSIICMFMITTSAGWDGLLAPILNSPPDCDPDVDNPGSTTRGNCGNAAVGIVFFCSYIVMSFLVVVNMYIAIILENFNVATEESSDPLCEDDFEMFYETWEKFDPTASQFIDYNRLSEFCDTLKDPLRIPKPNTLKLITMDIPMVTGDKIHCLDLLLALTGEVLGGSDQMDGMKATMEEKFMANNPSKASYEPITSTLKRKQEEVAASTIQRAYRSH 1682          

HSP 2 Score: 343.584 bits (880), Expect = 3.949e-95
Identity = 199/399 (49.87%), Postives = 267/399 (66.92%), Query Frame = 3
Query:  321 IKKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCV-------KSFNHTLLYFEPNEFENLTD-----AEKWTVKYE-FFNNETNW------LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSY 1451
            +K  ++D+PK P   LE GK LP   GD  P   L  +P+ ELDP+Y  ++TF+VI    TI+RF+T  A Y LSP NP+R+ AIR+L H +FS +++ TI+ NCVFMA +     S  +EYVFT IYT E  +K +SRG  I +FT+LRD WNWLDF+VI +AYL  F   LGN+SALR+ RVLRALKT+T +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L +KCV        S N T+L        N TD         T  Y+ + N+E N+      +DPL  C N +       CPEGY+C++    NPNYGYT++DNF  + L  FRLMTQD+WENL+QLT+R  G  ++++F+++IF GSFYLIN+ILA+VAM+Y
Sbjct:   43 VKVAEEDLPK-PTSDLEAGKVLPFIYGD--PPPNLLNVPIEELDPYYKAQKTFIVIDKKNTIYRFNTEPACYCLSPFNPVRRAAIRILIHSLFSLVIMLTILTNCVFMAMSDPPGWSKILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD-LGNISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVLWPPVGWYSDNLTVL-------SNYTDINGNGTANSTFDYQKYINSEENYYYVPGQMDPL-VCGNSSDAGL---CPEGYICLKAGR-NPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAY 425          

HSP 3 Score: 78.1814 bits (191), Expect = 1.155e-13
Identity = 43/132 (32.58%), Postives = 78/132 (59.09%), Query Frame = 3
Query: 3678 EILDKVFTIIFTAEMLLK----WFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV 4058
            +IL+ VFT I+T E ++K     F  G   + +D W WLDF+++++A ++  +         +G   A+RT R LR L+ ++   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV
Sbjct:  157 KILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD--------LGNISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCV 280          

HSP 4 Score: 61.6178 bits (148), Expect = 1.094e-8
Identity = 73/322 (22.67%), Postives = 142/322 (44.10%), Query Frame = 3
Query:  561 RKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTL-LYFEPNEFENLTDAEKWTVKYEF--FNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRT---------NGDIHI-LYFMMVIFFGSFYLINVILAIV 1439
            RKT   ++ H  F   ++  I+++   +A        +      +EY   VFT ++ +E  +K ++ G  +    Y  +AW WLDF+++ ++ +     +  +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    K    FN T    F+ N   N TD       YE   F+ E  W++                                 G  NFDN  +  L   ++ T   W ++    + +           ++++ +YF++ I FGSF+ +N+ + ++
Sbjct:  962 RKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKV----YFTNAWCWLDFLIVDVSLISLTANILGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAG----KFYYCFNETSEEVFDHNVVNNKTDC------YELMEFHPEVRWMN---------------------------------GKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVI 1236          

HSP 5 Score: 61.2326 bits (147), Expect = 1.599e-8
Identity = 66/294 (22.45%), Postives = 128/294 (43.54%), Query Frame = 3
Query: 2031 TEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFCSWTC---CPC------------YFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTP--DNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIP---LDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIG---NLCIVLGIIIFIFAVVGMQLFGDKYSNFKNET 2843
             +++G+G+ K     N     S +   +  + N   + D     ++D+D+   +IN   KN +  S  S +        + ++E       +   +  C   CPC            ++ F+     I+   + E FI   I++++  ++ +    +    +   L+ A+  FT  F +E  LK +A G + YF   W   DF+IV +SL+ +    L  S +  +++ R LR  +  ++      + +++   VGAI    N+ +V  I   IF+++G+ LF  K+    NET
Sbjct:  846 AKVNGEGDAKMNAIMN-----SSSSMVKVPIANGESDDDDGNGSSEDEDDEGRDINMKKKNGDESSTCSTVDKPPEVEDLVEEEEEDLTSPEDCYTENCIRRCPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYYCFNET 1134          

HSP 6 Score: 60.4622 bits (145), Expect = 2.605e-8
Identity = 43/155 (27.74%), Postives = 81/155 (52.26%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            I++     L I L I+ N V M++  P   P  +  L+   Y FT  +  EA +K+++    +G   + ++ WN  DF+++ ++ +   +D   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF
Sbjct:  126 ILIHSLFSLVIMLTILTNCVFMAMSDP---PGWSKILE---YVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLGNISALRTFRVLRAL---KTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLF 271          
BLAST of scna-1 vs. Ensembl Zebrafish
Match: scn4ab (sodium channel, voltage-gated, type IV, alpha, b [Source:NCBI gene;Acc:564977])

HSP 1 Score: 903.664 bits (2334), Expect = 0.000e+0
Identity = 551/1197 (46.03%), Postives = 763/1197 (63.74%), Query Frame = 3
Query: 2178 NMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKV----QIRFAIKL-----SKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYS---TSPEDCLPNFISKLLRKC--YDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE----DPKVCN---KEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY 5693
            N +   +  I+ P + SA+   S  DA+  + ++     W      F  W CC  + KF+ +V L ++DPFV+L ITLCIV+NTV M+++    S  +   L   N  FT  F  E  LKLIAL P  YFQ  WN+FD IIV +SLVE+ L D  G+S+LR+FRL+RVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y++   +    S     PRW+  DF H+F+I+FRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF  ++L   +DD    N LQ AI RI R I W+K      +R  + L       ++ G    K    +  S  M        E    + + S++ +  +++  +  +  K   + +     D+ PE+ ++        TSPEDC   +    +R+C   D+      G+ WWN R     +VEH +FETFII MI++SS  L  ED  +  R  +K+ LE  D+VFT +F  EMLLKW A+G   YF +AWCWLDF+IV ++L+SL  + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSIFNVLLVCL+FWLIFSI+G+ LF GKFY C N  + E     ++ NK  C  +   +  V W N ++NFDNV  GYL L QVATFKGW++IM  AVDS  + +QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK ++ G+ ++FMTE+QKKYYNAMKK+ S  PQKPIPRP      ++F     Q FDIFIM +I LN + M +E  DQ  +++  L  IN  FI++FTGE +LK+ A R++YF + WN+FDFV+VILSI+   +  ++    VSPT  RV+R+ RIGR+LRL++ AKGIRTLLF+L++SLPAL NI LLL +IMFI++I GMS F+ V     ID++ NFETFG ++I +F I+TS GW+G+L  ++N     DP V N     +G CG+  + +V+  SY+++SFLV++NMYIA+ILENF+ AT++  + L +DD+++FYE WE++D  A  FI    L +F + +  PL IPKPN+++L  ++IP+   D ++C+DLL  LT   LG   + D  +  + +        K     +++TLKR++E  AA  I +  +++
Sbjct:  503 NYLEVPDSQIRKPSVVSAVE--SALDAQEDI-ERPCPPGWYKFADIFLKWDCCIPWVKFKRIVYLFVMDPFVDLGITLCIVLNTVFMAMEHYPMSVHVEEVLAIGNLVFTGIFAAEMVLKLIALDPYYYFQVGWNIFDSIIVTMSLVELMLADVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYTDSVCKI---SSDCELPRWHMADFFHAFLIIFRVLCGEWIETMWDCMEVAGQGMCIIVFMMVMVIGNLVVLNLFLALLLSSFSGDNLSASDDDGE--NNLQIAISRITRGIDWIKAFVNKHVRQCLNLKPKEEGAKVNGEGDAKMNAIMNSSSSMVKVPIANGESDDDDGNGSSEDE--DDEGRDINMKKKNGDESSTCSTVDKPPEVEDLVEEEEEDLTSPEDC---YTENCIRRCPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYYCFNETSEEVFDHNVVNNKTDCYELMEFHPEVRWMNGKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKAKIRGT-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPTNCCQGLVFDFVTQQFFDIFIMVMICLNMVTMMVETDDQSAEIEEILFYINFAFIILFTGECVLKITALRYHYFSIGWNIFDFVVVILSILGIGLADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEVGIDDMMNFETFGNSIICMFMITTSAGWDGLLAPILNSPPDCDPDVDNPGSTTRGNCGNAAVGIVFFCSYIVMSFLVVVNMYIAIILENFNVATEESSDPLCEDDFEMFYETWEKFDPTASQFIDYNRLSEFCDTLKDPLRIPKPNTLKLITMDIPMVTGDKIHCLDLLLALTGEVLGGSDQMDGMKATMEEKFMANNPSKASYEPITSTLKRKQEEVAASTIQRAYRSH 1683          

HSP 2 Score: 334.339 bits (856), Expect = 3.133e-92
Identity = 198/401 (49.38%), Postives = 266/401 (66.33%), Query Frame = 3
Query:  321 IKKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTH--PVFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCV-------KSFNHTLLYFEPNEFENLTD-----AEKWTVKYE-FFNNETNW------LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSY 1451
            +K  ++D+PK P   LE GK LP   GD  P   L  +P+ ELDP+Y  ++TF+VI    TI+RF+T  A Y LSP NP+R+ AIR+L H  P+   +++ TI+ NCVFMA +     S  +EYVFT IYT E  +K +SRG  I +FT+LRD WNWLDF+VI +AYL  F   LGN+SALR+ RVLRALKT+T +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L +KCV        S N T+L        N TD         T  Y+ + N+E N+      +DPL  C N +       CPEGY+C++    NPNYGYT++DNF  + L  FRLMTQD+WENL+QLT+R  G  ++++F+++IF GSFYLIN+ILA+VAM+Y
Sbjct:   43 VKVAEEDLPK-PTSDLEAGKVLPFIYGD--PPPNLLNVPIEELDPYYKAQKTFIVIDKKNTIYRFNTEPACYCLSPFNPVRRAAIRILIHSYPI-HLVIMLTILTNCVFMAMSDPPGWSKILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD-LGNISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVLWPPVGWYSDNLTVL-------SNYTDINGNGTANSTFDYQKYINSEENYYYVPGQMDPL-VCGNSSDAGL---CPEGYICLKAGR-NPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAY 426          

HSP 3 Score: 78.1814 bits (191), Expect = 1.071e-13
Identity = 43/132 (32.58%), Postives = 78/132 (59.09%), Query Frame = 3
Query: 3678 EILDKVFTIIFTAEMLLK----WFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV 4058
            +IL+ VFT I+T E ++K     F  G   + +D W WLDF+++++A ++  +         +G   A+RT R LR L+ ++   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV
Sbjct:  158 KILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD--------LGNISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCV 281          

HSP 4 Score: 63.5438 bits (153), Expect = 3.340e-9
Identity = 74/337 (21.96%), Postives = 149/337 (44.21%), Query Frame = 3
Query:  561 RKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTL-LYFEPNEFENLTDAEKWTVKYEF--FNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRT---------NGDIHI-LYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            RKT   ++ H  F   ++  I+++   +A        +      +EY   VFT ++ +E  +K ++ G  +    Y  +AW WLDF+++ ++ +     +  +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    K    FN T    F+ N   N TD       YE   F+ E  W++                                 G  NFDN  +  L   ++ T   W ++    + +           ++++ +YF++ I FGSF+ +N+ + ++  +++  +  I+  +
Sbjct:  963 RKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKV----YFTNAWCWLDFLIVDVSLISLTANILGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAG----KFYYCFNETSEEVFDHNVVNNKTDC------YELMEFHPEVRWMN---------------------------------GKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKAKIRGTD 1252          

HSP 5 Score: 61.6178 bits (148), Expect = 1.351e-8
Identity = 65/294 (22.11%), Postives = 127/294 (43.20%), Query Frame = 3
Query: 2031 TEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFCSWTC---CPC------------YFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTP--DNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIP---LDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIG---NLCIVLGIIIFIFAVVGMQLFGDKYSNFKNET 2843
             +++G+G+ K     N    + K        +++  N       ++D+D+   +IN   KN +  S  S +        + ++E       +   +  C   CPC            ++ F+     I+   + E FI   I++++  ++ +    +    +   L+ A+  FT  F +E  LK +A G + YF   W   DF+IV +SL+ +    L  S +  +++ R LR  +  ++      + +++   VGAI    N+ +V  I   IF+++G+ LF  K+    NET
Sbjct:  847 AKVNGEGDAKMNAIMNSSSSMVKVPIANGESDDDDGNGS-----SEDEDDEGRDINMKKKNGDESSTCSTVDKPPEVEDLVEEEEEDLTSPEDCYTENCIRRCPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYYCFNET 1135          

HSP 6 Score: 60.8474 bits (146), Expect = 2.220e-8
Identity = 47/178 (26.40%), Postives = 90/178 (50.56%), Query Frame = 3
Query: 2310 FCSWTCCPCYFKF----QSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            F +   C C   F    ++ + ++I    + L I L I+ N V M++  P   P  +  L+   Y FT  +  EA +K+++    +G   + ++ WN  DF+++ ++ +   +D   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF
Sbjct:  104 FNTEPACYCLSPFNPVRRAAIRILIHSYPIHLVIMLTILTNCVFMAMSDP---PGWSKILE---YVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLGNISALRTFRVLRAL---KTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLF 272          
BLAST of scna-1 vs. Ensembl Zebrafish
Match: scn8ab (sodium channel, voltage gated, type VIII, alpha subunit b [Source:ZFIN;Acc:ZDB-GENE-060906-2])

HSP 1 Score: 900.582 bits (2326), Expect = 0.000e+0
Identity = 566/1214 (46.62%), Postives = 758/1214 (62.44%), Query Frame = 3
Query: 2307 TFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVK--VQIRFAIKLSKEIFGR------CIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVK----------IPEEQLS---NPELWFKYSLKETE-------VPKFDEDPEINEVEIIYSTS---------------------------PEDCLPNFISKLLR-KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACL-IMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKV-CNKE------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY-------TERLKQNRKL*N 5729
            TF  W CCP + K + +V LI++DPFV+L IT+CIV+NTV M+++    +P     L   N  FT  F  E F KLIA+ P  YFQE WN+FD  IV LSLVE+ L D  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K+     +     PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF +++L   +DD  E N LQ ++ RI + I W K  V++  A  L K+           +  K+  L+ +H       IKC    Y  + +              I EE +S   NP L  +  +   E          F  + ++   + +  TS                           PE C  +  + + R KC DV      G+ WW  R     +VEH +FET II MI++SS  L  ED  +  R  +++ LE  D+VFT IF  EMLLKW A+G  KYF +AWCWLDF IV +++VSL+ + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GK+Y C N    E    +++ NK  C  ++ A Y  V W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS  + +QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  KI  ++F     Q FDI IM +I LN + M +E  DQ ++ +  L  IN VFIV FTGEF+LKL A R YYF   WN+FD V+VILSIV   +  ++    VSPT  RV+R+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFI++I GMS F+ V     ID+++NFETFG +MI LF I+TS GW+G+L  ++N  P    NKE      KG CG+  + + + + Y+I+SFL+++NMYIA+ILENFS AT++  + L +DD++ FYE WE++D  A  FI+   L DF + ++ PL +PKPN ++L  +++P+   D ++C+D+L   T+R LG   + D     + +        KV    ++ TL+R++E  +A VI +  +++        +R   N KL N
Sbjct:  702 TFLIWECCPIWIKIKEIVNLIVMDPFVDLAITICIVLNTVFMAMEHYPMTPRFEEVLSVGNLVFTGIFTAEMFAKLIAMDPYYYFQEGWNIFDGFIVSLSLVELGLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KDCVCKIAESCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLIVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDG-EMNNLQISVIRIKKGIAWFKIHVRLLVAHVLKKKPLEDEDKPLDDMYDKKLNLMGNH---TGVEIKCGDLNYPKNGNGTTSGIGSSVGKYMIDEEPMSFIHNPNLTVRVPIAVGESDFENLNTEDFSSESDVENSKDLDDTSSSEGSTIDIKPDEEEMAVVEVVEEYLDPEACWTD--ACVARYKCCDVPITEGWGKYWWFLRKTCYLIVEHNWFETLIIFMILLSSGALAFEDVYIEQRKTIQIILEYADRVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFFIVDVSIVSLIANALGYS--DLGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYYCFNQTAEEYFQVDVVNNKTECFALINANYTEVRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKVEDQPLYEDNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGMVFDFVTQQAFDISIMMLICLNMVTMMVETDDQSDETENILYWINFVFIVAFTGEFVLKLFALRHYYFTNGWNVFDCVVVILSIVGMFLADLIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKREIGIDDMYNFETFGNSMICLFMITTSAGWDGLLAPILNYPPDCDPNKENPGTTVKGNCGNPSVGIFFFVMYIIVSFLIVVNMYIAIILENFSVATEESADPLCEDDFESFYEIWEKFDPDASQFITFAKLPDFADTLEHPLRVPKPNIIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGDLDMMRQQMEERFVAANPSKVSYEPITTTLRRKQEEVSAIVIQRSYRSHLASRGFICKRRPANNKLEN 1903          

HSP 2 Score: 326.25 bits (835), Expect = 1.800e-89
Identity = 189/382 (49.48%), Postives = 256/382 (67.02%), Query Frame = 3
Query:  366 LEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK-SFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNW------LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            LE GK +P   GD  P   L+ +PL +LDPFY  K+TF+V+   KTIFRFS T + Y++SP N  R+ AI++L H  FS +++ TI+ NCVFM  ++    S  VEY FT IYT E   K ++RG  I++FT+LRD WNWLDF+VI +AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L +KCV    N T  Y        L +  K     E+  N+TN+      LD L  C N + +     CPEGY C++    NPNYGYT+FD+F  + L  FRLMTQD+WENLYQLT+R  G  ++++F++VIF GSFYL+N+ILA+VAM+Y++   A   E
Sbjct:   61 LEAGKGVPFIYGD-VPSNMLA-VPLEDLDPFYLNKKTFIVLNKGKTIFRFSATPSLYIISPFNLFRQIAIKILIHSFFSMIIMCTILTNCVFMTFSNPPEWSKQVEYTFTGIYTFESLTKIVARGFCIDDFTFLRDPWNWLDFMVISMAYVTEFVD-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRQKCVIWPVNSTETY--------LANGSKGFDFNEYIMNDTNFYFLPGMLDALL-CGNSSDS---GRCPEGYTCMKAGR-NPNYGYTSFDSFGWAFLALFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATIEE 426          

HSP 3 Score: 78.5666 bits (192), Expect = 8.632e-14
Identity = 74/321 (23.05%), Postives = 134/321 (41.74%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV-----NNDTFERISA------EIIPNKNACLIMKAMYGNVSWENSQ----------------------LNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVI-----------IDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPI 4499
            ++  FT I+T E L K  A G       + +D W WLDF+++++A V+  +         +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV     + +T+    +      E I N      +  M   +   NS                        +FD+    +L LF++ T   W  +    + + G            Y  +FV  I  G+F+ +NL + V+           I+    ++      LE    + ++   NAM   + T  +  +
Sbjct:  163 VEYTFTGIYTFESLTKIVARGFCIDDFTFLRDPWNWLDFMVISMAYVTEFVD--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRQKCVIWPVNSTETYLANGSKGFDFNEYIMNDTNFYFLPGMLDALLCGNSSDSGRCPEGYTCMKAGRNPNYGYTSFDSFGWAFLALFRLMTQDFWENLYQLTLRAAG----------KTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATIEEAEQKEAEFKAMLEQLKKQQEEAQANAMATSAGTVSEDAV 465          

HSP 4 Score: 63.1586 bits (152), Expect = 4.514e-9
Identity = 45/162 (27.78%), Postives = 81/162 (50.00%), Query Frame = 3
Query: 2346 FQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            F+ +   I++  F  + I   I+ N V M+   P   PE +   K   Y FT  +  E+  K++A G       + ++ WN  DF+++ ++ V   +D   +S LR FR+LR  K   +   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF
Sbjct:  123 FRQIAIKILIHSFFSMIIMCTILTNCVFMTFSNP---PEWS---KQVEYTFTGIYTFESLTKIVARGFCIDDFTFLRDPWNWLDFMVISMAYVTEFVDLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLF 275          

HSP 5 Score: 62.3882 bits (150), Expect = 6.373e-9
Identity = 75/320 (23.44%), Postives = 142/320 (44.38%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTN---------GDIHI-LYFMMVIFFGSFYLINVILAIV 1439
            +RKT   ++ H  F  L++  I+++   +A        + +    +EY   VFT I+ LE  +K ++ G +     Y  +AW WLDF ++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    K    FN T              AE++  + +  NN+T     +    NYT   W                       NFDN     L   ++ T   W ++    + +           +I++ +YF++ I FGSF+ +N+ + ++
Sbjct: 1162 LRKTCYLIVEHNWFETLIIFMILLSSGALAFEDVYIEQRKTIQIILEYADRVFTYIFILEMLLKWVAYGFV----KYFTNAWCWLDFFIVDVSIVSLIANALGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG----KYYYCFNQT--------------AEEY-FQVDVVNNKTECFALINA--NYTEVRWKNV------------------KINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKVEDQPLYEDNIYMYIYFVIFIIFGSFFTLNLFIGVI 1438          
BLAST of scna-1 vs. Ensembl Xenopus
Match: srl (sarcalumenin [Source:Xenbase;Acc:XB-GENE-981745])

HSP 1 Score: 1204.12 bits (3114), Expect = 0.000e+0
Identity = 820/1923 (42.64%), Postives = 1121/1923 (58.29%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPV-FSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK-SFNHTLLYFEPNEFENLTDAEKWTVKYE-FFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD-----VRLAIQAE--------ETGDXXXXXXXXXXXXXIIDRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSIC----DYDSTDR-NLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPR--------SIAVGKRIVGSLSSFSPMLDERSS---KSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLS-FRHRMENESINSDIFIKINQDDDNMISEINQY------IKNPEL----QSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSS-GMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAE-PRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRK-----KLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPE----------EQLSNPELWFKYSLKET---------------EVPKFDE-----DPEINEVEIIYSTSPE----------------------------------DCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNR 5717
            K+ +++ PK PN  LE G+SLP   GD  PR  +   PL +LDP+Y  ++TF+V+   KT+FRFS T A Y+L+P NP+R+ AI++L H     FL L           KN     VEY FT IYTLE  IK ++RG  + +FT+LRD WNWLDF VI LAY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC+   +N ++   + + +E+  ++++W    +  F    N  DPL  C N +       CPEGYVC++    NPNYGYT+FD F  + L  FRLMTQD WENLYQLT+R  G  ++++F++VIF GSFYL+N+ILA+VAM+Y++     +  A+Q E        +  +            +I  +I   LG+E                D     S V K S   +     +  +  QV++ D + +     C      DS  R  L+ TR    LE Y K  +      +S      P+   SPR        S     + VGS + F+   DERS+    S  DP L      R      I++      I   LS N +   + + +     +   S    +F +    + +     + Y      +++P L    QS  S L+    E +  +++    W      F  W CC  + K + +V LI++DPFV+L IT+ IV+NT+ M+++    +P     L   N  FT  F  E  LKLIAL P  YFQE WN+FD +IV LSL+E+ L S+ G S+LR+FRLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y     E +    +  E PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F++ M++GNLV+LNLFLALLLSSF S++L   ++DS E N +Q A+ RI R +   K+ +R       E F +  ++K+K     K ++  P  N   +        L   NDV+  +          E+ +  E  +   + +T               E P  +E     DPE  + +I  S+S E                                  DC+ +F       C  +  E   GR WWN R     +VEH +FE+FII MI++SS  L  ED  +  R  +K  LE  DKVF  IF  EMLLKW A+G  KYF +AWCWLDFIIV I+LVSL+ + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY CVN  +     A  + N + C +     G   W+N ++NFDNV  GYL L QVATFKGW+ IM  AVDS  +  QP Y ++T  Y YFV+FIIFG+FFTLNLFIGVIIDNFN QKK++ G  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP      +IF     Q FDI IM +I LN + M IE  DQ ++++  L +IN VFI++FTGEFLLKLI+ R YYF + WN+FD V+VILSIV   +  ++     SPT  RV+R+ RIGRILRL+K+AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+ +L  ++N     C+          KG CG+  + + + +SY+IISFL+++NMYIAVILENFS AT++  E L +DD+++FYE WE++D  A  FI    L DF + +D PL +PKPN++QL  +++P+   D ++C+D+L   T+R LG+  E D+    + +        KV    ++ TL+R++E  +A VI +  + +  RLK+ +
Sbjct:   42 KEGEENGPK-PNRDLEAGQSLPFIYGDIPPR--MVSEPLEDLDPYYANQKTFIVLNKGKTLFRFSATSALYILTPFNPVRQAAIKILVHSYPLQFLPLK--------WTKN-----VEYTFTGIYTLESLIKILARGFCLEKFTFLRDPWNWLDFSVIVLAYVTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCLLWPYNSSV---DISLYEHFNESKQWLCPSKGLFYKLENQKDPL-VCGNSSDT---GKCPEGYVCVKAGR-NPNYGYTSFDTFNWAFLSLFRLMTQDCWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIEEAVQKEAEFQRLKKQQEEAQLFHFASLKNSQIFQKI---LGLE----------------DASECSSTVSKLSSKSAKERRNWRKQRKQVAHCDGQEKGDKEKCYKSGSEDSIKRKGLNFTREGRRLEEYRKSSM----PHQSLLSIQGPVF--SPRRNSKTSIFSFKDRAKDVGSENDFAD--DERSTFEEDSRRDP-LFVPGRHRARRNSNISQTSRSSRILPLLSMNGKMHSTVDCNGVVSLVGGSSAPIGLFPEGTTTETDRKRRPSSYKISMDLMEDPSLRQRAQSIASILTNTMEELQESRRKCPSCWYKFANCFLIWDCCEAWLKVKRIVKLIVMDPFVDLAITISIVLNTIFMAVEHAHMTPYFISVLTTGNQVFTGIFTAEMVLKLIALDPYYYFQEGWNIFDGLIVSLSLMELGLSSTGGFSVLRSFRLLRVFKLAKSWPTLNKLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY----KECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLLVFMLVMVIGNLVVLNLFLALLLSSFSSDNLSATDEDS-EINNIQIAVGRIQRGVASGKIILR-------EFFEKLFLQKQKDINETKQLEETPGKNDTCVLGNAVVEILKEKNDVRDSDGMTSEIGSSVEKSAENEKEYMTVINKTSLTVAVPIAPGESDFENPNTEEFSSESDPEETKEKIKVSSSSEGSTIDIRAPGVERIEEFLDYEYEETFDPEPCFTDDCVASFT------CCQINIENGTGRDWWNLRKTCYTIVEHSWFESFIIFMILLSSGALAFEDIYVEQRRNVKAILEYADKVFAYIFIMEMLLKWVAYGFIKYFTNAWCWLDFIIVDISLVSLIANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCVNTTSGVPFPATDVNNYSDCRMYINTTGAARWKNVKVNFDNVGAGYLALLQVATFKGWMPIMYAAVDSREINEQPKYENNTTMYLYFVAFIIFGSFFTLNLFIGVIIDNFNQQKKKIRGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANCCQGLIFDFVTKQAFDIIIMILIFLNMVTMMIETDDQSQEMEMYLYRINAVFIILFTGEFLLKLISLRQYYFTIGWNIFDLVVVILSIVGMFLADIIERYFFSPTLFRVIRLARIGRILRLIKAAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKQSGIDDMFNFETFGNSMICLFQITTSAGWDLLLEPILNSGEPDCDPNAEHPGSLFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEVWEKFDPSASQFIEYSKLSDFADALDPPLRVPKPNNIQLIAMDLPMVSGDRIHCLDILFAFTKRVLGEGGEMDSLRQPMEERFMTSNPSKVPYEPITTTLRRKQEEQSAVVIQRCYRRF--RLKKRQ 1888          
BLAST of scna-1 vs. Ensembl Xenopus
Match: srl (sarcalumenin [Source:Xenbase;Acc:XB-GENE-981745])

HSP 1 Score: 1202.96 bits (3111), Expect = 0.000e+0
Identity = 819/1930 (42.44%), Postives = 1124/1930 (58.24%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPV-FSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK-SFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD-----VRLAIQAEETGDXXXXXXXXXXXXXII--------DRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSIC----DYDSTDR-NLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPR--------SIAVGKRIVGSLSSFSPMLDERSS---KSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLS---------------FRHRMENESINSDIFIKINQDDDNMISEINQYIKNPEL----QSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSS-GMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAE-PRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRK-----KLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPE----------EQLSNPELWFKYSLKET---------------EVPKFDE-----DPEINEVEIIYSTSPE----------------------------------DCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNR 5717
            K+ +++ PK PN  LE G+SLP   GD  PR  +   PL +LDP+Y  ++TF+V+   KT+FRFS T A Y+L+P NP+R+ AI++L H     FL L           KN     VEY FT IYTLE  IK ++RG  + +FT+LRD WNWLDF VI LAY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC+   +N ++   + + +E+  ++++W   +    N+    DPL  C N +       CPEGYVC++    NPNYGYT+FD F  + L  FRLMTQD WENLYQLT+R  G  ++++F++VIF GSFYL+N+ILA+VAM+Y++     +  A+Q E      +++++E                 + EE+G+E                D     S V K S   +     +  +  QV++ D + +     C      DS  R  L+ TR    LE Y K  +      +S      P+   SPR        S     + VGS + F+   DERS+    S  DP L      R      I++      I   LS N +   + + +               F   +   +  +D   + +    +M       +++P L    QS  S L+    E +  +++    W      F  W CC  + K + +V LI++DPFV+L IT+ IV+NT+ M+++    +P     L   N  FT  F  E  LKLIAL P  YFQE WN+FD +IV LSL+E+ L S+ G S+LR+FRLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y     E +    +  E PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F++ M++GNLV+LNLFLALLLSSF S++L   ++DS E N +Q A+ RI R +   K+ +R       E F +  ++K+K     K ++  P  N   +        L   NDV+  +          E+ +  E  +   + +T               E P  +E     DPE  + +I  S+S E                                  DC+ +F       C  +  E   GR WWN R     +VEH +FE+FII MI++SS  L  ED  +  R  +K  LE  DKVF  IF  EMLLKW A+G  KYF +AWCWLDFIIV I+LVSL+ + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY CVN  +     A  + N + C +     G   W+N ++NFDNV  GYL L QVATFKGW+ IM  AVDS  +  QP Y ++T  Y YFV+FIIFG+FFTLNLFIGVIIDNFN QKK++ G  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP      +IF     Q FDI IM +I LN + M IE  DQ ++++  L +IN VFI++FTGEFLLKLI+ R YYF + WN+FD V+VILSIV   +  ++     SPT  RV+R+ RIGRILRL+K+AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+ +L  ++N     C+          KG CG+  + + + +SY+IISFL+++NMYIAVILENFS AT++  E L +DD+++FYE WE++D  A  FI    L DF + +D PL +PKPN++QL  +++P+   D ++C+D+L   T+R LG+  E D+    + +        KV    ++ TL+R++E  +A VI +  + +  RLK+ +
Sbjct:   42 KEGEENGPK-PNRDLEAGQSLPFIYGDIPPR--MVSEPLEDLDPYYANQKTFIVLNKGKTLFRFSATSALYILTPFNPVRQAAIKILVHSYPLQFLPLK--------WTKN-----VEYTFTGIYTLESLIKILARGFCLEKFTFLRDPWNWLDFSVIVLAYVTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCLLWPYNSSV---DISLYEHFNESKQWLCLFYKLENQK---DPL-VCGNSSDT---GKCPEGYVCVKAGR-NPNYGYTSFDTFNWAFLSLFRLMTQDCWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIEEAVQKEAEFQRLKKQQEEAQALAAAVADVFGESQELSEEVGLE----------------DASECSSTVSKLSSKSAKERRNWRKQRKQVAHCDGQEKGDKEKCYKSGSEDSIKRKGLNFTREGRRLEEYRKSSM----PHQSLLSIQGPVF--SPRRNSKTSIFSFKDRAKDVGSENDFAD--DERSTFEEDSRRDP-LFVPGRHRARRNSNISQTSRSSRILPLLSMNGKMHSTVDCNGVVSLVGGSSAPIGLFPEVLSGTTTETDRKRRPSSYKISM-----DLMEDPSLRQRAQSIASILTNTMEELQESRRKCPSCWYKFANCFLIWDCCEAWLKVKRIVKLIVMDPFVDLAITISIVLNTIFMAVEHAHMTPYFISVLTTGNQVFTGIFTAEMVLKLIALDPYYYFQEGWNIFDGLIVSLSLMELGLSSTGGFSVLRSFRLLRVFKLAKSWPTLNKLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY----KECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLLVFMLVMVIGNLVVLNLFLALLLSSFSSDNLSATDEDS-EINNIQIAVGRIQRGVASGKIILR-------EFFEKLFLQKQKDINETKQLEETPGKNDTCVLGNAVVEILKEKNDVRDSDGMTSEIGSSVEKSAENEKEYMTVINKTSLTVAVPIAPGESDFENPNTEEFSSESDPEETKEKIKVSSSSEGSTIDIRAPGVERIEEFLDYEYEETFDPEPCFTDDCVASFT------CCQINIENGTGRDWWNLRKTCYTIVEHSWFESFIIFMILLSSGALAFEDIYVEQRRNVKAILEYADKVFAYIFIMEMLLKWVAYGFIKYFTNAWCWLDFIIVDISLVSLIANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCVNTTSGVPFPATDVNNYSDCRMYINTTGAARWKNVKVNFDNVGAGYLALLQVATFKGWMPIMYAAVDSREINEQPKYENNTTMYLYFVAFIIFGSFFTLNLFIGVIIDNFNQQKKKIRGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANCCQGLIFDFVTKQAFDIIIMILIFLNMVTMMIETDDQSQEMEMYLYRINAVFIILFTGEFLLKLISLRQYYFTIGWNIFDLVVVILSIVGMFLADIIERYFFSPTLFRVIRLARIGRILRLIKAAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKQSGIDDMFNFETFGNSMICLFQITTSAGWDLLLEPILNSGEPDCDPNAEHPGSLFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEVWEKFDPSASQFIEYSKLSDFADALDPPLRVPKPNNIQLIAMDLPMVSGDRIHCLDILFAFTKRVLGEGGEMDSLRQPMEERFMTSNPSKVPYEPITTTLRRKQEEQSAVVIQRCYRRF--RLKKRQ 1890          
BLAST of scna-1 vs. Ensembl Xenopus
Match: srl (sarcalumenin [Source:Xenbase;Acc:XB-GENE-981745])

HSP 1 Score: 1195.65 bits (3092), Expect = 0.000e+0
Identity = 824/1929 (42.72%), Postives = 1120/1929 (58.06%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPV-FSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK-SFNHTL---LYFEPNEFENLTDAEKWTVKYE----FFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD-----VRLAIQAEETGDXXXXXXXXXXXXXII--------DRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSIC----DYDSTDR-NLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPR--------SIAVGKRIVGSLSSFSPMLDERSS---KSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLS-FRHRMENESINSDIFIKINQDDDNMISEINQY------IKNPEL----QSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSS-GMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAE-PRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRK-----KLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPE----------EQLSNPELWFKYSLKET---------------EVPKFDE-----DPEINEVEIIYSTSPE----------------------------------DCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNR 5717
            K+ +++ PK PN  LE G+SLP   GD  PR  +   PL +LDP+Y  ++TF+V+   KT+FRFS T A Y+L+P NP+R+ AI++L H     FL L           KN     VEY FT IYTLE  IK ++RG  + +FT+LRD WNWLDF VI LAY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC+   +N ++   LY   NE +      K TV        F    N  DPL  C N +       CPEGYVC++    NPNYGYT+FD F  + L  FRLMTQD WENLYQLT+R  G  ++++F++VIF GSFYL+N+ILA+VAM+Y++     +  A+Q E      +++++E                 + EE+G+E                D     S V K S   +     +  +  QV++ D + +     C      DS  R  L+ TR    LE Y K  +      +S      P+   SPR        S     + VGS + F+   DERS+    S  DP L      R      I++      I   LS N +   + + +     +   S    +F +    + +     + Y      +++P L    QS  S L+    E +  +++    W      F  W CC  + K + +V LI++DPFV+L IT+ IV+NT+ M+++    +P     L   N  FT  F  E  LKLIAL P  YFQE WN+FD +IV LSL+E+ L S+ G S+LR+FRLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y     E +    +  E PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F++ M++GNLV+LNLFLALLLSSF S++L   ++DS E N +Q A+ RI R +   K+ +R       E F +  ++K+K     K ++  P  N   +        L   NDV+  +          E+ +  E  +   + +T               E P  +E     DPE  + +I  S+S E                                  DC+ +F       C  +  E   GR WWN R     +VEH +FE+FII MI++SS  L  ED  +  R  +K  LE  DKVF  IF  EMLLKW A+G  KYF +AWCWLDFIIV I+LVSL+ + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY CVN  +     A  + N + C +     G   W+N ++NFDNV  GYL L QVATFKGW+ IM  AVDS     +P Y ++T  Y YFV+FIIFG+FFTLNLFIGVIIDNFN QKK++ G  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP      +IF     Q FDI IM +I LN + M IE  DQ ++++  L +IN VFI++FTGEFLLKLI+ R YYF + WN+FD V+VILSIV   +  ++     SPT  RV+R+ RIGRILRL+K+AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+ +L  ++N     C+          KG CG+  + + + +SY+IISFL+++NMYIAVILENFS AT++  E L +DD+++FYE WE++D  A  FI    L DF + +D PL +PKPN++QL  +++P+   D ++C+D+L   T+R LG+  E D+    + +        KV    ++ TL+R++E  +A VI +  + +  RLK+ +
Sbjct:   42 KEGEENGPK-PNRDLEAGQSLPFIYGDIPPR--MVSEPLEDLDPYYANQKTFIVLNKGKTLFRFSATSALYILTPFNPVRQAAIKILVHSYPLQFLPLK--------WTKN-----VEYTFTGIYTLESLIKILARGFCLEKFTFLRDPWNWLDFSVIVLAYVTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCLLWPYNSSVDISLYEHFNESKQWLCPSKGTVFSSCIVCLFYKLENQKDPL-VCGNSSDT---GKCPEGYVCVKAGR-NPNYGYTSFDTFNWAFLSLFRLMTQDCWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIEEAVQKEAEFQRLKKQQEEAQALAAAVADVFGESQELSEEVGLE----------------DASECSSTVSKLSSKSAKERRNWRKQRKQVAHCDGQEKGDKEKCYKSGSEDSIKRKGLNFTREGRRLEEYRKSSM----PHQSLLSIQGPVF--SPRRNSKTSIFSFKDRAKDVGSENDFAD--DERSTFEEDSRRDP-LFVPGRHRARRNSNISQTSRSSRILPLLSMNGKMHSTVDCNGVVSLVGGSSAPIGLFPEGTTTETDRKRRPSSYKISMDLMEDPSLRQRAQSIASILTNTMEELQESRRKCPSCWYKFANCFLIWDCCEAWLKVKRIVKLIVMDPFVDLAITISIVLNTIFMAVEHAHMTPYFISVLTTGNQVFTGIFTAEMVLKLIALDPYYYFQEGWNIFDGLIVSLSLMELGLSSTGGFSVLRSFRLLRVFKLAKSWPTLNKLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY----KECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLLVFMLVMVIGNLVVLNLFLALLLSSFSSDNLSATDEDS-EINNIQIAVGRIQRGVASGKIILR-------EFFEKLFLQKQKDINETKQLEETPGKNDTCVLGNAVVEILKEKNDVRDSDGMTSEIGSSVEKSAENEKEYMTVINKTSLTVAVPIAPGESDFENPNTEEFSSESDPEETKEKIKVSSSSEGSTIDIRAPGVERIEEFLDYEYEETFDPEPCFTDDCVASFT------CCQINIENGTGRDWWNLRKTCYTIVEHSWFESFIIFMILLSSGALAFEDIYVEQRRNVKAILEYADKVFAYIFIMEMLLKWVAYGFIKYFTNAWCWLDFIIVDISLVSLIANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCVNTTSGVPFPATDVNNYSDCRMYINTTGAARWKNVKVNFDNVGAGYLALLQVATFKGWMPIMYAAVDS----REPKYENNTTMYLYFVAFIIFGSFFTLNLFIGVIIDNFNQQKKKIRGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANCCQGLIFDFVTKQAFDIIIMILIFLNMVTMMIETDDQSQEMEMYLYRINAVFIILFTGEFLLKLISLRQYYFTIGWNIFDLVVVILSIVGMFLADIIERYFFSPTLFRVIRLARIGRILRLIKAAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKQSGIDDMFNFETFGNSMICLFQITTSAGWDLLLEPILNSGEPDCDPNAEHPGSLFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEVWEKFDPSASQFIEYSKLSDFADALDPPLRVPKPNNIQLIAMDLPMVSGDRIHCLDILFAFTKRVLGEGGEMDSLRQPMEERFMTSNPSKVPYEPITTTLRRKQEEQSAVVIQRCYRRF--RLKKRQ 1896          
BLAST of scna-1 vs. Ensembl Xenopus
Match: srl (sarcalumenin [Source:Xenbase;Acc:XB-GENE-981745])

HSP 1 Score: 1195.65 bits (3092), Expect = 0.000e+0
Identity = 820/1929 (42.51%), Postives = 1113/1929 (57.70%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPV-FSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD-----VRLAIQAEETGDXXXXXXXXXXXXXII--------DRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSIC----DYDSTDR-NLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPR--------SIAVGKRIVGSLSSFSPMLDERSS---KSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLS---------------FRHRMENESINSDIFIKINQDDDNMISEINQYIKNPEL----QSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSS-GMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAE-PRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRK-----KLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPE----------EQLSNPELWFKYSLKET---------------EVPKFDE-----DPEINEVEIIYSTSPE----------------------------------DCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNR 5717
            K+ +++ PK PN  LE G+SLP   GD  PR  +   PL +LDP+Y  ++TF+V+   KT+FRFS T A Y+L+P NP+R+ AI++L H     FL L           KN     VEY FT IYTLE  IK ++RG  + +FT+LRD WNWLDF VI LAY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC        L +  N           +V    F    N  DPL  C N +       CPEGYVC++    NPNYGYT+FD F  + L  FRLMTQD WENLYQLT+R  G  ++++F++VIF GSFYL+N+ILA+VAM+Y++     +  A+Q E      +++++E                 + EE+G+E                D     S V K S   +     +  +  QV++ D + +     C      DS  R  L+ TR    LE Y K  +      +S      P+   SPR        S     + VGS + F+   DERS+    S  DP L      R      I++      I   LS N +   + + +               F   +   +  +D   + +    +M       +++P L    QS  S L+    E +  +++    W      F  W CC  + K + +V LI++DPFV+L IT+ IV+NT+ M+++    +P     L   N  FT  F  E  LKLIAL P  YFQE WN+FD +IV LSL+E+ L S+ G S+LR+FRLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y     E +    +  E PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F++ M++GNLV+LNLFLALLLSSF S++L   ++DS E N +Q A+ RI R +   K+ +R       E F +  ++K+K     K ++  P  N   +        L   NDV+  +          E+ +  E  +   + +T               E P  +E     DPE  + +I  S+S E                                  DC+ +F       C  +  E   GR WWN R     +VEH +FE+FII MI++SS  L  ED  +  R  +K  LE  DKVF  IF  EMLLKW A+G  KYF +AWCWLDFIIV I+LVSL+ + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY CVN  +     A  + N + C +     G   W+N ++NFDNV  GYL L QVATFKGW+ IM  AVDS  +  QP Y ++T  Y YFV+FIIFG+FFTLNLFIGVIIDNFN QKK++ G  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP      +IF     Q FDI IM +I LN + M IE  DQ ++++  L +IN VFI++FTGEFLLKLI+ R YYF + WN+FD V+VILSIV   +  ++     SPT  RV+R+ RIGRILRL+K+AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+ +L  ++N     C+          KG CG+  + + + +SY+IISFL+++NMYIAVILENFS AT++  E L +DD+++FYE WE++D  A  FI    L DF + +D PL +PKPN++QL  +++P+   D ++C+D+L   T+R LG+  E D+    + +        KV    ++ TL+R++E  +A VI +  + +  RLK+ +
Sbjct:   42 KEGEENGPK-PNRDLEAGQSLPFIYGDIPPR--MVSEPLEDLDPYYANQKTFIVLNKGKTLFRFSATSALYILTPFNPVRQAAIKILVHSYPLQFLPLK--------WTKN-----VEYTFTGIYTLESLIKILARGFCLEKFTFLRDPWNWLDFSVIVLAYVTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKC--------LLWPYNS----------SVDISLFYKLENQKDPL-VCGNSSDT---GKCPEGYVCVKAGR-NPNYGYTSFDTFNWAFLSLFRLMTQDCWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIEEAVQKEAEFQRLKKQQEEAQALAAAVADVFGESQELSEEVGLE----------------DASECSSTVSKLSSKSAKERRNWRKQRKQVAHCDGQEKGDKEKCYKSGSEDSIKRKGLNFTREGRRLEEYRKSSM----PHQSLLSIQGPVF--SPRRNSKTSIFSFKDRAKDVGSENDFAD--DERSTFEEDSRRDP-LFVPGRHRARRNSNISQTSRSSRILPLLSMNGKMHSTVDCNGVVSLVGGSSAPIGLFPEVLSGTTTETDRKRRPSSYKISM-----DLMEDPSLRQRAQSIASILTNTMEELQESRRKCPSCWYKFANCFLIWDCCEAWLKVKRIVKLIVMDPFVDLAITISIVLNTIFMAVEHAHMTPYFISVLTTGNQVFTGIFTAEMVLKLIALDPYYYFQEGWNIFDGLIVSLSLMELGLSSTGGFSVLRSFRLLRVFKLAKSWPTLNKLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY----KECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLLVFMLVMVIGNLVVLNLFLALLLSSFSSDNLSATDEDS-EINNIQIAVGRIQRGVASGKIILR-------EFFEKLFLQKQKDINETKQLEETPGKNDTCVLGNAVVEILKEKNDVRDSDGMTSEIGSSVEKSAENEKEYMTVINKTSLTVAVPIAPGESDFENPNTEEFSSESDPEETKEKIKVSSSSEGSTIDIRAPGVERIEEFLDYEYEETFDPEPCFTDDCVASFT------CCQINIENGTGRDWWNLRKTCYTIVEHSWFESFIIFMILLSSGALAFEDIYVEQRRNVKAILEYADKVFAYIFIMEMLLKWVAYGFIKYFTNAWCWLDFIIVDISLVSLIANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCVNTTSGVPFPATDVNNYSDCRMYINTTGAARWKNVKVNFDNVGAGYLALLQVATFKGWMPIMYAAVDSREINEQPKYENNTTMYLYFVAFIIFGSFFTLNLFIGVIIDNFNQQKKKIRGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANCCQGLIFDFVTKQAFDIIIMILIFLNMVTMMIETDDQSQEMEMYLYRINAVFIILFTGEFLLKLISLRQYYFTIGWNIFDLVVVILSIVGMFLADIIERYFFSPTLFRVIRLARIGRILRLIKAAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKQSGIDDMFNFETFGNSMICLFQITTSAGWDLLLEPILNSGEPDCDPNAEHPGSLFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEVWEKFDPSASQFIEYSKLSDFADALDPPLRVPKPNNIQLIAMDLPMVSGDRIHCLDILFAFTKRVLGEGGEMDSLRQPMEERFMTSNPSKVPYEPITTTLRRKQEEQSAVVIQRCYRRF--RLKKRQ 1877          
BLAST of scna-1 vs. Ensembl Xenopus
Match: srl (sarcalumenin [Source:Xenbase;Acc:XB-GENE-981745])

HSP 1 Score: 1173.69 bits (3035), Expect = 0.000e+0
Identity = 809/1938 (41.74%), Postives = 1099/1938 (56.71%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPV-FSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLA---------YLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK-SFNHTL---LYFEPNEFENLTDAEKWTVKYE----FFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD-----VRLAIQAEETGDXXXXXXXXXXXXXII--------DRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSIC----DYDSTDR-NLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPR--------SIAVGKRIVGSLSSFSPMLDERSS---KSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLS-FRHRMENESINSDIFIKINQDDDNMISEINQY------IKNPEL----QSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSS-GMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAE-PRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRK-----KLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPE----------EQLSNPELWFKYSLKET---------------EVPKFDE-----DPEINEVEIIYSTSPE----------------------------------DCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNR 5717
            K+ +++ PK PN  LE G+SLP   GD  PR  +   PL +LDP+Y  ++TF+V+   KT+FRFS T A Y+L+P NP+R+ AI++L H     FL L           KN     VEY FT IYTLE  IK ++RG  + +FT+LRD WNWLDF VI LA         Y   FF                          +KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC+   +N ++   LY   NE +      K TV        F    N  DPL  C N +       CPEGYVC++    NPNYGYT+FD F  + L  FRLMTQD WENLYQLT+R  G  ++++F++VIF GSFYL+N+ILA+VAM+Y++     +  A+Q E      +++++E                 + EE+G+E                D     S V K S   +     +  +  QV++ D + +     C      DS  R  L+ TR    LE Y K  +      +S      P+   SPR        S     + VGS + F+   DERS+    S  DP L      R      I++      I   LS N +   + + +     +   S    +F +    + +     + Y      +++P L    QS  S L+    E +  +++    W      F  W CC  + K + +V LI++DPFV+L IT+ IV+NT+ M+++    +P     L   N  FT  F  E  LKLIAL P  YFQE WN+FD +IV LSL+E+ L S+ G S+LR+FRLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y     E +    +  E PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F++ M++GNLV+LNLFLALLLSSF S++L   ++DS E N +Q A+ RI R +   K+ +R       E F +  ++K+K     K ++  P  N   +        L   NDV+  +          E+ +  E  +   + +T               E P  +E     DPE  + +I  S+S E                                  DC+ +F       C  +  E   GR WWN R     +VEH +FE+FII MI++SS  L  ED  +  R  +K  LE  DKVF  IF  EMLLKW A+G  KYF +AWCWLDFIIV I+LVSL+ + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY CVN  +     A  + N + C +     G   W+N ++NFDNV  GYL L QVATFKGW+ IM  AVDS  +  QP Y ++T  Y YFV+FIIFG+FFTLNLFIGVIIDNFN QKK++ G  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP      +IF     Q FDI IM +I LN + M IE  DQ ++++  L +IN VFI++FTGEFLLKLI+ R YYF + WN+FD V+VILSIV   +  ++     SPT  RV+R+ RIGRILRL+K+AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+ +L  ++N     C+          KG CG+  + + + +SY+IISFL+++NMYIAVILENFS AT++  E L +DD+++FYE WE++D  A  FI    L DF + +D PL +PKPN++QL  +++P+   D ++C+D+L   T+R LG+  E D+    + +        KV    ++ TL+R++E  +A VI +  + +  RLK+ +
Sbjct:   42 KEGEENGPK-PNRDLEAGQSLPFIYGDIPPR--MVSEPLEDLDPYYANQKTFIVLNKGKTLFRFSATSALYILTPFNPVRQAAIKILVHSYPLQFLPLK--------WTKN-----VEYTFTGIYTLESLIKILARGFCLEKFTFLRDPWNWLDFSVIVLAATFRLLHFTYKEAFF-------------------------SLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCLLWPYNSSVDISLYEHFNESKQWLCPSKGTVFSSCIVCLFYKLENQKDPL-VCGNSSD---TGKCPEGYVCVKAGR-NPNYGYTSFDTFNWAFLSLFRLMTQDCWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIEEAVQKEAEFQRLKKQQEEAQALAAAVADVFGESQELSEEVGLE----------------DASECSSTVSKLSSKSAKERRNWRKQRKQVAHCDGQEKGDKEKCYKSGSEDSIKRKGLNFTREGRRLEEYRKSSM----PHQSLLSIQGPVF--SPRRNSKTSIFSFKDRAKDVGSENDFAD--DERSTFEEDSRRDP-LFVPGRHRARRNSNISQTSRSSRILPLLSMNGKMHSTVDCNGVVSLVGGSSAPIGLFPEGTTTETDRKRRPSSYKISMDLMEDPSLRQRAQSIASILTNTMEELQESRRKCPSCWYKFANCFLIWDCCEAWLKVKRIVKLIVMDPFVDLAITISIVLNTIFMAVEHAHMTPYFISVLTTGNQVFTGIFTAEMVLKLIALDPYYYFQEGWNIFDGLIVSLSLMELGLSSTGGFSVLRSFRLLRVFKLAKSWPTLNKLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY----KECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLLVFMLVMVIGNLVVLNLFLALLLSSFSSDNLSATDEDS-EINNIQIAVGRIQRGVASGKIILR-------EFFEKLFLQKQKDINETKQLEETPGKNDTCVLGNAVVEILKEKNDVRDSDGMTSEIGSSVEKSAENEKEYMTVINKTSLTVAVPIAPGESDFENPNTEEFSSESDPEETKEKIKVSSSSEGSTIDIRAPGVERIEEFLDYEYEETFDPEPCFTDDCVASFT------CCQINIENGTGRDWWNLRKTCYTIVEHSWFESFIIFMILLSSGALAFEDIYVEQRRNVKAILEYADKVFAYIFIMEMLLKWVAYGFIKYFTNAWCWLDFIIVDISLVSLIANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCVNTTSGVPFPATDVNNYSDCRMYINTTGAARWKNVKVNFDNVGAGYLALLQVATFKGWMPIMYAAVDSREINEQPKYENNTTMYLYFVAFIIFGSFFTLNLFIGVIIDNFNQQKKKIRGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANCCQGLIFDFVTKQAFDIIIMILIFLNMVTMMIETDDQSQEMEMYLYRINAVFIILFTGEFLLKLISLRQYYFTIGWNIFDLVVVILSIVGMFLADIIERYFFSPTLFRVIRLARIGRILRLIKAAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKQSGIDDMFNFETFGNSMICLFQITTSAGWDLLLEPILNSGEPDCDPNAEHPGSLFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEVWEKFDPSASQFIEYSKLSDFADALDPPLRVPKPNNIQLIAMDLPMVSGDRIHCLDILFAFTKRVLGEGGEMDSLRQPMEERFMTSNPSKVPYEPITTTLRRKQEEQSAVVIQRCYRRF--RLKKRQ 1885          
BLAST of scna-1 vs. Ensembl Mouse
Match: Scn2a (sodium channel, voltage-gated, type II, alpha [Source:MGI Symbol;Acc:MGI:98248])

HSP 1 Score: 929.858 bits (2402), Expect = 0.000e+0
Identity = 575/1204 (47.76%), Postives = 764/1204 (63.46%), Query Frame = 3
Query: 2319 WTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIK--CEKSYYELSVSNDVKIPEEQ------------------------LSNPELWFKYSLKETE-------VPKFDEDPEINEV-EIIYSTS---------------------PEDCL---PNFISKLLR--KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            W CC  + K + +V L+++DPFV+L IT+CIV+NT+ M+++    + + +  L   N  FT  F  E FLK+IA+ P  YFQE WN+FD  IV LSL+E+ L +  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      S     PRW+ +DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF S++L   +DD NE N LQ A+ R+ + I +VK +IR       E   +  V+K+K L +  P+ + +N K  C  ++  + +  D+   ++                         ++NP L     +   E         +F  + ++ E  E + +TS                     PE+ L     F    +R  KC  +  E   G+LWWN R    K+VEH +FETFI+ MI++SS  L  ED  +  R  +K  LE  DKVFT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LVSL  + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY C+N  T E     ++ N + C  +        W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS  +  QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  K   ++F     Q FDI IM +I LN + M +E  DQ +++   L  IN VFIV+FTGE +LKLI+ R YYF + WN+FDFV+VILSIV   +  ++    VSPT  RV+R+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ E        KG CG+  + + + +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D     + +        KV    ++ TLKR++E  +A VI +  + Y   LKQ  K
Sbjct:  740 WDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDD-NEMNNLQIAVGRMQKGIDFVKRKIR-------EFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYL--LKQKVK 1927          

HSP 2 Score: 335.88 bits (860), Expect = 1.859e-92
Identity = 193/404 (47.77%), Postives = 263/404 (65.10%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK--SFNHTLLYFEPNEFENLTDAEKWT-VKYEFFNNETNWLDPLRQCQNYTYNEW--------NTS----CPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            K + D+   +PN  LE GKSLP   GD  P  ++   PL +LDP+Y  K+TF+V+   K I RFS T A Y+L+P NPIRK AI++L H +F+ L++ TI+ NCVFM  ++  D    VEY FT IYT E  IK ++RG  + +FT+LRD WNWLDF VI  AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC++    N T   FE N      ++  W    +    N  NW + +    ++ + E         N+S    CPEGY+C++    NPNYGYT+FD F  + L  FRLMTQD+WENLYQLT+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++   A   E
Sbjct:   42 KDEDDENGPKPNSDLEAGKSLPFIYGDIPP--EMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNST---FEINITSFFNNSLDWNGTAFNRTMNMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGR-NPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEE 438          

HSP 3 Score: 79.337 bits (194), Expect = 6.146e-14
Identity = 47/140 (33.57%), Postives = 79/140 (56.43%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV----NNDTFE 4076
            ++  FT I+T E L+K  A G       + +D W WLDF ++T A V+  ++        +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KC+    +N TFE
Sbjct:  158 VEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVN--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFE 289          

HSP 4 Score: 61.2326 bits (147), Expect = 1.670e-8
Identity = 74/320 (23.12%), Postives = 143/320 (44.69%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLY---------QLTIRTNGDIHI-LYFMMVIFFGSFYLINVILAIV 1439
            +RKT  +++ H  F   ++  I+++   +A        + +    +EY   VFT I+ LE  +K ++ G  +    Y  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV ALL A+  + + +++ +    IF ++G+ L+ G         F H +         N T  E + V     NN +       +CQ    +               +T        NFDN  +  L   ++ T   W ++          +L  +   ++++ LYF++ I FGSF+ +N+ + ++
Sbjct: 1198 LRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQM----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG--------KFYHCI---------NYTTGEMFDVS--VVNNYS-------ECQALIES--------------NQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1473          

HSP 5 Score: 59.6918 bits (143), Expect = 4.660e-8
Identity = 52/203 (25.62%), Postives = 90/203 (44.33%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF---------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLFGDKYSNFKNETL 2846
            KTF          +F +  AL IL PF                 + I   I+ N V M++  P +      + K   Y FT  +  E+ +K++A G       + ++ WN  DF ++  + V   ++   +S LR FR+LR  K   +   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF     N +N+ L
Sbjct:   89 KTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPD------WTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVNLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLF---MGNLRNKCL 279          
BLAST of scna-1 vs. Ensembl Mouse
Match: Scn2a (sodium channel, voltage-gated, type II, alpha [Source:MGI Symbol;Acc:MGI:98248])

HSP 1 Score: 929.858 bits (2402), Expect = 0.000e+0
Identity = 575/1204 (47.76%), Postives = 764/1204 (63.46%), Query Frame = 3
Query: 2319 WTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIK--CEKSYYELSVSNDVKIPEEQ------------------------LSNPELWFKYSLKETE-------VPKFDEDPEINEV-EIIYSTS---------------------PEDCL---PNFISKLLR--KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            W CC  + K + +V L+++DPFV+L IT+CIV+NT+ M+++    + + +  L   N  FT  F  E FLK+IA+ P  YFQE WN+FD  IV LSL+E+ L +  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      S     PRW+ +DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF S++L   +DD NE N LQ A+ R+ + I +VK +IR       E   +  V+K+K L +  P+ + +N K  C  ++  + +  D+   ++                         ++NP L     +   E         +F  + ++ E  E + +TS                     PE+ L     F    +R  KC  +  E   G+LWWN R    K+VEH +FETFI+ MI++SS  L  ED  +  R  +K  LE  DKVFT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LVSL  + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY C+N  T E     ++ N + C  +        W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS  +  QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  K   ++F     Q FDI IM +I LN + M +E  DQ +++   L  IN VFIV+FTGE +LKLI+ R YYF + WN+FDFV+VILSIV   +  ++    VSPT  RV+R+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ E        KG CG+  + + + +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D     + +        KV    ++ TLKR++E  +A VI +  + Y   LKQ  K
Sbjct:  740 WDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDD-NEMNNLQIAVGRMQKGIDFVKRKIR-------EFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYL--LKQKVK 1927          

HSP 2 Score: 336.265 bits (861), Expect = 1.412e-92
Identity = 193/404 (47.77%), Postives = 263/404 (65.10%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK--SFNHTLLYFEPNEFENLTDAEKWT-VKYEFFNNETNWLDPLRQCQNYTYNEW--------NTS----CPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            K + D+   +PN  LE GKSLP   GD  P  ++   PL +LDP+Y  K+TF+V+   K I RFS T A Y+L+P NPIRK AI++L H +F+ L++ TI+ NCVFM  ++  D    VEY FT IYT E  IK ++RG  + +FT+LRD WNWLDF VI  AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC++    N T   FE N      ++  W    +    N  NW + +    ++ + E         N+S    CPEGY+C++    NPNYGYT+FD F  + L  FRLMTQD+WENLYQLT+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++   A   E
Sbjct:   42 KDEDDENGPKPNSDLEAGKSLPFIYGDIPP--EMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVD-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNST---FEINITSFFNNSLDWNGTAFNRTMNMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGR-NPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEE 438          

HSP 3 Score: 78.9518 bits (193), Expect = 7.032e-14
Identity = 47/140 (33.57%), Postives = 78/140 (55.71%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV----NNDTFE 4076
            ++  FT I+T E L+K  A G       + +D W WLDF ++T A V+  +         +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KC+    +N TFE
Sbjct:  158 VEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVD--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFE 289          

HSP 4 Score: 61.6178 bits (148), Expect = 1.163e-8
Identity = 53/203 (26.11%), Postives = 90/203 (44.33%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF---------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLFGDKYSNFKNETL 2846
            KTF          +F +  AL IL PF                 + I   I+ N V M++  P +      + K   Y FT  +  E+ +K++A G       + ++ WN  DF ++  + V   +D   +S LR FR+LR  K   +   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF     N +N+ L
Sbjct:   89 KTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPD------WTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLF---MGNLRNKCL 279          

HSP 5 Score: 61.2326 bits (147), Expect = 1.642e-8
Identity = 74/320 (23.12%), Postives = 143/320 (44.69%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLY---------QLTIRTNGDIHI-LYFMMVIFFGSFYLINVILAIV 1439
            +RKT  +++ H  F   ++  I+++   +A        + +    +EY   VFT I+ LE  +K ++ G  +    Y  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV ALL A+  + + +++ +    IF ++G+ L+ G         F H +         N T  E + V     NN +       +CQ    +               +T        NFDN  +  L   ++ T   W ++          +L  +   ++++ LYF++ I FGSF+ +N+ + ++
Sbjct: 1198 LRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQM----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG--------KFYHCI---------NYTTGEMFDVS--VVNNYS-------ECQALIES--------------NQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1473          
BLAST of scna-1 vs. Ensembl Mouse
Match: Scn2a (sodium channel, voltage-gated, type II, alpha [Source:MGI Symbol;Acc:MGI:98248])

HSP 1 Score: 929.858 bits (2402), Expect = 0.000e+0
Identity = 575/1204 (47.76%), Postives = 764/1204 (63.46%), Query Frame = 3
Query: 2319 WTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIK--CEKSYYELSVSNDVKIPEEQ------------------------LSNPELWFKYSLKETE-------VPKFDEDPEINEV-EIIYSTS---------------------PEDCL---PNFISKLLR--KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            W CC  + K + +V L+++DPFV+L IT+CIV+NT+ M+++    + + +  L   N  FT  F  E FLK+IA+ P  YFQE WN+FD  IV LSL+E+ L +  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      S     PRW+ +DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF S++L   +DD NE N LQ A+ R+ + I +VK +IR       E   +  V+K+K L +  P+ + +N K  C  ++  + +  D+   ++                         ++NP L     +   E         +F  + ++ E  E + +TS                     PE+ L     F    +R  KC  +  E   G+LWWN R    K+VEH +FETFI+ MI++SS  L  ED  +  R  +K  LE  DKVFT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LVSL  + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY C+N  T E     ++ N + C  +        W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS  +  QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  K   ++F     Q FDI IM +I LN + M +E  DQ +++   L  IN VFIV+FTGE +LKLI+ R YYF + WN+FDFV+VILSIV   +  ++    VSPT  RV+R+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ E        KG CG+  + + + +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D     + +        KV    ++ TLKR++E  +A VI +  + Y   LKQ  K
Sbjct:  740 WDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDD-NEMNNLQIAVGRMQKGIDFVKRKIR-------EFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYL--LKQKVK 1927          

HSP 2 Score: 335.88 bits (860), Expect = 1.859e-92
Identity = 193/404 (47.77%), Postives = 263/404 (65.10%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK--SFNHTLLYFEPNEFENLTDAEKWT-VKYEFFNNETNWLDPLRQCQNYTYNEW--------NTS----CPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            K + D+   +PN  LE GKSLP   GD  P  ++   PL +LDP+Y  K+TF+V+   K I RFS T A Y+L+P NPIRK AI++L H +F+ L++ TI+ NCVFM  ++  D    VEY FT IYT E  IK ++RG  + +FT+LRD WNWLDF VI  AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC++    N T   FE N      ++  W    +    N  NW + +    ++ + E         N+S    CPEGY+C++    NPNYGYT+FD F  + L  FRLMTQD+WENLYQLT+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++   A   E
Sbjct:   42 KDEDDENGPKPNSDLEAGKSLPFIYGDIPP--EMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNST---FEINITSFFNNSLDWNGTAFNRTMNMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGR-NPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEE 438          

HSP 3 Score: 79.337 bits (194), Expect = 6.146e-14
Identity = 47/140 (33.57%), Postives = 79/140 (56.43%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV----NNDTFE 4076
            ++  FT I+T E L+K  A G       + +D W WLDF ++T A V+  ++        +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KC+    +N TFE
Sbjct:  158 VEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVN--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFE 289          

HSP 4 Score: 61.2326 bits (147), Expect = 1.670e-8
Identity = 74/320 (23.12%), Postives = 143/320 (44.69%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLY---------QLTIRTNGDIHI-LYFMMVIFFGSFYLINVILAIV 1439
            +RKT  +++ H  F   ++  I+++   +A        + +    +EY   VFT I+ LE  +K ++ G  +    Y  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV ALL A+  + + +++ +    IF ++G+ L+ G         F H +         N T  E + V     NN +       +CQ    +               +T        NFDN  +  L   ++ T   W ++          +L  +   ++++ LYF++ I FGSF+ +N+ + ++
Sbjct: 1198 LRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQM----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG--------KFYHCI---------NYTTGEMFDVS--VVNNYS-------ECQALIES--------------NQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1473          

HSP 5 Score: 59.6918 bits (143), Expect = 4.660e-8
Identity = 52/203 (25.62%), Postives = 90/203 (44.33%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF---------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLFGDKYSNFKNETL 2846
            KTF          +F +  AL IL PF                 + I   I+ N V M++  P +      + K   Y FT  +  E+ +K++A G       + ++ WN  DF ++  + V   ++   +S LR FR+LR  K   +   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF     N +N+ L
Sbjct:   89 KTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPD------WTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVNLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLF---MGNLRNKCL 279          
BLAST of scna-1 vs. Ensembl Mouse
Match: Scn8a (sodium channel, voltage-gated, type VIII, alpha [Source:MGI Symbol;Acc:MGI:103169])

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 573/1263 (45.37%), Postives = 786/1263 (62.23%), Query Frame = 3
Query: 2118 RMENESINSDIFIKINQDDDNMIS--EINQYIKNPELQSALSALS---IYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKV------QIRFAIKLSKEIFG-RCIVKKRKKLIKSHPMWNAH-------NIKCEKSYYELSVSNDVKIPEEQLS---NPELWFKYSLK---------ETEVPKFDEDPEINEVEIIYSTS-------------------------PEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGN---VSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVC-NKE------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTER 5702
            +   +S  +++ IK       ++S  ++  Y +   + S +S ++   + + E   RK          TF  W C P + K + +V LI++DPFV+L IT+CIV+NT+ M+++    +P+  H L   N  FT  F  E FLKLIA+ P  YFQE WN+FD  IV LSL+E+ L D  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      S +   PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF +++L   +DD  E N LQ ++ RI + + W KV      Q  F  + + E+     + +K+   I +H   + H       N     S    SV   + I E+ +S   NP L  +  +           TE    + DPE ++ ++  ++S                         P+ C      +   KC  V  E   G+ WW  R     +VEH +FETFII MI++SS  L  ED  +  R  ++  LE  DKVFT IF  EMLLKW A+G  K+F +AWCWLDF+IV ++LVSL+ + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GK++ C N  +  R   + + NK  C   K M GN   + W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS     QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  KI  I+F     Q FDI IM +I LN + M +E   Q ++++  L  IN VF++ FT E +LK+ A R YYF + WN+FDFV+VILSIV   +  ++    VSPT  RV+R+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFI++I GMS F+ V +   ID++FNFETFG +MI LFQI+TS GW+G+L  ++N  P    +KE      KG CG+  + + + +SY+IISFL+++NMYIA+ILENFS AT++  + L++DD++ FYE WE++D  A  FI    L DF + ++ PL +PKPN+++L  +++P+   D ++C+D+L   T+R LG   E D     + +        KV    ++ TL+R++E  +A V+ +  + +  R
Sbjct:  669 KAATDSATTEVEIKKKGPGSLLVSMEQLASYGRKDRINSIMSVVTNTLVEELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELGLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKISQECKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDG-EMNNLQISVIRIKKGVAWAKVKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGVDIHRNGDFQKNGNGTTSGIGSSVEKYI-IDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGCVQRF-KCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVAVSLVSLIANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIDEVNNKTDC--EKLMEGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPDYEGNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLAR 1920          

HSP 2 Score: 344.739 bits (883), Expect = 3.755e-95
Identity = 198/398 (49.75%), Postives = 265/398 (66.58%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK---SFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNW------LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            ++  +D   +PN  LE GKSLP   GD    + L  +PL + DP+Y  ++TFVV+   KT+FRFS T A Y+LSP N IR+ AI++L H VFS +++ TI+ NCVFM  ++    S  VEY FT IYT E  +K I+RG  I+ FT+LRD WNWLDF VI +AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KCV    +FN + L       EN T    W    E+ NN+TN+      L+PL  C N +       CPEG+ C++    NPNYGYT+FD F  + L  FRLMTQDYWENLYQLT+R  G  ++++F++VIF GSFYL+N+ILA+VAM+Y++   A   E
Sbjct:   45 REDDEDSKPKPNSDLEAGKSLPFIYGDI--PQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSVFSMIIMCTILTNCVFMTFSNPPEWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMAYVTEFVD-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYL-------ENGTRGFDWE---EYINNKTNFYMVPGMLEPL-LCGNSSDA---GQCPEGFQCMKAGR-NPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEE 424          

HSP 3 Score: 78.5666 bits (192), Expect = 1.043e-13
Identity = 70/277 (25.27%), Postives = 118/277 (42.60%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV-----------NNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQ----------------------LNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K  A G       + +D W WLDF ++ +A V+  +         +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV            N T      E I NK    ++  M   +   NS                        +FD     +L LF++ T   W  +    + + G            Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  161 VEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMAYVTEFVD--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGFDWEEYINNKTNFYMVPGMLEPLLCGNSSDAGQCPEGFQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAG----------KTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQ 419          

HSP 4 Score: 69.3218 bits (168), Expect = 5.416e-11
Identity = 78/321 (24.30%), Postives = 143/321 (44.55%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTL-LYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTN---------GDIHI-LYFMMVIFFGSFYLINVILAIV 1439
            +RKT   ++ H  F   ++  I+++   +A        + +    +EY   VFT I+ LE  +K  + G +     +  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    K    FN T  + FE +E  N TD EK     E  N E  W       +N                             NFDN     L   ++ T   W ++    + +          G+I++ +YF++ I FGSF+ +N+ + ++
Sbjct: 1195 LRKTCFLIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFV----KFFTNAWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG----KYHYCFNETSEIRFEIDEVNNKTDCEKLM---EGNNTEIRW-------KNVK--------------------------INFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPDYEGNIYMYIYFVIFIIFGSFFTLNLFIGVI 1471          

HSP 5 Score: 65.4698 bits (158), Expect = 9.545e-10
Identity = 56/203 (27.59%), Postives = 93/203 (45.81%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF---------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLFGDKYSNFKNETL 2846
            KTF         F+F +  AL IL PF                 + I   I+ N V M+   P   PE +   K   Y FT  +  E+ +K+IA G       + ++ WN  DF +++++ V   +D   +S LR FR+LR  K   +   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF     N +N+ +
Sbjct:   92 KTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSVFSMIIMCTILTNCVFMTFSNP---PEWS---KNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMAYVTEFVDLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLF---MGNLRNKCV 282          
BLAST of scna-1 vs. Ensembl Mouse
Match: Scn8a (sodium channel, voltage-gated, type VIII, alpha [Source:MGI Symbol;Acc:MGI:103169])

HSP 1 Score: 908.672 bits (2347), Expect = 0.000e+0
Identity = 569/1239 (45.92%), Postives = 776/1239 (62.63%), Query Frame = 3
Query: 2184 ISEINQYIKNPELQSALSALS---IYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKV------QIRFAIKLSKEIFG-RCIVKKRKKLIKSHPMWNAH-------NIKCEKSYYELSVSNDVKIPEEQLS---NPELWFKYSLK---------ETEVPKFDEDPEINEVEIIYSTS-------------------------PEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGN---VSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVC-NKE------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTER 5702
            + ++  Y +   + S +S ++   + + E   RK          TF  W C P + K + +V LI++DPFV+L IT+CIV+NT+ M+++    +P+  H L   N  FT  F  E FLKLIA+ P  YFQE WN+FD  IV LSL+E+ L D  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      S +   PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF +++L   +DD  E N LQ ++ RI + + W KV      Q  F  + + E+     + +K+   I +H   + H       N     S    SV   + I E+ +S   NP L  +  +           TE    + DPE ++ ++  ++S                         P+ C      +   KC  V  E   G+ WW  R     +VEH +FETFII MI++SS  L  ED  +  R  ++  LE  DKVFT IF  EMLLKW A+G  K+F +AWCWLDF+IV ++LVSL+ + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GK++ C N  +  R   + + NK  C   K M GN   + W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS     QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  KI  I+F     Q FDI IM +I LN + M +E   Q ++++  L  IN VF++ FT E +LK+ A R YYF + WN+FDFV+VILSIV   +  ++    VSPT  RV+R+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFI++I GMS F+ V +   ID++FNFETFG +MI LFQI+TS GW+G+L  ++N  P    +KE      KG CG+  + + + +SY+IISFL+++NMYIA+ILENFS AT++  + L++DD++ FYE WE++D  A  FI    L DF + ++ PL +PKPN+++L  +++P+   D ++C+D+L   T+R LG   E D     + +        KV    ++ TL+R++E  +A V+ +  + +  R
Sbjct:  683 MEQLASYGRKDRINSIMSVVTNTLVEELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELGLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKISQECKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDG-EMNNLQISVIRIKKGVAWAKVKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGVDIHRNGDFQKNGNGTTSGIGSSVEKYI-IDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGCVQRF-KCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVAVSLVSLIANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIDEVNNKTDC--EKLMEGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPDYEGNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLAR 1910          

HSP 2 Score: 343.969 bits (881), Expect = 5.303e-95
Identity = 198/398 (49.75%), Postives = 265/398 (66.58%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK---SFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNW------LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            ++  +D   +PN  LE GKSLP   GD    + L  +PL + DP+Y  ++TFVV+   KT+FRFS T A Y+LSP N IR+ AI++L H VFS +++ TI+ NCVFM  ++    S  VEY FT IYT E  +K I+RG  I+ FT+LRD WNWLDF VI +AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KCV    +FN + L       EN T    W    E+ NN+TN+      L+PL  C N +       CPEG+ C++    NPNYGYT+FD F  + L  FRLMTQDYWENLYQLT+R  G  ++++F++VIF GSFYL+N+ILA+VAM+Y++   A   E
Sbjct:   45 REDDEDSKPKPNSDLEAGKSLPFIYGDI--PQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSVFSMIIMCTILTNCVFMTFSNPPEWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMAYITEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYL-------ENGTRGFDWE---EYINNKTNFYMVPGMLEPL-LCGNSSDA---GQCPEGFQCMKAGR-NPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEE 424          

HSP 3 Score: 77.7962 bits (190), Expect = 1.508e-13
Identity = 69/277 (24.91%), Postives = 119/277 (42.96%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV-----------NNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQ----------------------LNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K  A G       + +D W WLDF ++ +A ++  ++        +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV            N T      E I NK    ++  M   +   NS                        +FD     +L LF++ T   W  +    + + G            Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  161 VEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMAYITEFVN--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGFDWEEYINNKTNFYMVPGMLEPLLCGNSSDAGQCPEGFQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAG----------KTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQ 419          

HSP 4 Score: 69.3218 bits (168), Expect = 5.986e-11
Identity = 78/321 (24.30%), Postives = 143/321 (44.55%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTL-LYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTN---------GDIHI-LYFMMVIFFGSFYLINVILAIV 1439
            +RKT   ++ H  F   ++  I+++   +A        + +    +EY   VFT I+ LE  +K  + G +     +  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    K    FN T  + FE +E  N TD EK     E  N E  W       +N                             NFDN     L   ++ T   W ++    + +          G+I++ +YF++ I FGSF+ +N+ + ++
Sbjct: 1185 LRKTCFLIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFV----KFFTNAWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG----KYHYCFNETSEIRFEIDEVNNKTDCEKLM---EGNNTEIRW-------KNVK--------------------------INFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPDYEGNIYMYIYFVIFIIFGSFFTLNLFIGVI 1461          

HSP 5 Score: 62.7734 bits (151), Expect = 6.440e-9
Identity = 54/203 (26.60%), Postives = 93/203 (45.81%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF---------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLFGDKYSNFKNETL 2846
            KTF         F+F +  AL IL PF                 + I   I+ N V M+   P   PE +   K   Y FT  +  E+ +K+IA G       + ++ WN  DF +++++ +   ++   +S LR FR+LR  K   +   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF     N +N+ +
Sbjct:   92 KTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSVFSMIIMCTILTNCVFMTFSNP---PEWS---KNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMAYITEFVNLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLF---MGNLRNKCV 282          
BLAST of scna-1 vs. UniProt/SwissProt
Match: sp|Q15858|SCN9A_HUMAN (Sodium channel protein type 9 subunit alpha OS=Homo sapiens OX=9606 GN=SCN9A PE=1 SV=3)

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 593/1242 (47.75%), Postives = 787/1242 (63.37%), Query Frame = 3
Query: 2205 IKNPEL-QSALSALSIYD---AETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAI--------KLSKEIF-GRCIVKKRKKLIKSHP---MWNAHNIKCEKSYYE-LSVSNDVKIPEEQ-----LSNPELWFKYSLKETEVP---------KFDEDPEINEVEIIYSTS--------------------------PEDCLPNFISKLLR-KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEK--------GTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            + +P L Q A+S  SI      E +  +++    W      F  W C P + KF+  +  I++DPFV+L IT+CIV+NT+ M+++    + E  + L   N  FT  F  E  LKLIA+ P +YFQ  WN+FD +IV LSLVE+ L D  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      +     PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  ++M M++GNLV+LNLFLALLLSSF S++L   E+D  + N LQ A+ RI + I +VK  +R  I        K+S+EI     +  K++  I +H    M   HN   EK        S D  + E+      + NP L     +   E             D D E ++V +  S+S                          PE C  +    + R  C  V  E+  G++WWN R    K+VEH +FE+FI+LMI++SS  L  ED  +  +  +K+ LE  DK+FT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LV+LV + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY+C+N     R  A  +PN++ C  +  +  NV W+N ++NFDNV  GYL L QVATFKGW  IM  AVDS  +  QP Y +S   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK++GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  KI   IF +  NQ FDI IM +I LN + M +E   Q + +   L  IN VFI++FTGE +LKLI+ R YYF V WN+FDFV+VI+SIV   +  ++    VSPT  RV+R+ RIGRILRLVK AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     I+++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ +K        G CG+  + + Y +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D+  + + +        KV    ++ TLKR++E+ +A VI +  + Y  RL+QN K
Sbjct:  680 LNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVLNLFLALLLSSFSSDNLTAIEEDP-DANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEEAEAEPMNSDEPEACFTD--GCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCWLDFLIVDVSLVTLVANTLGYS--DLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNVRWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRY--RLRQNVK 1910          

HSP 2 Score: 332.413 bits (851), Expect = 1.643e-90
Identity = 182/374 (48.66%), Postives = 253/374 (67.65%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSF--NHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            +P+  LE GK LP   GD  P   +   PL +LDP+Y  K+TF+V+   KTIFRF+ T A Y+LSP +P+R+ +I++L H +FS L++ TI+ NC+FM  N+  D    VEY FT IYT E  +K ++RG  + EFT+LRD WNWLDF+VI  AYL  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC ++   N+  L    N  E+  D  K+     F+     +L+  +      ++  +  CPEGY C++    NP+YGYT+FD F  + L  FRLMTQDYWENLYQ T+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++
Sbjct:   48 KPSSDLEAGKQLPFIYGDIPP--GMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKY-----FY-----YLEGSKDALLCGFSTDSGQCPEGYTCVKIGR-NPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEE 407          

HSP 3 Score: 83.5741 bits (205), Expect = 1.890e-14
Identity = 70/274 (25.55%), Postives = 123/274 (44.89%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV-----NNDTFERI-----SAE--------IIPNKNACLIMKAMYGNVSWEN------------SQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K  A G       + +D W WLDF+++  A ++  ++        +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G   +KC      NN+T E I     S E        +  +K+A L   +       E                +FD     +L LF++ T   W  +    + + G            Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  155 VEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVN--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAG----------KTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQ 410          

HSP 4 Score: 64.6994 bits (156), Expect = 1.125e-8
Identity = 52/202 (25.74%), Postives = 97/202 (48.02%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPFVEL---------------FITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF-GD-KYSNFKN 2837
            KTF         F+F +  AL +L PF  L                I   I+ N + M+++ P +      + K   Y FT  +  E+ +K++A    +G   + ++ WN  DF++++ + +   ++   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF G+ K+  F+N
Sbjct:   86 KTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNPPD------WTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRAL---KTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRN 278          

HSP 5 Score: 60.8474 bits (146), Expect = 1.675e-7
Identity = 73/335 (21.79%), Postives = 142/335 (42.39%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWE-NLYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            IRKT  +++ H  F   ++  I+++   +A        K +    +EY   +FT I+ LE  +K I+ G      TY  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    +C+                N TD  ++        N +     +   QN  +                          NFDN  +  L   ++ T   W   +Y      N D            +YF++ I FGSF+ +N+ + ++  +++  +  +  ++
Sbjct: 1181 IRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYK----TYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY-ECI----------------NTTDGSRFPASQ--VPNRSECFALMNVSQNVRWKNLK---------------------VNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQD 1471          
BLAST of scna-1 vs. UniProt/SwissProt
Match: sp|O08562|SCN9A_RAT (Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1)

HSP 1 Score: 935.25 bits (2416), Expect = 0.000e+0
Identity = 584/1244 (46.95%), Postives = 791/1244 (63.59%), Query Frame = 3
Query: 2205 IKNPEL-QSALSALSIYD---AETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIR-FAIK-LSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYS-LKETEVPKFDEDPEI----------NEVEIIYS------------------TSPEDC------LPN-----------------FISKLLRK--CYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEK--------GTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            + +P L Q A+S  SI      E +  +++    W     TF  W C P + KF+ L+  I++DPFV+L IT+CIV+NT+ M+++    + E  + L   N  FT  F  E  LKLIA+ P +YFQ  WN+FD +IV LSL+E+ L D  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      +     PRW+ NDF HSF+IVFRVLCGEWIE+MWDCM V G   C+  ++M M++GNLV+LNLFLALLLSSF S++L   E+D+ + N LQ A+ RI R I +VK  +R F +K  SK+  G    K+      + P     N    ++  E+S  ++    ++++S        S + E +   F  +P +          +++EI+ +                  +S  +C      LP                  F    +R+  C  V  ++  G++WW  R    ++VEH +FE+FI+LMI++SS  L  ED  +  +  +K+ LE  DK+FT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LV+LV + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY+CVN     R     + N++ C  +  + GNV W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS  +  QP Y +S   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK++GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  K    IF +  NQ FDI IM +I LN + M +E   Q E +   L  IN VFI++FTGE +LKLI+ R YYF V WN+FDFV+VILSIV   +  M+    VSPT  RV+R+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     I+++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ +K        G CG+  + + Y +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D+  + + +        KV    ++ TLKR++E  +A +I +  + Y  RL+Q+ K
Sbjct:  679 LNDPHLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHTFLIWNCSPYWIKFKKLIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAVGNLIFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLIELFLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKINVDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLIVYMMVMVIGNLVVLNLFLALLLSSFSSDNLTAIEEDT-DANNLQIAVARIKRGINYVKQTLREFILKSFSKKPKGSKDTKR-----TADPNNKKENYISNRTLAEMSKDHNFLKEKDRISGYGSSLDKSFMDENDYQSFIHNPSLTVTVPIAPGESDLEIMNTEELSSDSDSDYSKEKRNRSSSSECSTVDNPLPGEEEAEAEPVNADEPEACFTDGCVRRFPCCQVNVDSGKGKVWWTIRKTCYRIVEHSWFESFIVLMILLSSGALAFEDIYIEKKKTIKIILEYADKIFTYIFILEMLLKWVAYGYKTYFTNAWCWLDFLIVDVSLVTLVANTLGY--SDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECVNTTDGSRFPTSQVANRSECFALMNVSGNVRWKNLKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSVNVNEQPKYEYSLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGCIFDLVTNQAFDITIMVLICLNMVTMMVEKEGQTEYMDYVLHWINMVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVILSIVGMFLAEMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEAGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGEGGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEEVSATIIQRAYRRY--RLRQHVK 1908          

HSP 2 Score: 328.946 bits (842), Expect = 1.812e-89
Identity = 180/375 (48.00%), Postives = 252/375 (67.20%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK---SFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            +P+  LE GK LP   GD  P   +   PL +LDP+Y  K+TF+V+   K IFRF+ T A Y+LSP +P+R+ +I++L H +FS L++ TI+ NC+FM  ++  +    VEY FT IYT E  IK ++RG  + EFT+LRD WNWLDF+VI  AYL  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC +     N TL         N  ++E+   KY ++      L+  +      ++  +  CPEGY+C++    NP+YGYT+FD F  + L  FRLMTQDYWENLYQ T+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++
Sbjct:   48 KPSSDLEAGKQLPFIYGDIPP--GMVSEPLEDLDPYYADKKTFIVLNKGKAIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTLSNPPEWTKNVEYTFTGIYTFESLIKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRKELEENETL-----ESIMNTAESEEELKKYFYY------LEGSKDALLCGFSTDSGQCPEGYICVKAGR-NPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEE 407          

HSP 3 Score: 82.8037 bits (203), Expect = 3.551e-14
Identity = 67/274 (24.45%), Postives = 119/274 (43.43%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVNNDTFERISAEIIPN------------------KNACLIMKAMYGNVSWEN------------SQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K  A G       + +D W WLDF+++  A ++  ++        +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G   +KC   +  E  + E I N                  K+A L   +       E                +FD     +L LF++ T   W  +    + + G            Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  155 VEYTFTGIYTFESLIKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVN--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRKELEENETLESIMNTAESEEELKKYFYYLEGSKDALLCGFSTDSGQCPEGYICVKAGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAG----------KTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQ 410          

HSP 4 Score: 65.0846 bits (157), Expect = 8.237e-9
Identity = 54/203 (26.60%), Postives = 97/203 (47.78%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPFVEL---------------FITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF-GD-KYSNFKNE 2840
            KTF         F+F +  AL +L PF  L                I   I+ N + M++  P   PE   + K   Y FT  +  E+ +K++A    +G   + ++ WN  DF++++ + +   ++   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF G+ K+  F+ E
Sbjct:   86 KTFIVLNKGKAIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTLSNP---PE---WTKNVEYTFTGIYTFESLIKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRAL---KTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRKE 279          

HSP 5 Score: 62.3882 bits (150), Expect = 5.070e-8
Identity = 77/337 (22.85%), Postives = 148/337 (43.92%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVF-SFLVLTTIIINCVFMAKNSNSDT-------VEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYG--YTNFDNFIVSLLCAFRLMTQDYWEN-LYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            IRKT  R++ H  F SF+VL  ++ +     ++   +        +EY   +FT I+ LE  +K ++ G      TY  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    +CV                N TD  ++               P  Q  N       + C      +   +GN  +     NFDN  +  L   ++ T   W + +Y      N +            +YF++ I FGSF+ +N+ + ++  +++  +  +  ++
Sbjct: 1179 IRKTCYRIVEHSWFESFIVLMILLSSGALAFEDIYIEKKKTIKIILEYADKIFTYIFILEMLLKWVAYGYK----TYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY-ECV----------------NTTDGSRF---------------PTSQVAN------RSEC----FALMNVSGNVRWKNLKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSVNVNEQPKYEYSLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQD 1469          
BLAST of scna-1 vs. UniProt/SwissProt
Match: sp|Q99250|SCN2A_HUMAN (Sodium channel protein type 2 subunit alpha OS=Homo sapiens OX=9606 GN=SCN2A PE=1 SV=3)

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 574/1204 (47.67%), Postives = 766/1204 (63.62%), Query Frame = 3
Query: 2319 WTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIK--CEKSYYELSVSNDVKIPEEQ------------------------LSNPELWFKYSLKETE-------VPKFDEDPEINEV-EIIYSTS---------------------PEDCL---PNFISKLLR--KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            W CC  + K + LV L+++DPFV+L IT+CIV+NT+ M+++    + + +  L   N  FT  F  E FLK+IA+ P  YFQE WN+FD  IV LSL+E+ L +  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      S     PRW+ +DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF S++L   +DD NE N LQ A+ R+ + I +VK +IR       E   +  V+K+K L +  P+ + +N K  C  ++  + +  D+   ++                         ++NP L     +   E         +F  + ++ E  E + +TS                     PE+ L     F    +R  KC  +  E   G+LWWN R    K+VEH +FETFI+ MI++SS  L  ED  +  R  +K  LE  DKVFT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LVSL  + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY C+N  T E     ++ N + C  +        W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS  +  QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  K   ++F     Q FDI IM +I LN + M +E  DQ +++   L  IN VFIV+FTGE +LKLI+ R+YYF + WN+FDFV+VILSIV   +  ++    VSPT  RV+R+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ +        KG CG+  + + + +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF + +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D     + +        KV    ++ TLKR++E  +A +I +  + Y   LKQ  K
Sbjct:  739 WDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDD-NEMNNLQIAVGRMQKGIDFVKRKIR-------EFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPDKDHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYL--LKQKVK 1926          

HSP 2 Score: 338.961 bits (868), Expect = 1.590e-92
Identity = 192/403 (47.64%), Postives = 264/403 (65.51%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK------SFNHTLLYFEPNEFENLTDAEKWTVKY----EFFNNETNWLDPLRQCQNYTYNEWNTS----CPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            K + D+   +PN  LE GKSLP   GD  P  ++  +PL +LDP+Y  K+TF+V+   K I RFS T A Y+L+P NPIRK AI++L H +F+ L++ TI+ NCVFM  ++  D    VEY FT IYT E  IK ++RG  + +FT+LRD WNWLDF VI  AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC++      SF   +  F  N  +        TV      E+  +++++     + QN      N+S    CPEGY+C++    NPNYGYT+FD F  + L  FRLMTQD+WENLYQLT+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++   A   E
Sbjct:   42 KDEDDENGPKPNSDLEAGKSLPFIYGDIPP--EMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRKLAIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVD-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFY--FLEGQNDALLCGNSSDAGQCPEGYICVKAGR-NPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEE 438          

HSP 3 Score: 77.7962 bits (190), Expect = 1.141e-12
Identity = 46/140 (32.86%), Postives = 78/140 (55.71%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV----NNDTFE 4076
            ++  FT I+T E L+K  A G       + +D W WLDF ++T A V+  +         +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KC+    +N +FE
Sbjct:  158 VEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVD--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFE 289          

HSP 4 Score: 62.003 bits (149), Expect = 6.933e-8
Identity = 53/203 (26.11%), Postives = 90/203 (44.33%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF---------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLFGDKYSNFKNETL 2846
            KTF          +F +  AL IL PF                 + I   I+ N V M++  P +      + K   Y FT  +  E+ +K++A G       + ++ WN  DF ++  + V   +D   +S LR FR+LR  K   +   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF     N +N+ L
Sbjct:   89 KTFIVLNKGKAISRFSATPALYILTPFNPIRKLAIKILVHSLFNMLIMCTILTNCVFMTMSNPPD------WTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLF---MGNLRNKCL 279          

HSP 5 Score: 60.8474 bits (146), Expect = 1.478e-7
Identity = 77/318 (24.21%), Postives = 141/318 (44.34%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCV-----KSFNHTLL--YFEPNEFENLTDAEKW-TVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIV 1439
            +RKT  +++ H  F   ++  I+++   +A        + +    +EY   VFT I+ LE  +K ++ G  +    Y  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV ALL A+  + + +++ +    IF ++G+ L+ G     C+     + F+ +++  Y E           +W  VK  F N    +L  L   Q  T+  W                  +  Y   D+  V L          Y +NLY            LYF++ I FGSF+ +N+ + ++
Sbjct: 1197 LRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQV----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYH-CINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLL---QVATFKGWM-----------------DIMYAAVDSRNVEL-------QPKYEDNLYMY----------LYFVIFIIFGSFFTLNLFIGVI 1472          
BLAST of scna-1 vs. UniProt/SwissProt
Match: sp|B1AWN6|SCN2A_MOUSE (Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1)

HSP 1 Score: 929.858 bits (2402), Expect = 0.000e+0
Identity = 575/1204 (47.76%), Postives = 764/1204 (63.46%), Query Frame = 3
Query: 2319 WTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIK--CEKSYYELSVSNDVKIPEEQ------------------------LSNPELWFKYSLKETE-------VPKFDEDPEINEV-EIIYSTS---------------------PEDCL---PNFISKLLR--KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            W CC  + K + +V L+++DPFV+L IT+CIV+NT+ M+++    + + +  L   N  FT  F  E FLK+IA+ P  YFQE WN+FD  IV LSL+E+ L +  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      S     PRW+ +DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF S++L   +DD NE N LQ A+ R+ + I +VK +IR       E   +  V+K+K L +  P+ + +N K  C  ++  + +  D+   ++                         ++NP L     +   E         +F  + ++ E  E + +TS                     PE+ L     F    +R  KC  +  E   G+LWWN R    K+VEH +FETFI+ MI++SS  L  ED  +  R  +K  LE  DKVFT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LVSL  + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY C+N  T E     ++ N + C  +        W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS  +  QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  K   ++F     Q FDI IM +I LN + M +E  DQ +++   L  IN VFIV+FTGE +LKLI+ R YYF + WN+FDFV+VILSIV   +  ++    VSPT  RV+R+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ E        KG CG+  + + + +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D     + +        KV    ++ TLKR++E  +A VI +  + Y   LKQ  K
Sbjct:  740 WDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDD-NEMNNLQIAVGRMQKGIDFVKRKIR-------EFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYL--LKQKVK 1927          

HSP 2 Score: 335.88 bits (860), Expect = 1.300e-91
Identity = 193/404 (47.77%), Postives = 263/404 (65.10%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK--SFNHTLLYFEPNEFENLTDAEKWT-VKYEFFNNETNWLDPLRQCQNYTYNEW--------NTS----CPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            K + D+   +PN  LE GKSLP   GD  P  ++   PL +LDP+Y  K+TF+V+   K I RFS T A Y+L+P NPIRK AI++L H +F+ L++ TI+ NCVFM  ++  D    VEY FT IYT E  IK ++RG  + +FT+LRD WNWLDF VI  AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC++    N T   FE N      ++  W    +    N  NW + +    ++ + E         N+S    CPEGY+C++    NPNYGYT+FD F  + L  FRLMTQD+WENLYQLT+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++   A   E
Sbjct:   42 KDEDDENGPKPNSDLEAGKSLPFIYGDIPP--EMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNST---FEINITSFFNNSLDWNGTAFNRTMNMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGR-NPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEE 438          

HSP 3 Score: 79.337 bits (194), Expect = 4.299e-13
Identity = 47/140 (33.57%), Postives = 79/140 (56.43%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV----NNDTFE 4076
            ++  FT I+T E L+K  A G       + +D W WLDF ++T A V+  ++        +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KC+    +N TFE
Sbjct:  158 VEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVN--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFE 289          

HSP 4 Score: 61.2326 bits (147), Expect = 1.168e-7
Identity = 74/320 (23.12%), Postives = 143/320 (44.69%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLY---------QLTIRTNGDIHI-LYFMMVIFFGSFYLINVILAIV 1439
            +RKT  +++ H  F   ++  I+++   +A        + +    +EY   VFT I+ LE  +K ++ G  +    Y  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV ALL A+  + + +++ +    IF ++G+ L+ G         F H +         N T  E + V     NN +       +CQ    +               +T        NFDN  +  L   ++ T   W ++          +L  +   ++++ LYF++ I FGSF+ +N+ + ++
Sbjct: 1198 LRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQM----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG--------KFYHCI---------NYTTGEMFDVS--VVNNYS-------ECQALIES--------------NQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1473          

HSP 5 Score: 59.6918 bits (143), Expect = 3.260e-7
Identity = 52/203 (25.62%), Postives = 90/203 (44.33%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF---------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLFGDKYSNFKNETL 2846
            KTF          +F +  AL IL PF                 + I   I+ N V M++  P +      + K   Y FT  +  E+ +K++A G       + ++ WN  DF ++  + V   ++   +S LR FR+LR  K   +   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF     N +N+ L
Sbjct:   89 KTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPD------WTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVNLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLF---MGNLRNKCL 279          
BLAST of scna-1 vs. UniProt/SwissProt
Match: sp|P04775|SCN2A_RAT (Sodium channel protein type 2 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn2a PE=1 SV=1)

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 584/1247 (46.83%), Postives = 783/1247 (62.79%), Query Frame = 3
Query: 2205 IKNPELQSALSALSIYD---AETKVRKKELIKQWL-LKTFCS-WTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIK--CEKSYYELSVSNDVKIPEEQ------------------------LSNPELWFKY--SLKETE-----VPKFDEDPEINEV-EIIYSTS---------------------PEDCL---PNFISKLLR--KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRK 5720
            +++P  Q A+S  SI      E +  +++    W      C  W CC  + K + +V L+++DPFV+L IT+CIV+NT+ M+++    + + +  L   N  FT  F  E FLK+IA+ P  YFQE WN+FD  IV LSL+E+ L +  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      S     PRW+ + F HSF+IVFRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF S++L   +DD NE N LQ A+ R+ + I +VK +IR       E   +  V+K+K L +  P+ + +N K  C  ++  + +  D+   ++                         ++NP L      +L E++       +F  + ++ E  E + +TS                     PE+ L     F    +R  KC  +  E   G+LWWN R    K+VEH +FETFI+ MI++SS  L  ED  +  R  +K  LE  DKVFT IF  EMLLKW A+G   YF +AWCWLDF+IV ++LVSL  + +G     +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY C+N  T E     ++ N + C  +        W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS  +  QP Y  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK+ GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP  K   ++F     Q FDI IM +I LN + M +E  DQ +++   L  IN VFIV+FTGE +LKLI+ R YYF + WN+FDFV+VILSIV   +  ++    VSPT  RV+R+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+G+L  ++N  P  C+ E        KG CG+  + + + +SY+IISFLV++NMYIAVILENFS AT++  E L++DD+++FYE WE++D  A  FI    L DF   +D PL I KPN VQL  +++P+   D ++C+D+L   T+R LG+  E D     + +        KV    ++ TLKR++E  +A VI +  + Y   LKQ  K
Sbjct:  696 LEDPSRQRAMSMASILTNTMEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY---KECVCKISNDCELPRWHMHHFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDD-NEMNNLQIAVGRMQKGIDFVKRKIR-------EFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVTVPIALGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYL--LKQKVK 1926          

HSP 2 Score: 333.954 bits (855), Expect = 6.054e-91
Identity = 190/406 (46.80%), Postives = 263/406 (64.78%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK-------------SFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTS----CPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            K + D+   +PN  LE GKSLP   GD  P  ++   PL +LDP+Y  K+TF+V+   K I RFS T A Y+L+P NPIRK AI++L H +F+ L++ TI+ NCVFM  ++  D    VEY FT IYT E  IK ++RG  + +FT+LR+ WNWLDF VI  AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC++             SF +  L +    F    +   W    E+  +++++     + QN      N+S    CPEGY+C++    NPNYGYT+FD F  + L  FRLMTQD+WENLYQLT+R  G  ++++F++VIF GSFYLIN+ILA+VAM+Y++   A   E
Sbjct:   42 KDEDDENGPKPNSDLEAGKSLPFIYGDIPP--EMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRNPWNWLDFTVITFAYVTEFVN-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFEINITSFFNNSLDWNGTAFNRTVNMFNWD---EYIEDKSHFY--FLEGQNDALLCGNSSDAGQCPEGYICVKAGR-NPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEE 438          

HSP 3 Score: 77.411 bits (189), Expect = 1.695e-12
Identity = 46/140 (32.86%), Postives = 79/140 (56.43%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV----NNDTFE 4076
            ++  FT I+T E L+K  A G       + ++ W WLDF ++T A V+  ++        +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KC+    +N TFE
Sbjct:  158 VEYTFTGIYTFESLIKILARGFCLEDFTFLRNPWNWLDFTVITFAYVTEFVN--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFE 289          

HSP 4 Score: 61.2326 bits (147), Expect = 1.348e-7
Identity = 74/320 (23.12%), Postives = 143/320 (44.69%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLY---------QLTIRTNGDIHI-LYFMMVIFFGSFYLINVILAIV 1439
            +RKT  +++ H  F   ++  I+++   +A        + +    +EY   VFT I+ LE  +K ++ G  +    Y  +AW WLDF+++ ++ +        +  LG + +LR+LR LR L+ ++   GM+ VV ALL A+  + + +++ +    IF ++G+ L+ G         F H +         N T  E + V     NN +       +CQ    +               +T        NFDN  +  L   ++ T   W ++          +L  +   ++++ LYF++ I FGSF+ +N+ + ++
Sbjct: 1197 LRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQM----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG--------KFYHCI---------NYTTGEMFDVS--VVNNYS-------ECQALIES--------------NQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1472          

HSP 5 Score: 58.9214 bits (141), Expect = 6.178e-7
Identity = 52/203 (25.62%), Postives = 89/203 (43.84%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF---------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLFGDKYSNFKNETL 2846
            KTF          +F +  AL IL PF                 + I   I+ N V M++  P +      + K   Y FT  +  E+ +K++A G       + +  WN  DF ++  + V   ++   +S LR FR+LR  K   +   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF     N +N+ L
Sbjct:   89 KTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPD------WTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRNPWNWLDFTVITFAYVTEFVNLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLF---MGNLRNKCL 279          
BLAST of scna-1 vs. TrEMBL
Match: A0A1I8HM84 (Sodium channel protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 1752.26 bits (4537), Expect = 0.000e+0
Identity = 1031/1904 (54.15%), Postives = 1295/1904 (68.01%), Query Frame = 3
Query:  348 KEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWT----------VKYEFFNNETNWL---DPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDXXXXXXXX--------XXXXXIIDRIDEELGVESSEDLNYQNPVRP-----NSKDGWSIQSYVRKQSLIKSGLND-------EFNSKSYQVSNVD-IESEPRFSICDYDSTDRNLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPRS---------------IAVGKR------IVGSLSSFSPMLDERSSKSYLD----------PNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFC-SWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVK-------------------KRKKL---------------IKSHPMWNAHNIKCEKSYY------ELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAG-GMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCN---KEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIG---KVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNR 5717
            + PNP+L  G  LP +L D F  K+L G  L ++D +Y  K TFVV++ DKTIFRFS T A +LLSP NPIR+ AIR+LTHP FS LVL  II NCVFMA+NS+S+ VEY FT IYT E TIKAISRGLI+ EFTYLRDAWNWLDFIVIGLAY+MFF P LGNLSALRSLRVLRALKTVTTVPG+KT+VGAL+EAVK+LRD  +LT+F+LSIF L+GLQ+Y+GTLL+KCV  FN T    E  ++E + +A + T          V+    NNE+NWL   D LR C     ++    CPEG+ C +T   NPN+GYTNFDNF  S+LCAFRLMTQD WE+LYQL IRTNG  H+++F++VI  GSF+LINVILAIVAM+YD+VR   + +E  +EA RK+++             I     +E+   S  D+ Y+    P      S D  SI+S   +   +++ ++        +  SKS  +     I+ + RF     D T  N+  T             I F YAD  +S A TP    S R                 A   R      ++G +++    L+ R  K  L           P +L    ++  G+    E+ G   I++  SQ   R  +        +E   +N  + +K   +D             PE +         +   K +K E  K   L+ FC SW CC C+   +  V+  ILDPFVELFITLCI++NT  M++D P N+P     L  AN FFT TFG+EA  KLIA+ P+ YF++ WN+FDF IV+LS VE+ L +  G+S+LRAFRLLRVFKLAKSWQTMNLLF II  T+GA+GNL  VLGIIIFIFAVVGMQLFG+ Y+ +KNETL+P FKG  PRWNF DFTHSFMIVFRVLCGEWIESMW C+ VNGY CVPFFL+T IL +LV+L+LFLALLLSSFG+ESLQ+RE++  E NKLQEAIDRI R IVW ++ I+   +L   + G+   +                   K K                 +K H  +   N+    S        E S+ +D     +    P   F  ++++   PKFDE+PEINEV+I Y  +PEDCLP  +     +   +   T  G++WW  RC+A KLVEH++FE FIILMI +SS+TLTLED NLP RP LKL LE +DK FTIIFT EM++KWFAFGL KYFKDAWCWLDF+IV +AL SLVL+ +G  +G  MGAFKAMRTLRALRPLRAVSRWEGM++VVNALIQAIPSIFNVLLVCLVFWLIFSI+G+QLFGG+FYKCV+++  ER+SA+++PNK AC  M A + NVSWENS++NFDN LNGYL LFQ+AT+KGWI I+ADAVD TG  NQP  + ST  Y +FV FIIFG+FFTL LFIGVIIDNFNVQKKR GGS+E+FMTEDQK+YY AMKKMSSTAPQKP+P+PKL+I    F +  +QKFDI IM  IMLNTIVMCIEH +Q E    A++QIN+ FIVIFTGE ++KL+AQRWYYFK  WNMFDFVIV+LSI+ WAIE ++  +P+ PT IRVVRVFR+GR+LRLVKSA+GIRTLLFSL VSLPAL NI LLL MIMFIY+IVG+SFFS+V +   IDE+FNFETF   M++LFQ+STS GW+ VL+GL+NE+   CN   K    CG+Y IAVV+LISYL+ISFLVIINMYIAVILENFSQAT+DVQ+GLTQ+D+DLFYE WE YD KA+GFI++  + +F+++++ PL +P+PN ++LA L +PIC+ DT++CVDLL+ LTR FLG   +    E  L+ LKP  K G   K E+II+SNT++RQR+ +AA VI +Y++AY  + K+ R
Sbjct:   84 RRPNPKLAAGMKLPPALSDKFSAKRLGGALLEDIDDYYGDKFTFVVVSRDKTIFRFSATNALFLLSPFNPIRRVAIRILTHPAFSMLVLLAIICNCVFMAQNSSSEAVEYTFTAIYTTEATIKAISRGLILTEFTYLRDAWNWLDFIVIGLAYIMFFVPTLGNLSALRSLRVLRALKTVTTVPGLKTIVGALMEAVKRLRDVGILTIFVLSIFALVGLQVYKGTLLQKCVSKFNFT----EYLDYEYMGNASELTSDELKDLKDQVRKIHHNNESNWLGYPDELRVCS--LNSDLGQQCPEGFECFRTDKVNPNFGYTNFDNFGWSMLCAFRLMTQDAWESLYQLIIRTNGTPHVVFFVLVIMMGSFFLINVILAIVAMAYDEVRKQDKLDEEEEEAARKQEDERREQEEQVKEASIEKSFSDEVSCLSITDI-YKAAGIPLESAKKSLDKLSIRSDKIEGGPVRTPISSYISKHFLKHKSKSVSLPGSPCIKHKDRFHWKPSDCTQVNVLET-------------ISFPYAD--DSAAHTPASDASAREQRDSFNSKFKYFALFSAFANRQPTKTDLLGKIANSKSPLESRKYKDILMCTRNGSDKPIPEILLQEETKQPGVLDHKELLG---IRKTQSQRTLRETTSQPPAGQEVE---MNDVVVLKTLIED--------AATTKPEKEEV-------ECRPKEKKFEHYKHLFLEKFCYSWECCYCWKVLEKYVSYFILDPFVELFITLCILVNTACMALDVPSNTPTFKEILSNANLFFTATFGIEAVCKLIAMKPQVYFKDGWNIFDFTIVVLSFVELTLQNVQGLSILRAFRLLRVFKLAKSWQTMNLLFAIIARTMGALGNLVFVLGIIIFIFAVVGMQLFGENYALYKNETLYPEFKGDYPRWNFKDFTHSFMIVFRVLCGEWIESMWGCINVNGYICVPFFLLTNILASLVVLSLFLALLLSSFGAESLQRREEEE-EVNKLQEAIDRINRFIVWSRIHIK---RLFWYLVGKACTRSYNDNDLFESDDADDSSEDKAKPASGKDRISIQLDSRFPLKQHGTYIMENVTIAASQMVFKDINEASILSDAAGANQNKVFPAGHFAIAIEDKLSPKFDEEPEINEVDIQYWDAPEDCLPKQLMDFCPRAVQLCDNTNLGKIWWGFRCRAYKLVEHKYFEMFIILMIALSSVTLTLEDVNLPKRPKLKLVLEYMDKCFTIIFTFEMVVKWFAFGLKKYFKDAWCWLDFVIVNVALFSLVLNLVGGASGQNMGAFKAMRTLRALRPLRAVSRWEGMKVVVNALIQAIPSIFNVLLVCLVFWLIFSIMGVQLFGGQFYKCVDSNN-ERVSADLVPNKEACEAMAAAFHNVSWENSRINFDNFLNGYLALFQIATYKGWIPIIADAVDITGPNNQPIRDASTSMYLFFVLFIIFGSFFTLKLFIGVIIDNFNVQKKRAGGSVELFMTEDQKRYYKAMKKMSSTAPQKPVPKPKLRIPQFFFKVINDQKFDIAIMVFIMLNTIVMCIEHHNQSEAFNDAVEQINRFFIVIFTGECVMKLLAQRWYYFKFAWNMFDFVIVVLSILTWAIEDIMVRLPIPPTMIRVVRVFRVGRVLRLVKSARGIRTLLFSLFVSLPALFNIGLLLFMIMFIYSIVGISFFSHVRHRSGIDEIFNFETFPSGMVVLFQLSTSAGWDSVLDGLINEEEPDCNPNKKPHSDCGNYAIAVVFLISYLVISFLVIINMYIAVILENFSQATEDVQQGLTQEDFDLFYEKWESYDPKAKGFIAVDQVYEFLDELEPPLQLPQPNKIKLATLSVPICKGDTIFCVDLLDALTRNFLGTAAD----EEELSALKP--KGGGKLKDERIIISNTMERQRQKYAANVITRYVRAYAAKCKERR 1933          
BLAST of scna-1 vs. TrEMBL
Match: A0A1I8HQ99 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1559.27 bits (4036), Expect = 0.000e+0
Identity = 936/1770 (52.88%), Postives = 1164/1770 (65.76%), Query Frame = 3
Query:  348 KEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWT----------VKYEFFNNETNWL---DPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDXXXXXXXX--------XXXXXIIDRIDEELGVESSEDLNYQNPVRP-----NSKDGWSIQSYVRKQSLIKSGLND-------EFNSKSYQVSNVD-IESEPRFSICDYDSTDRNLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPRS---------------IAVGKR------IVGSLSSFSPMLDERSSKSYLD----------PNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFC-SWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVK-------------------KRKKL---------------IKSHPMWNAHNIKCEKSYY------ELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAG-GMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCN---KEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYD 5324
            + PNP+L  G  LP +L D F  K+L G  L ++D +Y  K TFVV++ DKTIFRFS T A +LLSP NPIR+ AIR+LTHP FS LVL  II NCVFMA+NS+S+ VEY FT IYT E TIKAISRGLI+ EFTYLRDAWNWLDFIVIGLAY+MFF P LGNLSALRSLRVLRALKTVTTVPG+KT+VGAL+EAVK+LRD  +LT+F+LSIF L+GLQ+Y+GTLL+KCV  FN T    E  ++E + +A + T          V+    NNE+NWL   D LR C     ++    CPEG+ C +T   NPN+GYTNFDNF  S+LCAFRLMTQD WE+LYQL IRTNG  H+++F++VI  GSF+LINVILAIVAM+YD+VR   + +E  +EA RK+++             I     +E+   S  D+ Y+    P      S D  SI+S   +   +++ ++        +  SKS  +     I+ + RF     D T  N+  T             I F YAD  +S A TP    S R                 A   R      ++G +++    L+ R  K  L           P +L    ++  G+    E+ G   I++  SQ   R  +        +E   +N  + +K   +D             PE +         +   K +K E  K   L+ FC SW CC C+   +  V+  ILDPFVELFITLCI++NT  M++D P N+P     L  AN FFT TFG+EA  KLIA+ P+ YF++ WN+FDF IV+LS VE+ L +  G+S+LRAFRLLRVFKLAKSWQTMNLLF II  T+GA+GNL  VLGIIIFIFAVVGMQLFG+ Y+ +KNETL+P FKG  PRWNF DFTHSFMIVFRVLCGEWIESMW C+ VNGY CVPFFL+T IL +LV+L+LFLALLLSSFG+ESLQ+RE++  E NKLQEAIDRI R IVW ++ I+   +L   + G+   +                   K K                 +K H  +   N+    S        E S+ +D     +    P   F  ++++   PKFDE+PEINEV+I Y  +PEDCLP  +     +   +   T  G++WW  RC+A                                   WL   LE +DK FTIIFT EM++KWFAFGL KYFKDAWCWLDF+IV +AL SLVL+ +G  +G  MGAFKAMRTLRALRPLRAVSRWEGM++VVNALIQAIPSIFNVLLVCLVFWLIFSI+G+QLFGG+FYKCV+++  ER+SA+++PNK AC  M A + NVSWENS++NFDN LNGYL LFQ+AT+KGWI I+ADAVD TG  NQP  + ST  Y +FV FIIFG+FFTL LFIGVIIDNFN    R GGS+E+FMTEDQK+YY AMKKMSSTAPQKP+P+PKL+I    F +  +QKFDI IM  IMLNTIVMCIEH +Q E    A++QIN+ FIVIFTGE ++KL+AQRWYYFK  WNMFDFVIV+LSI+ WAIE ++  +P+ PT IRVVRVFR+GR+LRLVKSA+GIRTLLFSL VSLPAL NI LLL MIMFIY+IVG+SFFS+V +   IDE+FNFETF   M++LFQ+STS GW+ VL+GL+NE+   CN   K    CG+Y IAVV+LISYL+ISFLVIINMYIAVILENFSQAT+DVQ+GLTQ+D+D
Sbjct:   84 RRPNPKLAAGMKLPPALSDKFSAKRLGGALLEDIDDYYGDKFTFVVVSRDKTIFRFSATNALFLLSPFNPIRRVAIRILTHPAFSMLVLLAIICNCVFMAQNSSSEAVEYTFTAIYTTEATIKAISRGLILTEFTYLRDAWNWLDFIVIGLAYIMFFVPTLGNLSALRSLRVLRALKTVTTVPGLKTIVGALMEAVKRLRDVGILTIFVLSIFALVGLQVYKGTLLQKCVSKFNFT----EYLDYEYMGNASELTSDELKDLKDQVRKIHHNNESNWLGYPDELRVCS--LNSDLGQQCPEGFECFRTDKVNPNFGYTNFDNFGWSMLCAFRLMTQDAWESLYQLIIRTNGTPHVVFFVLVIMMGSFFLINVILAIVAMAYDEVRKQDKLDEEEEEAARKQEDERREQEEQVKEASIEKSFSDEVSCLSITDI-YKAAGIPLESAKKSLDKLSIRSDKIEGGPVRTPISSYISKHFLKHKSKSVSLPGSPCIKHKDRFHWKPSDCTQVNVLET-------------ISFPYAD--DSAAHTPASDASAREQRDSFNSKFKYFALFSAFANRQPTKTDLLGKIANSKSPLESRKYKDILMCTRNGSDKPIPEILLQEETKQPGVLDHKELLG---IRKTQSQRTLRETTSQPPAGQEVE---MNDVVVLKTLIED--------AATTKPEKEEV-------ECRPKEKKFEHYKHLFLEKFCYSWECCYCWKVLEKYVSYFILDPFVELFITLCILVNTACMALDVPSNTPTFKEILSNANLFFTATFGIEAVCKLIAMKPQVYFKDGWNIFDFTIVVLSFVELTLQNVQGLSILRAFRLLRVFKLAKSWQTMNLLFAIIARTMGALGNLVFVLGIIIFIFAVVGMQLFGENYALYKNETLYPEFKGDYPRWNFKDFTHSFMIVFRVLCGEWIESMWGCINVNGYICVPFFLLTNILASLVVLSLFLALLLSSFGAESLQRREEEE-EVNKLQEAIDRINRFIVWSRIHIK---RLFWYLVGKACTRSYNDNDLFESDDADDSSEDKAKPASGKDRISIQLDSRFPLKQHGTYIMENVTIAASQMVFKDINEASILSDAAGANQNKVFPAGHFAIAIEDKLSPKFDEEPEINEVDIQYWDAPEDCLPKQLMDFCPRAVQLCDNTNLGKIWWGFRCRAHT--------------------------------SWLNTILEYMDKCFTIIFTFEMVVKWFAFGLKKYFKDAWCWLDFVIVNVALFSLVLNLVGGASGQNMGAFKAMRTLRALRPLRAVSRWEGMKVVVNALIQAIPSIFNVLLVCLVFWLIFSIMGVQLFGGQFYKCVDSNN-ERVSADLVPNKEACEAMAAAFHNVSWENSRINFDNFLNGYLALFQIATYKGWIPIIADAVDITGPNNQPIRDASTSMYLFFVLFIIFGSFFTLKLFIGVIIDNFN----RAGGSVELFMTEDQKRYYKAMKKMSSTAPQKPVPKPKLRIPQFFFKVINDQKFDIAIMVFIMLNTIVMCIEHHNQSEAFNDAVEQINRFFIVIFTGECVMKLLAQRWYYFKFAWNMFDFVIVVLSILTWAIEDIMVRLPIPPTMIRVVRVFRVGRVLRLVKSARGIRTLLFSLFVSLPALFNIGLLLFMIMFIYSIVGISFFSHVRHRSGIDEIFNFETFPSGMVVLFQLSTSAGWDSVLDGLINEEEPDCNPNKKPHSDCGNYAIAVVFLISYLVISFLVIINMYIAVILENFSQATEDVQQGLTQEDFD 1769          
BLAST of scna-1 vs. TrEMBL
Match: A0A2C9K836 (Sodium channel protein OS=Biomphalaria glabrata OX=6526 GN=106065847 PE=3 SV=1)

HSP 1 Score: 1401.34 bits (3626), Expect = 0.000e+0
Identity = 864/1866 (46.30%), Postives = 1176/1866 (63.02%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEF----ENLTDAEKWTVKYEFFNNETNW----LDPLRQCQNYTYNEWNTSCPE-------GYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDXXXXXXXXXXXXXIIDRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVS---------NVDIESEPRFSICDYDSTDRNLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSP--------RSIAVGKRIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRR-RVSKNLSFRHRMEN--ESINSDIFIKINQDDDNMISEINQYI------KNPELQSALSALSIYDAETKVRK---------KELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNF---KNETLFPSFKGAE--PRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYY-ELSVSNDVKIPEEQLSNPELWFK---YSLKETEVP-------------------------KFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY 5693
            +PNP+LE G+ LP SL DY   K+  G PL +LD FY+ ++TFVV+  DK IFRFS T A +LLSP NPIR+ AI +L HP FS  V+ TII NCVFMAK  N++ VE++F  IYT+E  IK +SRG I+  FTYLRD WNWLDF VI +AY+      LGNLSALR+ RVLRALKT++ +PG+KT+VGALLEAV++LRD M+LT+F+LSIF L+G+QLY G+L +KCV+           N F    EN+T  +     +EF N+  NW    L+  R C N   N     CP         YVC+     NPNY +T+FDNF  ++LCAFRLMTQD+WE+LY L +R  G  H LYF++VI  GSFYL+N+ILAIVAMSYD+ +   QA+   + AER+E+E  +E +            +E     N  +P  K+  S+ S    QSL    L    + K + +S              S+  +   +  +  R   S     PL  +    +   +AD S +     + P S         R+I  G+R   +    S  L E   +S    +   +++SR     R ++   + +++  L  N ++ +V   +  + ++++  +S++S     +++D     SE N ++      +N E++  +    I D  +  RK         K  +K  + K FC+W C P + K Q L  L I+D FV+LFIT+CIV NT+ M++D  D  P++ +    AN  FT  F  EAFLK++AL P  YF++ WN+FD  IV+LSL+E+ L +  G+S+LRAFRLLRVFKLAKSW T+N+L  I+  T+GA+GNL IVL I+IFIFAV+G QLF   Y  +   KNET        E  PRWNFNDF HSFMIVFRVLCGEWIESMW+C   NG+ CVPFF +T I+GNLV+LNLFLALLLSSFGSESL + E D +E NK+ EAIDR  R   WVKV+I   IK+         +++++      P      +  ++++  + ++    K PE+     ++      YS K+ + P                           + + EINEVEI+Y+  P+DC    ++K    C ++  +T  G +WW  RC   +L EH++F+TFII MI++SS  L  ED  LP +P LK  LE +DKVFT+IF +EM++KWFAFG   YF DAWCWLDF IV +++  LV   + TG G MG  +++RTLRALRPLRAVSRWEGMR+VVNAL +AIPSI NVLLVCLVFWLIF I+G+QLF GKF+ C N     + S + +PN+  C  +      ++W N+Q+NFDNV+  YL LFQVAT+KGW++IM +A+D+  +  QP    S  YY YFV FI+FG+FFTLNLFIGVIIDNFN QKK+ GGSLEMFMT+DQKKYYNAMK+M S +PQK IPRPK K+A ++F IT +QKFDI IM +I+LN + M  E+ D  +++K  L   N +FI +FT E +LKL   RWYYFK+PWN+FDF +V+ SI+  ++    ++  +SPT +RV+RVFR+GR+LRLVKSAKGIRTLLFSL VSLPAL NI LLL ++MFIYAI+GM+FF +  +   +D+  NF+TF ++ I+LFQ+ TS GW+ VLNGL++E P      KG+C  Y  A +YL +YLIISFLV++NMYIAVILENFSQAT++VQ+GLT DD+D++YE WE++D KA  +I L  L DFV+ +++PL +PKPN   L  L+IPIC+ D  YC D+L+ LT+ FLG     D  +   +K        K E   +S+TL+RQ+E++AA++I K  + Y
Sbjct:   27 KPNPKLEAGRKLPPSLEDY--PKEYIGKPLEDLDEFYHNQKTFVVLNKDKAIFRFSATNALFLLSPFNPIRRVAIYILVHPFFSLTVMVTIITNCVFMAKADNTEYVEHIFLGIYTVEACIKMLSRGFILKPFTYLRDPWNWLDFFVISIAYMTMAAKQLGNLSALRTFRVLRALKTISVIPGLKTIVGALLEAVRRLRDVMILTIFVLSIFALVGMQLYSGSLRQKCVR-----------NPFAVFGENVTHEQY----FEFTNDTNNWPNGGLETYRVCGN---NSGAGGCPNTTTNGTADYVCLSIGP-NPNYDFTSFDNFGFAMLCAFRLMTQDFWESLYHLVLRAEGTAHSLYFVLVILLGSFYLVNLILAIVAMSYDEQQKQDQADADEEAAERQEEEARKEVMSVMTQSPSNSSWNEFEGKDNTDKPEEKERLSMTS---DQSLTSGHLKPSLSQKRHSLSLPGSPYIHRRNSKGSQYSWKKPNVPTAKRGGHSADRQ-PLVHHALENLPLPFADDSGA-----VTPSSEDLCNFSFVRNIPNGRRFSFASQKRSAAL-ESGKQSGSRRSSFASNHSRASRTSRGSQQVDKSKMETLL--NFKKYKVPDVILDKSKLDDGHDSVSSGSGHGMDKDK---TSESNPFLGNSGTGQNVEMKDVMVLKDILDQASGHRKSYVSMASIHKRNMKDLMWKYFCTWDCSPNFQKIQRLAGLFIMDAFVDLFITVCIVANTLFMAMDHYDMDPKLANVSSMANEVFTAIFAAEAFLKILALSPVVYFKDGWNIFDCFIVVLSLMELSLTELPGLSVLRAFRLLRVFKLAKSWPTLNMLIAIVARTMGALGNLIIVLAIVIFIFAVMGQQLFSQGYEPYYCPKNETTKEPNPNPECMPRWNFNDFMHSFMIVFRVLCGEWIESMWNCHRANGWSCVPFFXLTYIIGNLVVLNLFLALLLSSFGSESLSRSESD-DEPNKIAEAIDRFKRFGNWVKVKIIVCIKVK--------LQRKQNWRPPPPALEQQEMNGKENFLGDGTLIALEKTPEDVPDGAKISRAGSVYSTKDLKSPLGSNSGSSHCSSCSSLSDSAQTKKIDLEAEHEINEVEIVYAKEPDDCFCYSLTKRCPCCLELE-KTVCGHVWWKVRCFMYRLAEHKYFDTFIISMILLSSCALAAEDAYLPEKPLLKEILEYMDKVFTVIFISEMIIKWFAFGFKTYFTDAWCWLDFSIVMLSIFMLVAEVMDTGGGKMGFMRSIRTLRALRPLRAVSRWEGMRVVVNALFKAIPSICNVLLVCLVFWLIFGIMGVQLFNGKFHACWNETN--KCSPDDVPNRTVCENL-----GLNWTNAQINFDNVIAAYLALFQVATYKGWVDIMNNAIDAREMNVQPKRESSIFYYLYFVLFIVFGSFFTLNLFIGVIIDNFNQQKKKAGGSLEMFMTDDQKKYYNAMKRMKSKSPQKSIPRPKYKLAALVFDITTDQKFDIVIMVIIILNMLTMMFEYEDMSKQMKDILGIFNLIFITVFTAECVLKLFGLRWYYFKIPWNVFDFCVVVFSILASSLSEFEDSFFISPTLLRVIRVFRVGRVLRLVKSAKGIRTLLFSLAVSLPALFNIGLLLGLVMFIYAIMGMNFFMHYPHRFGLDDALNFDTFFRSFILLFQMCTSAGWSDVLNGLISECPP-----KGSCAHYTKATIYLATYLIISFLVVVNMYIAVILENFSQATEEVQQGLTPDDFDMYYEKWEKFDPKATKYIPLDQLSDFVDYLEEPLRLPKPNHFILVKLDIPICEGDKCYCRDILDALTKNFLGTSETVDIPQKETDK-------EKEEYTPISSTLRRQKEHYAARIIQKAYRNY 1827          
BLAST of scna-1 vs. TrEMBL
Match: P90670 (Sodium channel protein OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 1354.73 bits (3505), Expect = 0.000e+0
Identity = 874/1886 (46.34%), Postives = 1162/1886 (61.61%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSDT--VEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNT--------SCPEG-------YVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR-----------------------LAIQAEETGDXXXXXXXXXXXXXIIDRIDEE----LGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVS-NVDIESEPRFSICDYDSTDRNLDSTRLVCPLESYFKGKIKFNYADKSESEATTPI------------LPRSPR-SIAVGKRIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGE-IKRQLSQNLRR-RVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIK------NPELQSALSALSIYDAETKVRK---------KELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETL----FPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKL---------------SKEIFGR--CIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSL------KETEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGT--GAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY 5693
            +PNP+LE G+ LP SL DY PR+ + G PL +LD FY+ ++TFVV+  DK IFRFS T A +LLSP NPIR+ AI +L HP+FS LV+ TI++NCVFMA  S +    VE++F  IYT+E  +K +SRG ++  FTYLRD WNWLDF VI +AY+       GNL ALR+ RVLRALKT++ +PG+KT+VGALLEAV++LRD M+LTVF+LSIF LIG+QLY G L +KCV       L   P    N+T  E W    ++ NNE++W       Q   Y+EW           C  G       ++C+     NPN+ +T+FDNF ++LLCAFRLMTQD+WE+LY L +R  G  H LYF++VI  GSFYL+N+ILAIVAMSYD+ +                       L+I  +   + +   + E       D+ +E+    L  + S    +  P R N K            SL  S      NS+  Q S    + +  R   C     DR         PL  +    +   +AD  +S A TP             +P   R S A  +R  G+  S S     RSS          +++SR     R +   GQG+  K Q   N ++ +V   +  + +++++  +       +  + +  SE N ++       N E++  +    I D  +  R+         +  +K  + K FC+W C P + K Q LV+L I+D FV+LFIT+CI++NT  M+++  D   ++      AN  FT  F +EAFLK++AL P  YF++ WN+FD IIV LSL+E+ +    G+S+LRAFRLLRVFKLAKSW T+N+L  I+G T+GA+GNL IVLGIIIFIFAV+G QLF   Y  ++ E          K   PRWNFNDF HSFMIVFRVLCGEWIESMW C LV+G+ CVPFFL+T ++GNLV+LNLFLALLLSSFGSESLQ+ E D +E +K+ EAIDR  R   WVKV+I   IK+                 E+ G+   +V      ++  P        C       S   D+K P    SN       S        +T+    + D EINEVEI+Y   P+DC     +K    C  V  ++  GR WW  RC   +L E+++F++FII MI+ SS  L LED  L  +P LK  LE LDKVFT IF  EML+KW AFG   YF DAWCWLDF IV +++V LV     +  G G M   K+MRTLRALRPLRAVSRWEGMR+VVNAL +AIPSI NVLLVCLVFWLIF I+G+QLF GKF+ C  ++  ++   E +PNK  C+         +W N+Q+NFD+VL+ YL LFQVAT+KGWI+IM +A+DST +G QPS   + I Y +FV FI+F +FFTLNLFIGVII+NFN QKK+ GGSLEMFMTEDQKKYYNAMK+M S +PQK IPRPK K+A +IF IT +QKFDI IM +I+LN + M  EH     ++K  L   N +FI IFT E +LKLI  RWYYFK+PWN+FDFV+V+LSI+  ++    ++  +SPT +RV+RVFR+GR+LRLVKSAKGIRTLLFS+ VSLPAL NI LLL +IMFIYAI+GM+FF      + +D+ FNF+TF ++ I+LFQ+ TS GW+ VLNGL+      C  E GTC  Y +A +YL +YL++SFLV++NMYIAVILENFSQAT+D Q+GLT DD+D++YE WE+YD KA  +I L  L DFV+ +++PL +PKPN   L  L+IPIC+ND  YC D+L+ LT+ FLG    +D  +   +K K + K        +S+TL+RQ+E++AA++I K  + +
Sbjct:   60 KPNPKLEAGRKLPPSLEDY-PREYV-GKPLEDLDEFYHNQKTFVVLKKDKAIFRFSATDAIFLLSPFNPIRRIAIYILVHPIFSLLVMMTILVNCVFMAITSYTPPAFVEHIFLGIYTVEAVVKVLSRGFVLKPFTYLRDPWNWLDFFVISIAYMTMTVKSFGNLQALRTFRVLRALKTISVIPGLKTIVGALLEAVRRLRDVMILTVFVLSIFALIGMQLYSGALRQKCV-------LNPVPELGTNITHDE-WN---DWVNNESHW-------QKDFYDEWQVCGNGTGAGKCGNGTINGTAEWLCLPNIGQNPNHDFTSFDNFGMALLCAFRLMTQDFWESLYHLVLRAVGSAHCLYFVLVILLGSFYLVNLILAIVAMSYDETQKQDQADAEEEAAERQEEEARKEALSIMTKSPSNSSWNNDFEAGVRTAGDKAEEKERLSLTSDHSATSAHLKPSRLNQKR--------HSLSLPGSPYIHRRNSRGSQYSWRKPVPTAKRSPYC----PDRQ--------PLVHHTLENLPLPFAD--DSAAVTPSSEDLCNFSFIRNMPNGRRFSFASQRRPDGTGRSGS----RRSS--------FASNHSRA---SRTSRGSGQGDRTKTQTLLNFKKGKVPDVVLDKSKLDDDQDSVSSGGSGHCPEKDKASESNPFLSHSPGGPNVEMKDVMVLKDILDQASGHRRSFVSMTSIHQRTMKDIMWKYFCTWDCHPNFQKLQRLVSLFIMDAFVDLFITICILVNTAFMAMEHYDMEDDLKAVSNAANLVFTAIFAVEAFLKILALSPVIYFKDGWNIFDSIIVALSLMELSMTKLPGLSVLRAFRLLRVFKLAKSWPTLNMLIAIVGRTMGALGNLIIVLGIIIFIFAVMGQQLFSSDYKTYEREIDAWGNVTINKDKMPRWNFNDFLHSFMIVFRVLCGEWIESMWGCYLVSGWACVPFFLLTYVVGNLVVLNLFLALLLSSFGSESLQRSESD-DEPSKIAEAIDRFKRFGNWVKVKIIVCIKVKLQRQKNWRPPPTTGQSEVNGKDPAVVDGTVVSMEKTPDDFPDGPCCPAQAAICSAKKDLKSPSGSHSNSGSSHCSSCSSLSESAQTKKIDLEADHEINEVEIVYVKEPDDCFCYMCTKRCPWCVKVE-KSKIGRAWWAVRCFFYRLTENKYFDSFIIAMILASSCALALEDAYLHEKPILKEILEYLDKVFTAIFIIEMLIKWLAFGFKTYFTDAWCWLDFTIVMLSIVMLVADLTASEEGGGSMSWMKSMRTLRALRPLRAVSRWEGMRVVVNALFKAIPSICNVLLVCLVFWLIFGIMGVQLFNGKFHAC-RDEKGDKYPREEVPNKTVCIDK-----GYNWTNAQINFDHVLSAYLALFQVATYKGWIDIMNNAIDSTEIGQQPSREENVIMYLFFVLFIVFCSFFTLNLFIGVIIENFNSQKKKAGGSLEMFMTEDQKKYYNAMKRMQSKSPQKSIPRPKYKLAGLIFDITTDQKFDIAIMVIIILNMLTMMFEHHGMSAQMKNILGIFNLIFITIFTAECVLKLIGLRWYYFKIPWNVFDFVVVVLSILASSLSEFEDSFFISPTLLRVIRVFRVGRVLRLVKSAKGIRTLLFSMAVSLPALFNIGLLLGLIMFIYAIMGMNFFMGAEQKYGLDDAFNFDTFLRSFILLFQMCTSAGWSDVLNGLIAR----CAPE-GTCKDYNVATIYLATYLVVSFLVVVNMYIAVILENFSQATEDEQQGLTPDDFDMYYEKWEKYDPKASKYIPLDQLSDFVDYLEEPLRLPKPNHFILVKLDIPICENDRCYCRDILDALTKNFLGTGETSDIPQKETDKEKEEYK-------PISSTLRRQKEHYAARIIQKAYRNF 1868          
BLAST of scna-1 vs. TrEMBL
Match: A0A1I8G7J9 (Sodium channel protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 1264.98 bits (3272), Expect = 0.000e+0
Identity = 740/1331 (55.60%), Postives = 958/1331 (71.98%), Query Frame = 3
Query: 1869 PILPRSPRSIAVGK-RIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISE---INQYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFC-SWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHP--------------MWNAHNIKCEK-----SYYELSVSND---------VKIPEEQLS--NPELWFKYSLKETEVPK---------------FDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFE-TPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAG-GMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCN---KEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY 5693
            P+L +SP S+++G  +  G+ SS S    + +   ++D +   T ++       ++ +  +  + R+ ++ L +     +      E E +  D    I  DD N   +    +     PE   A++  + ++   K +K +  K+ +L+  C SW CC C+   +  V L ILDPFVELFIT+CI++NT+ M++D P NS     FL  AN FFT TF +EAF KLI + P  YF + WN+FDF IV+LSLVE+PL +  G+S+LRAFRLLRVFKLAKSWQTMNLLF II  T+GA+GNL  VLGI+IFIFAVVGMQLFG+ Y+ +KN TL+P + G  PRWNF DFTHSFMIVFRVLCGEWIESMWDCM +NG+ CVPFFL+T ++  LV+L+LFLALLLSSFGSESLQ+RE++  E NKLQ+AIDRI R IVW K++++    L   +FG     KR+   +  P                 A N K  +     S  ELS+ +          + I    LS  N  L  + S   T+ PK               F ++PE+ EVE++Y  +PEDCLP  ++KL   C   + + T  GR WW  RC+A +LVEH++FETFII +I ISSLTLTLED NLP RP LKL LE +DK FTIIF  EML+KWFAFG+ KYF DAWCWLDF+IV +A++SLVL+ +G  AG  MGAFKAMRTLRALRPLRAVSRWEGMR+VVNALIQAIPSIFNVLLVCLVFWLIFSI+G+QLFGG+F+KC++ +T ER+  E++P+  +C  M+  + NVSW NS++NFDNVLNGYL LFQ++T+KGW  ++ADAVD+TG+G QP+ + +T  Y +FV FIIFG+FFTLNLFIGVIIDNFN+QKKR GGSLEMFMT+DQKKYY AMKKMSS +PQKPIP+PKLKI+   F IT NQKFDI IMS IMLNT+VMC+EH +Q      A++Q+N+ FIV+FTGE + KL+AQRW+YFK  WN+FDF+IV+LS++ WA+E ++  +PV PT IRVVRVFR+GR+LRLVKSA+GIRTLLFSL VSLPAL NI +LL+M+MFIY+IVG+SFFS+V + + ID++FNFETF  AMI+LFQ+STS GW+GVL+GLMNE+P +CN   K    CG+Y IAVV+LISYL+ISFLVIINMYIAVILENFSQAT+DVQEGLTQ+D+DLFYE WE+YD KARGFI L+ +   ++++D PL IP PN ++LA L +PIC+ DTVYCVDLL+ LT+ FLG   EA   E  L++++P  K  K E+++++NT + QR+  AA+VI++Y + +
Sbjct:  485 PML-QSPTSLSLGNLQEAGAASSCSHCAPQEAVFPFVDDSNAQTPDAAATAAALMSPM--RTPLARRAAEKLLKY--DIICNAPSTEKEKVYDDRDNVITADDKNADCDKCRCHHADSMPEDIEAVAVAAAHEDAPKEKKFQYWKRVMLEKLCYSWECCYCWKVVEKYVNLFILDPFVELFITICILVNTLFMALDVPANSQSFKEFLSHANLFFTATFAIEAFSKLIGMRPAVYFLDGWNIFDFSIVLLSLVELPLQNVQGLSILRAFRLLRVFKLAKSWQTMNLLFAIIARTMGALGNLVFVLGIVIFIFAVVGMQLFGESYNAYKNVTLYPEYNGYYPRWNFVDFTHSFMIVFRVLCGEWIESMWDCMRLNGFVCVPFFLLTQVIAGLVVLSLFLALLLSSFGSESLQRREEEEEEVNKLQQAIDRINRFIVWSKLKLK---SLGSRLFGGL---KRRLWARPVPDSDLFEEENGVDGEEGKADNGKGHRGCMGGSNPELSLGSGQSPLTRHGALVIENFGLSGVNHLLLGERSQPATDDPKAAVQITPPPPPEIPDFYKEPEVTEVEVLYWDTPEDCLPAKLAKLFAPCAARLCDSTAFGRFWWGLRCRAYRLVEHRYFETFIIALIAISSLTLTLEDVNLPRRPKLKLTLEYMDKCFTIIFAFEMLVKWFAFGMKKYFSDAWCWLDFVIVNVAVISLVLNSLGGEAGQSMGAFKAMRTLRALRPLRAVSRWEGMRVVVNALIQAIPSIFNVLLVCLVFWLIFSIMGVQLFGGQFFKCISKETGERLLPEVVPDVESCERMRQAFDNVSWVNSRINFDNVLNGYLALFQISTYKGWTLVIADAVDTTGVGKQPARDANTPMYFFFVLFIIFGSFFTLNLFIGVIIDNFNMQKKRAGGSLEMFMTDDQKKYYKAMKKMSSVSPQKPIPKPKLKISKFFFVITSNQKFDIVIMSFIMLNTVVMCVEHHNQSASFSNAVNQVNRFFIVLFTGEAVFKLLAQRWHYFKFAWNVFDFIIVVLSVLTWAMEDIMYVLPVPPTMIRVVRVFRVGRVLRLVKSARGIRTLLFSLFVSLPALFNIGILLLMVMFIYSIVGLSFFSHVRHHNGIDQIFNFETFPSAMIVLFQMSTSAGWDGVLDGLMNEEPPMCNPNKKPHSDCGNYAIAVVFLISYLVISFLVIINMYIAVILENFSQATEDVQEGLTQEDFDLFYEKWEKYDLKARGFIQLRDVYILLDELDPPLQIPAPNKIKLASLCVPICEGDTVYCVDLLDALTKNFLGTGDEA---EEALSEMRPAGK-AKSERVVITNTAELQRQVAAARVILRYWRHW 1800          

HSP 2 Score: 457.603 bits (1176), Expect = 1.214e-128
Identity = 239/378 (63.23%), Postives = 284/378 (75.13%), Query Frame = 3
Query:  348 KEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYE-----FFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRL 1466
            + PN +LE G  LP S+ D FP KKLSGIPL ++D FY  K TFVVIA DKTIFRFS T A ++LSP NP+R+ AI +LTHP FS LVL  II NCVFMA+NS+S+ VEY FT IYT E TIKA+SRGLI++EFTYLRDAWNWLDFIVIGLAYLMFF P LGNLSALRSLRVLRALKTVTTVPG+KT+VGAL+EAVK+LRD  +LT+F+LSIF LIGLQ+Y+GTLL+KCV  FN T         E++ DA       E       NN +NW   +  C   +Y+     CP+GY C  T   NPN+GYT FDNF  ++LCAFRLMTQDYWENLYQ+ IR NG  H  +F++VI  GSF+L+NVILAIVAM+YD+VR+
Sbjct:   77 RRPNAKLEAGMKLPPSMSDIFPVKKLSGIPLEDIDEFYADKMTFVVIAKDKTIFRFSATNALFVLSPFNPVRRGAIFVLTHPAFSLLVLLAIICNCVFMARNSSSEIVEYTFTAIYTTEATIKAVSRGLILSEFTYLRDAWNWLDFIVIGLAYLMFFIPTLGNLSALRSLRVLRALKTVTTVPGLKTIVGALMEAVKRLRDVGILTIFVLSIFALIGLQMYKGTLLQKCVLEFNFTAALEARGYNESVMDAGTLEQIKEQELDLHGNNRSNWHPDMLIC---SYSSLGQPCPQGYQCFTTDEANPNFGYTKFDNFGWAMLCAFRLMTQDYWENLYQIVIRANGTPHFFFFVLVIMLGSFFLMNVILAIVAMAYDEVRM 451          

HSP 3 Score: 82.8037 bits (203), Expect = 1.013e-11
Identity = 71/278 (25.54%), Postives = 126/278 (45.32%), Query Frame = 3
Query: 3678 EILDKVFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV-------------------NNDTFERISAEII-----------PNKNAC----LIMKAMYGNVSWENSQLN-------FDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVI 4373
            EI++  FT I+T E  +K  + GL      Y +DAW WLDFI++ +A    ++ +I T    +G   A+R+LR LR L+ V+   G++ +V AL++A+  + +V ++ +    IF++IG+Q++ G    KCV                   +  T E+I  + +           P+   C    L      G   +   + N       FDN     LC F++ T   W  +    + + G          T ++ +FV  I+ G+FF +N+ + ++
Sbjct:  182 EIVEYTFTAIYTTEATIKAVSRGLILSEFTYLRDAWNWLDFIVIGLA---YLMFFIPT----LGNLSALRSLRVLRALKTVTTVPGLKTIVGALMEAVKRLRDVGILTIFVLSIFALIGLQMYKGTLLQKCVLEFNFTAALEARGYNESVMDAGTLEQIKEQELDLHGNNRSNWHPDMLICSYSSLGQPCPQGYQCFTTDEANPNFGYTKFDNFGWAMLCAFRLMTQDYWENLYQIVIRANG----------TPHFFFFVLVIMLGSFFLMNVILAIV 442          

HSP 4 Score: 67.781 bits (164), Expect = 3.588e-7
Identity = 72/323 (22.29%), Postives = 129/323 (39.94%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEYV---FTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXX--------XKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNG-------DIHI-LYFMMVIF--FGSFYLINVILAIV 1439
            +R  A RL+ H  F   ++  I I+ + +         +     T+EY+   FT I+  E  +K  + G+      Y  DAW WLDF+++ +A +      LG  +                  L+ V+   GM+ VV AL++A+  + + +++ +    IF ++G+QL+ G   +   K     LL       E + D E      + F+N  +W++                                    NFDN +   L  F++ T   W  +    + T G       D +  +YF  V+F  FGSF+ +N+ + ++
Sbjct: 1083 LRCRAYRLVEHRYFETFIIALIAISSLTLTLEDVNLPRRPKLKLTLEYMDKCFTIIFAFEMLVKWFAFGMK----KYFSDAWCWLDFVIVNVAVISLVLNSLGGEAGQSMGAFKAMRTLRALRPLRAVSRWEGMRVVVNALIQAIPSIFNVLLVCLVFWLIFSIMGVQLFGGQFFKCISKETGERLLP------EVVPDVESCERMRQAFDN-VSWVN---------------------------------SRINFDNVLNGYLALFQISTYKGWTLVIADAVDTTGVGKQPARDANTPMYFFFVLFIIFGSFFTLNLFIGVI 1361          
BLAST of scna-1 vs. Ensembl Cavefish
Match: scn1laa (sodium channel, voltage-gated, type I-like, alpha [Source:ZFIN;Acc:ZDB-GENE-040426-751])

HSP 1 Score: 1139.79 bits (2947), Expect = 0.000e+0
Identity = 785/1906 (41.19%), Postives = 1099/1906 (57.66%), Query Frame = 3
Query:  291 ESDLHSHYTPIKKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLL---THPV--FSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK-SFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDXXXXXXXXXXXXXIIDRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSICDYDSTDRNLDSTRLVCPLESY-FKGKI--KFNYADKSESEATTPILPRSPRSIAVGKRIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNP-------ELQSALSALSIYD---AETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVK---------VQIRFAIKLSKEIFGRCIVKKRKKL--IKSH----------PMWNAHNIKCEKSYYELSVSNDVKIP------EEQLSNPELWFKYS------------------------------LKETEVPKFDEDPEIN---------EVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCN--------KEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLK 5708
            E+D  +     K   ++  ++P   LE GK LP   GD    + L   PL ++DPFY  ++TF+V+   KTIFRF+ T A ++LS  NP+R+ +I++L   T  V  F+ +++ TI+ NC FM  + +   +   EY FT IYTLE  IK ++RG  I +FT+LRD WNWLDF VI LAY+  F   +GN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L  KC++   NHT L      +      E W   Y          DP   C+ +   +  T C     CI          + +FD+                      LT+R  G  ++++F++VIF GSFYL+N+ILA+VAM       A   +   + AE +++EE  + +++++      ++S + +     + +SK     ++  +K+   +    DE           DIE    F +    ST  ++ + R       + F+G++  + +YAD   S                 +R    LS  S  L    SK  L P ++  SN ++     +  +D  G +     ++L      +     R+   +I+     K   D++   ++ + +  +P         Q ALS  SI      E +  +++    W     TF  W CCP + K +  V ++++DPFV+L IT+CIVMNT+ M+++      + +  L   NY FT  F  E   K+IAL P  YFQE WN+FD +IV LSL+E+ L + SGMS+LR+FRLLRVFKLAKSW T+N+L  IIG ++GA+ NL +VL IIIFIFAVVGMQLFG  Y     +     F     RW+  DF HSF+IVFRVLCGEWIE+MWDCM V+G   C+  FLM M++GNLV+LNLFLALLLSSF +++L   EDD NE N LQ A+ RI+R + +VK         V +R   K S E  G   +K  KKL  I +H           M +      +   + ++ S  V +P      + +  N E +  YS                               K +EV    E   +          E E+  S  PE C  +   +  R C  V  E    R WW  R    ++VEH +FE+FII MI++SS  L  ED  +     LK+ LE  DKVFT +F  EMLLKW A+G  KYF +AWCWLDF+IV ++L+SLV + +      +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GKFY+CVN  T  R++   + NK  C ++    GN  W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS  L  QP +  + I Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK++  S ++FMTE+QKKYYNAMKK+ S   QKPIPRP  K+   IF I  NQ FDIFIM +I LN + M +E  D   K+KT L+ +N +F+ +FT E  LK+++ R Y+F V WN+FDFV+VILSIV   I  ++     SPT +RVVR+ RIGRILRL+K AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+G+L+ ++N D   CN        K KG CGS  I +++ +SY+II FL+++NMYIAVILENFS AT++  E L++DD+++FYE WE++D KA  F+    L DF + +D PL +PKPN +QL  +++P+   + ++C+D+L   T+R LG+  E D     +          KV    +++TL+R+ E+ +A VI +  + Y  + +
Sbjct:   31 ENDKKNKNDEEKNTDEESTRKPQRDLEAGKKLPLIYGDI--PQGLVSTPLEDMDPFYCNQKTFIVLNRGKTIFRFNATPALFILSSFNPLRRISIKILFSLTEAVTWFNMVIMFTILTNCAFMTMSESPGWAKIAEYTFTGIYTLESVIKILARGFCIGKFTFLRDPWNWLDFSVIVLAYVTEFVK-MGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLKYKCIQLPANHTDLGNGSISYNGTAVPEDWLKNYT--------SDP---CECWFNCKLKTCCSFFLFCILL--------FKSFDH--------------------KCLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAM-------AYDEQNQANLAEAQQKEEEFQAMLEQLKNGEMTDTSSETS-----KLSSKSAKERRNQKKKKKQREEAREDE---------KADIECGACFFLQSVLSTQGSVFTPRRNSKASIFSFRGRLGSENDYADDEHSAFDD----------TGSRRDSLFLSHRSERLYSCFSKGSLSPRIILPSNGKV-----LCSVDSNGVVTLVSGRSL-----PSTPVGLRLPEVTID-----KATTDENVRKAQYDSHQPSPGYLDEQRARQRALSVASIITNTMEELEESRQKCHPCWYRFAHTFLIWECCPTWMKIKKAVHMVVMDPFVDLSITICIVMNTIFMAMEHHPMDKDFSSVLSMGNYVFTGIFTAEMVFKIIALDPYYYFQEGWNIFDSVIVSLSLMELGLANISGMSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSMGALSNLTLVLAIIIFIFAVVGMQLFGKSYKTSLTKIAPDGFL----RWHMMDFLHSFLIVFRVLCGEWIETMWDCMEVHGQPLCLIVFLMVMVIGNLVVLNLFLALLLSSFSADNLAATEDD-NEMNNLQIALGRIHRGVAFVKASLRRFFQTVCLRVRRKKSSEQNG---LKNSKKLPDISNHTTVELIKDPGSMKDLAGADSDNENFIINSSVTVTVPIATADSDAECQNMEDYSSYSSDMEEDKERRHCVPSRNVVMEMCAVSGLFLQKLSEVMSSSEGSTVEIRKDGADSLEFELEESMDPEPCFTDGCVRRCR-CCQVNMEKERWRTWWTVRRTCFRIVEHTWFESFIIFMILLSSGALAFEDIYIEGYKTLKMILEYADKVFTYVFMLEMLLKWLAYGFAKYFTNAWCWLDFLIVDVSLISLVANALDYSE--LGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECVNITTGIRMNETDVANKTECDMLGE--GNARWKNLKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRNLNEQPKFEVNLIMYGYFVGFIIFGSFFTLNLFIGVIIDNFNQQKKKI--SQDIFMTEEQKKYYNAMKKLGSKKLQKPIPRPTNKVQGFIFDIVTNQAFDIFIMILICLNMVTMMVESDDPDPKMKTVLNWLNMIFVALFTTECALKMVSLRQYFFTVGWNIFDFVVVILSIVAMCISDVITYF-FSPTLLRVVRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLSPILNRDIPDCNPTKDNPGSKVKGDCGSPSIGIIFFVSYIIICFLIVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPKATQFMEYNKLSDFADALDPPLRMPKPNKIQLIGMDLPMVTGERIHCLDILFAFTKRVLGEGGEMDILRGQMEDRFMASNPSKVSYEPITSTLRRKHEDMSALVIQRAYRKYVGKHR 1832          
BLAST of scna-1 vs. Ensembl Cavefish
Match: ENSAMXT00000044886.1 (sodium channel protein type 4 subunit alpha B-like [Source:NCBI gene;Acc:103028834])

HSP 1 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 554/1185 (46.75%), Postives = 755/1185 (63.71%), Query Frame = 3
Query: 2310 FCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKK------------LIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPN-------------------------FISKLLRKC--YDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVK-YMKAYTER-LKQ 5711
            F  W CC  + +F+  V  I++DPFV+L IT+CIV+NTV M+++    + E    L   N  FT  F  E  LKLIA+ P  YFQ  WN+FD IIV +SLVE+ L +  G+S+LR+FRL+RVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLF   Y   K+     S     PRW+  DF HSF+IVFR+LCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF  +++    DD  E N LQ AI RI RA+ WVK  +      ++ + G   V+K KK            L+ +H M +   +       E ++   VK+P   ++  E  F+    +T     DED + +E   +  +  +D   +                         +  K +R+C   D+      G+ WW  R     +VEH +FETFII MI++SS  L  ED  L  R  +K+ LE  D+VFT IF  EMLLKW A+G   YF +AWCWLDF+IV ++L+SL  + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSIFNV+LVCL+FWLIFSI+G+ LF GKFY C+N  + E    E++ NK+ C ++     +  W N ++N+DNV  GYL L QVATFKGW++IM  AVDS  + +QPSY  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK ++GG  ++FMTEDQKKYYNAMKK+ S  PQKPIPRP+      +F +   Q FDI IM +I LN I M  E  +Q  +++  L  IN  FIVIFTGE  LK+IA R YYF V WN+FDF++VILSI+   +  ++    VSPT  RV+R+ RIGR+LRL++ AKGIRTLLF+L++SLPAL NI LLL +IMFI++I GMS F+ V     ID++FNFETFG ++I LF I+TS GW+G+L+ ++N  P  C+ +        +G CG+  + +V+  +Y++ISFLV++NMYIA+ILENF+ AT++  E L +DD+++FYE WE +D  A  FI+   L DF + +  PL IPKPN+++L  +++P+   D ++C+D+L  LT   LG+    D+ +  + +        KV    ++ TL+R++E  AA VI + Y K   +R LKQ
Sbjct:  604 FLKWDCCTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLVELGLANVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSY---KSCVCKISEDCELPRWHMTDFFHSFLIVFRILCGEWIETMWDCMEVAGQGMCIVVFMMVMVIGNLVVLNLFLALLLSSFSGDNMAS--DDDGEMNNLQIAIGRITRAVDWVKATV---TGQARSVLGLKPVEKEKKGNDEDDFRCNNDLVLTH-MESGDKLD---GAAERAIVLSVKVP---MAKRESDFESPYDDTSD---DEDKKADEKSKLKDSGGDDSSCSTVDKPPEVEEAESEEEEDPTTPEDCYTEKCIRRCPCLDLDITQGRGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGYSE--LGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYHCINTTSEELFPPEVVNNKSECFLLIEGGYDARWVNQKVNYDNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKLGGQ-DLFMTEDQKKYYNAMKKLGSKKPQKPIPRPQNCCQGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDCDPDIQNPGSDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFNVATEESGEPLCEDDFEMFYETWERFDPDASQFIAYSSLSDFCDTLKDPLRIPKPNTIKLITMDLPMVPGDKIHCLDILLALTAEVLGESEAMDSLKATMEEKFMANNPSKVSYEPITTTLRRKQEEVAAVVIQRAYRKHVLKRTLKQ 1767          

HSP 2 Score: 339.347 bits (869), Expect = 1.017e-93
Identity = 193/394 (48.98%), Postives = 266/394 (67.51%), Query Frame = 3
Query:  321 IKKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCV------KSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNW------LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            I+  ++D+PK P+  LE GKSLP   GD  P  +L  +PL +LDP+Y  ++TF+VI+   TI RF+   A Y+L+P +P+R+ AIR+L H +FS  ++ TI+ NCVFM  ++    S  +EYVFT IYT E  IK +SRG  I +FT+LRD WNWLDF+VI +AYL  F   LGN+SALR+ RVLRALKT+T +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L +KCV         N T        F +   A       E+ NNE N+      +D L  C N + +     CPEGY+C++    NPNYGYT++DNF  + L  FRLMTQD+WENL+QLT+R+ G  ++++F+++IF GSFYLIN+ILA+VAM+Y +
Sbjct:   94 IEVAEEDLPK-PSSDLEAGKSLPFIYGD--PPPELLNVPLEDLDPYYKAQKTFIVISKGNTINRFNAESACYILNPFSPVRRGAIRILIHSLFSMFIMVTILSNCVFMTMSNPPEWSKIMEYVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD-LGNVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVVWPPVFPLINGTTNMNATASFSDKLYANSSFDYEEYINNEENYYFIPGSMDAL-LCGNSSDS---GRCPEGYMCLKAGR-NPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRSAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAE 478          

HSP 3 Score: 80.4925 bits (197), Expect = 1.996e-14
Identity = 73/284 (25.70%), Postives = 127/284 (44.72%), Query Frame = 3
Query: 3678 EILDKVFTIIFTAEMLLK----WFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVN-NDTFERISAEIIPNKNACLIMKAMYGNVSWE-----NSQLNF-------DNVL-----------NGYLC-----------------------LFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVI 4373
            +I++ VFT I+T E L+K     F  G   + +D W WLDF+++++A ++  +         +G   A+RT R LR L+ ++   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV     F  I+     N  A    K +Y N S++     N++ N+       D +L            GY+C                       LF++ T   W  +    + S G            Y  +FV  I  G+F+ +NL + V+
Sbjct:  208 KIMEYVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD--------LGNVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVVWPPVFPLINGTTNMNATASFSDK-LYANSSFDYEEYINNEENYYFIPGSMDALLCGNSSDSGRCPEGYMCLKAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRSAG----------KTYMIFFVVIIFLGSFYLINLILAVV 472          

HSP 4 Score: 63.5438 bits (153), Expect = 2.556e-9
Identity = 42/155 (27.10%), Postives = 83/155 (53.55%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            I++     +FI + I+ N V M++  P   PE +  ++   Y FT  +  EA +K+++    +G   + ++ WN  DF+++ ++ +   +D   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF
Sbjct:  177 ILIHSLFSMFIMVTILSNCVFMTMSNP---PEWSKIME---YVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLGNVSALRTFRVLRAL---KTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLF 322          

HSP 5 Score: 55.0694 bits (131), Expect = 1.066e-6
Identity = 74/326 (22.70%), Postives = 147/326 (45.09%), Query Frame = 3
Query:  561 RKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVC-IQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWE-NLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            RKT   ++ H  F   ++  I+++   +A        + +    +EY   VFT I+ +E  +K  + G      TY  +AW WLDF+++ ++ +     +  +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + M++ +    IF ++G+ L+ G     C+ + +  L  F P    N         K E F       D     Q   Y+        GY+  +Q  T      +  + + + + + +  +  Q  +E NLY            +YF++ I FGSF+ +N+ + ++  +++  +  +  ++
Sbjct: 1038 RKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFK----TYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYH-CINTTSEEL--FPPEVVNN---------KSECFLLIEGGYDARWVNQKVNYDNVGM----GYLSLLQVAT------FKGWMDIMYAAVDSRNVEDQPSYEINLYMY----------IYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKLGGQD 1327          
BLAST of scna-1 vs. Ensembl Cavefish
Match: scn12aa (sodium channel protein type 4 subunit alpha-like [Source:NCBI gene;Acc:103035061])

HSP 1 Score: 904.82 bits (2337), Expect = 0.000e+0
Identity = 564/1255 (44.94%), Postives = 789/1255 (62.87%), Query Frame = 3
Query: 2130 ESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIY-DA--ETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIR--FAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQ----LSNPELWF---------------------------------KYSLKE---TEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPG--RLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCN--------KEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNR 5717
            E +  D  +    +    + E+      P  +  LS++S + DA  E +  +++    W    K +  WTC P + KF+  V ++++DPF++L IT+CIV+NT+ M+++    + E N  L   N  FT  F  E  LKL+A+ P  YFQ+ WN+FD IIV LSL+E+ L +  G+S+LR+FRLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y +   +    S   + PRW+  DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F++ M++GNLV+LNLFLALLLSSF S++L   +DD  E N LQ AI RI+  + W+   I+   +  L+K        +K K+   +    N+++ +C      +    +  I  E+    ++NP L                                     SL E    ++ K  E+ E++E+ I  +  PE+C P F    +R+C      T  G  + WW  R    ++VEH +FETFII MI++SS  L  ED  +  R  +K+ LE  DKVFT IF  EM LKW A+G  KYF + WCWLDF+IV ++L+SLV + +G      GA K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKF KCVN   +   +A I+ NK+ C  M        W   ++NFDNV  GYL L QVATFKGW+EIM  AVDS G+  QP    +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK+++GG  ++FMTE+QKKYYNAMKK+ +  PQKPIPRP   +   IF +   Q FDI IM +I+LN I M IE  +Q +++++ L+++N  FI+IFT E L+K+ A R Y+F + WN+FDFV+VILSI+   +  ++    VSPT  RV+R+ RIGR+LRL++ AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GM+ F+ V     ID++FNFETFG +MI LFQI+TS GW+ +L+ ++N  P+ CN          KG CG+  + + + +SY+IISFL+++NMYIA+ILENFS AT++  E L++DD+++FYE WE++D +A  FI    L +F + + +PL I KPN ++L  +++P+   D ++C+D+L   T+R LG+  E D  +  +          K+    ++ TL+R++E+ +A VI    +AY   L + +
Sbjct:  618 EKVKEDTELVCATEAPKPVPEVQVEAPPPRRKRGLSSISFFSDAMDELEESRQKCPPCWYEFAKKYLIWTCAPVWMKFKDGVKIMVMDPFLDLAITICIVLNTLFMALEHYPMTEEFNGMLSVGNLVFTGIFTAEMVLKLVAMDPYFYFQQGWNIFDGIIVCLSLMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDCVCKI---SIDCSLPRWHMKDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCILVFMLVMVIGNLVVLNLFLALLLSSFSSDNLSAPDDDG-EMNNLQIAIARIHSGLTWLLAFIKDLCSGNLTKR------NQKNKEGQGAKKCQNSNHAECNGVVGRIGRYGEKYIITEEEDSYMTNPNLTICVPIAPGESDVEFLEEEEEEDTETSEDEDNKPEVVSLSEGSTVDLRKPGEEDEMSEL-IEDTMEPEECFPEFC---VRRCECCKINTTQGLGQAWWRLRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIEQRKVVKVVLEYADKVFTYIFVLEMFLKWIAYGFKKYFTNYWCWLDFLIVDVSLISLVANSLGYS--DFGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGKCVNRTGYIH-NASIVNNKSDCQSMNDT--QFYWTKVKVNFDNVGLGYLSLLQVATFKGWMEIMYAAVDSRGVEEQPIKEINLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKRKIGGQ-DIFMTEEQKKYYNAMKKLGTKKPQKPIPRPANILQAFIFDLVSKQAFDISIMMLIILNMITMMIETDEQSDRMESILNKVNLAFIIIFTTECLVKIFALRCYFFTISWNVFDFVVVILSIIGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMANFAYVKKQGGIDDMFNFETFGNSMICLFQITTSAGWDNLLDPILNNSPEECNPNIVNTGTNTKGNCGNPSVGITFFVSYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFEMFYEVWEKFDVEATHFIEYSMLSNFADALSEPLRIAKPNKIKLISMDLPMVSGDKIHCLDILFAFTKRVLGESGEMDALKQQMEDKFMLTNPSKISHEPITTTLRRKQEDVSATVI---QRAYRRHLVKRQ 1849          

HSP 2 Score: 335.109 bits (858), Expect = 2.281e-92
Identity = 189/423 (44.68%), Postives = 272/423 (64.30%), Query Frame = 3
Query:  237 DAYTEISKPEVIISNENI--ESDLHSHYTPIKKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYK-KQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSD---TVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNW--LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            DA    ++  ++   + I  E   ++  TP  K   +   EP   LE GK LP   GD      L G+PL ++DPFY+K K+TF+V+   K IFRFS T A Y+ +P + IR+ +IR+L H +FSF ++ TI+ NC FMA +  +     +EY FT IYT E  IK ++RG  +  FT+LRD WNWLDF VI +AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++V++L D M+LTVF LS+F LIGLQL+ G L +KCV+S  H +    P     + + + W    EF  +E N+  ++  +      ++     CP+G+ C++T   NPNYGYT+FD+F  + L  FRLMTQDYWENLY  T+R+ G  ++++F++VIF GSFYL+N+ILA+VAM+Y++   A  AE
Sbjct:   11 DALRRFTRESLVAIEQRIADEQAKNAKDTPPNKGTTE---EPKLDLEAGKVLPRIFGDI--PTGLVGVPLEDIDPFYFKNKKTFIVLNKGKAIFRFSATSAVYIFTPFHLIRRISIRILVHSLFSFFIMCTILTNCCFMAMSDPAHWTKYLEYTFTGIYTFESLIKILARGFCLEPFTFLRDPWNWLDFSVIVMAYVTEFVD-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVRKLADVMILTVFCLSVFALIGLQLFMGVLRQKCVRSAAHCVNSTFPANTSFVCNNKTWQSMKEFVTSEENYYKIEGAKDGLICGFSSDAGKCPDGFDCLKTGR-NPNYGYTSFDSFGWAFLALFRLMTQDYWENLYHQTLRSAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIAE 426          

HSP 3 Score: 87.0409 bits (214), Expect = 2.119e-16
Identity = 71/283 (25.09%), Postives = 122/283 (43.11%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVN------NDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTI---------------------------------YYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            L+  FT I+T E L+K  A G       + +D W WLDF ++ +A V+  +         +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV       N TF   ++ +  NK      ++M   V+ E +    +   +G +C F     K       D  D    G  P+Y +++                                  Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  156 LEYTFTGIYTFESLIKILARGFCLEPFTFLRDPWNWLDFSVIVMAYVTEFVD--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVRKLADVMILTVFCLSVFALIGLQLFMGVLRQKCVRSAAHCVNSTFPANTSFVCNNKT----WQSMKEFVTSEENYYKIEGAKDGLICGFSSDAGK-----CPDGFDCLKTGRNPNYGYTSFDSFGWAFLALFRLMTQDYWENLYHQTLRSAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQ 421          

HSP 4 Score: 67.0106 bits (162), Expect = 2.675e-10
Identity = 51/191 (26.70%), Postives = 87/191 (45.55%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF---------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            KTF         F+F +  A+ I  PF                  FI   I+ N   M++  P       H+ K   Y FT  +  E+ +K++A G    P  + ++ WN  DF +++++ V   +D   +S LR FR+LR  K   +   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF
Sbjct:   87 KTFIVLNKGKAIFRFSATSAVYIFTPFHLIRRISIRILVHSLFSFFIMCTILTNCCFMAMSDP------AHWTKYLEYTFTGIYTFESLIKILARGFCLEPFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQSVRKLADVMILTVFCLSVFALIGLQLF 268          

HSP 5 Score: 58.151 bits (139), Expect = 1.287e-7
Identity = 76/335 (22.69%), Postives = 143/335 (42.69%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNG-------DIHI---LYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            +RKT  +++ H  F   ++  I+++   +A        +      +EY   VFT I+ LE  +K I+ G       Y  + W WLDF+++ ++ +        +   G + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    KCV   N T      +   N +D                      Q  N T   W            TK         NFDN  +  L   ++ T   W  +    + + G       +I++   LYF++ I FGSF+ +N+ + ++  +++  +  I  ++
Sbjct: 1125 LRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIEQRKVVKVVLEYADKVFTYIFVLEMFLKWIAYGFK----KYFTNYWCWLDFLIVDVSLISLVANSLGYSDFGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGK-FGKCV---NRTGYIHNASIVNNKSDC---------------------QSMNDTQFYW------------TKVK------VNFDNVGLGYLSLLQVATFKGWMEIMYAAVDSRGVEEQPIKEINLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKRKIGGQD 1412          
BLAST of scna-1 vs. Ensembl Cavefish
Match: ENSAMXT00000006401.2 (sodium channel protein type 4 subunit alpha B-like [Source:NCBI gene;Acc:103028834])

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 554/1185 (46.75%), Postives = 755/1185 (63.71%), Query Frame = 3
Query: 2310 FCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKK------------LIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPN-------------------------FISKLLRKC--YDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVK-YMKAYTER-LKQ 5711
            F  W CC  + +F+  V  I++DPFV+L IT+CIV+NTV M+++    + E    L   N  FT  F  E  LKLIA+ P  YFQ  WN+FD IIV +SLVE+ L +  G+S+LR+FRL+RVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLF   Y   K+     S     PRW+  DF HSF+IVFR+LCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF  +++    DD  E N LQ AI RI RA+ WVK  +      ++ + G   V+K KK            L+ +H M +   +       E ++   VK+P   ++  E  F+    +T     DED + +E   +  +  +D   +                         +  K +R+C   D+      G+ WW  R     +VEH +FETFII MI++SS  L  ED  L  R  +K+ LE  D+VFT IF  EMLLKW A+G   YF +AWCWLDF+IV ++L+SL  + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSIFNV+LVCL+FWLIFSI+G+ LF GKFY C+N  + E    E++ NK+ C ++     +  W N ++N+DNV  GYL L QVATFKGW++IM  AVDS  + +QPSY  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK ++GG  ++FMTEDQKKYYNAMKK+ S  PQKPIPRP+      +F +   Q FDI IM +I LN I M  E  +Q  +++  L  IN  FIVIFTGE  LK+IA R YYF V WN+FDF++VILSI+   +  ++    VSPT  RV+R+ RIGR+LRL++ AKGIRTLLF+L++SLPAL NI LLL +IMFI++I GMS F+ V     ID++FNFETFG ++I LF I+TS GW+G+L+ ++N  P  C+ +        +G CG+  + +V+  +Y++ISFLV++NMYIA+ILENF+ AT++  E L +DD+++FYE WE +D  A  FI+   L DF + +  PL IPKPN+++L  +++P+   D ++C+D+L  LT   LG+    D+ +  + +        KV    ++ TL+R++E  AA VI + Y K   +R LKQ
Sbjct:  553 FLKWDCCTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLVELGLANVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSY---KSCVCKISEDCELPRWHMTDFFHSFLIVFRILCGEWIETMWDCMEVAGQGMCIVVFMMVMVIGNLVVLNLFLALLLSSFSGDNMAS--DDDGEMNNLQIAIGRITRAVDWVKATVT---GQARSVLGLKPVEKEKKGNDEDDFRCNNDLVLTH-MESGDKLD---GAAERAIVLSVKVP---MAKRESDFESPYDDTSD---DEDKKADEKSKLKDSGGDDSSCSTVDKPPEVEEAESEEEEDPTTPEDCYTEKCIRRCPCLDLDITQGRGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGYSE--LGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYHCINTTSEELFPPEVVNNKSECFLLIEGGYDARWVNQKVNYDNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKLGGQ-DLFMTEDQKKYYNAMKKLGSKKPQKPIPRPQNCCQGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDCDPDIQNPGSDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFNVATEESGEPLCEDDFEMFYETWERFDPDASQFIAYSSLSDFCDTLKDPLRIPKPNTIKLITMDLPMVPGDKIHCLDILLALTAEVLGESEAMDSLKATMEEKFMANNPSKVSYEPITTTLRRKQEEVAAVVIQRAYRKHVLKRTLKQ 1716          

HSP 2 Score: 338.961 bits (868), Expect = 1.036e-93
Identity = 193/394 (48.98%), Postives = 266/394 (67.51%), Query Frame = 3
Query:  321 IKKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCV------KSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNW------LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            I+  ++D+PK P+  LE GKSLP   GD  P  +L  +PL +LDP+Y  ++TF+VI+   TI RF+   A Y+L+P +P+R+ AIR+L H +FS  ++ TI+ NCVFM  ++    S  +EYVFT IYT E  IK +SRG  I +FT+LRD WNWLDF+VI +AYL  F   LGN+SALR+ RVLRALKT+T +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L +KCV         N T        F +   A       E+ NNE N+      +D L  C N + +     CPEGY+C++    NPNYGYT++DNF  + L  FRLMTQD+WENL+QLT+R+ G  ++++F+++IF GSFYLIN+ILA+VAM+Y +
Sbjct:   43 IEVAEEDLPK-PSSDLEAGKSLPFIYGD--PPPELLNVPLEDLDPYYKAQKTFIVISKGNTINRFNAESACYILNPFSPVRRGAIRILIHSLFSMFIMVTILSNCVFMTMSNPPEWSKIMEYVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD-LGNVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVVWPPVFPLINGTTNMNATASFSDKLYANSSFDYEEYINNEENYYFIPGSMDALL-CGNSSDS---GRCPEGYMCLKAGR-NPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRSAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAE 427          

HSP 3 Score: 80.1073 bits (196), Expect = 2.663e-14
Identity = 73/284 (25.70%), Postives = 127/284 (44.72%), Query Frame = 3
Query: 3678 EILDKVFTIIFTAEMLLK----WFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVN-NDTFERISAEIIPNKNACLIMKAMYGNVSWE-----NSQLNF-------DNVL-----------NGYLC-----------------------LFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVI 4373
            +I++ VFT I+T E L+K     F  G   + +D W WLDF+++++A ++  +         +G   A+RT R LR L+ ++   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV     F  I+     N  A    K +Y N S++     N++ N+       D +L            GY+C                       LF++ T   W  +    + S G            Y  +FV  I  G+F+ +NL + V+
Sbjct:  157 KIMEYVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD--------LGNVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVVWPPVFPLINGTTNMNATASFSDK-LYANSSFDYEEYINNEENYYFIPGSMDALLCGNSSDSGRCPEGYMCLKAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRSAG----------KTYMIFFVVIIFLGSFYLINLILAVV 421          

HSP 4 Score: 63.1586 bits (152), Expect = 3.415e-9
Identity = 42/155 (27.10%), Postives = 83/155 (53.55%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            I++     +FI + I+ N V M++  P   PE +  ++   Y FT  +  EA +K+++    +G   + ++ WN  DF+++ ++ +   +D   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF
Sbjct:  126 ILIHSLFSMFIMVTILSNCVFMTMSNP---PEWSKIME---YVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLGNVSALRTFRVLRAL---KTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLF 271          

HSP 5 Score: 54.6842 bits (130), Expect = 1.322e-6
Identity = 74/326 (22.70%), Postives = 147/326 (45.09%), Query Frame = 3
Query:  561 RKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVC-IQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWE-NLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            RKT   ++ H  F   ++  I+++   +A        + +    +EY   VFT I+ +E  +K  + G      TY  +AW WLDF+++ ++ +     +  +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + M++ +    IF ++G+ L+ G     C+ + +  L  F P    N         K E F       D     Q   Y+        GY+  +Q  T      +  + + + + + +  +  Q  +E NLY            +YF++ I FGSF+ +N+ + ++  +++  +  +  ++
Sbjct:  987 RKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFK----TYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYH-CINTTSEEL--FPPEVVNN---------KSECFLLIEGGYDARWVNQKVNYDNVGM----GYLSLLQVAT------FKGWMDIMYAAVDSRNVEDQPSYEINLYMY----------IYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKLGGQD 1276          
BLAST of scna-1 vs. Ensembl Cavefish
Match: ENSAMXT00000006399.2 (sodium channel protein type 4 subunit alpha B-like [Source:NCBI gene;Acc:103028834])

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 555/1172 (47.35%), Postives = 748/1172 (63.82%), Query Frame = 3
Query: 2310 FCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKK------------LIKSHPMWNAHNIKCEKSYYELSV-------SNDVKIPEEQLSNPELWFKYSLKET-----EVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKC--YDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVK-YMKAYTER-LKQ 5711
            F  W CC  + +F+  V  I++DPFV+L IT+CIV+NTV M+++    + E    L   N  FT  F  E  LKLIA+ P  YFQ  WN+FD IIV +SLVE+ L +  G+S+LR+FRL+RVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLF   Y   K+     S     PRW+  DF HSF+IVFR+LCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF  +      DD  E N LQ AI RI RA+ WVK  +      ++ + G   V+K KK            L+ +H           +    LSV        +D + P +  S+ E      LK++          D+ PE+ E E      P      +  K +R+C   D+      G+ WW  R     +VEH +FETFII MI++SS  L  ED  L  R  +K+ LE  D+VFT IF  EMLLKW A+G   YF +AWCWLDF+IV ++L+SL  + +G     +G  K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSIFNV+LVCL+FWLIFSI+G+ LF GKFY C+N  + E    E++ NK+ C ++     +  W N ++N+DNV  GYL L QVATFKGW++IM  AVDS  + +QPSY  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK ++ G  ++FMTEDQKKYYNAMKK+ S  PQKPIPRP+      +F +   Q FDI IM +I LN I M  E  +Q  +++  L  IN  FIVIFTGE  LK+IA R YYF V WN+FDF++VILSI+   +  ++    VSPT  RV+R+ RIGR+LRL++ AKGIRTLLF+L++SLPAL NI LLL +IMFI++I GMS F+ V     ID++FNFETFG ++I LF I+TS GW+G+L+ ++N  P  C+ +        +G CG+  + +V+  +Y++ISFLV++NMYIA+ILENF+ AT++  E L +DD+++FYE WE +D  A  FI+   L DF + +  PL IPKPN+++L  +++P+   D ++C+D+L  LT   LG+    D+ +  + +        KV    ++ TL+R++E  AA VI + Y K   +R LKQ
Sbjct:  533 FLKWDCCTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLVELGLANVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSY---KSCVCKISEDCELPRWHMTDFFHSFLIVFRILCGEWIETMWDCMEVAGQGMCIVVFMMVMVIGNLVVLNLFLALLLSSFSGD--NMASDDDGEMNNLQIAIGRITRAVDWVKATVT---GQARSVLGLKPVEKEKKGNDEDDFRCNNDLVLTHMESGDKLDGAAERAIVLSVKVPMAKRESDFESPYDDTSDDE---DKKLKDSGGDDSSCSTVDKPPEVEEAESEEEEDPTTPEDCYTEKCIRRCPCLDLDITQGRGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGYSE--LGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYHCINTTSEELFPPEVVNNKSECFLLIEGGYDARWVNQKVNYDNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKIRGQ-DLFMTEDQKKYYNAMKKLGSKKPQKPIPRPQNCCQGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDCDPDIQNPGSDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFNVATEESGEPLCEDDFEMFYETWERFDPDASQFIAYSSLSDFCDTLKDPLRIPKPNTIKLITMDLPMVPGDKIHCLDILLALTAEVLGESEAMDSLKATMEEKFMANNPSKVSYEPITTTLRRKQEEVAAVVIQRAYRKHVLKRTLKQ 1690          

HSP 2 Score: 328.561 bits (841), Expect = 1.947e-90
Identity = 193/410 (47.07%), Postives = 266/410 (64.88%), Query Frame = 3
Query:  321 IKKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHP----------------VFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCV------KSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNW------LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            I+  ++D+PK P+  LE GKSLP   GD  P  +L  +PL +LDP+Y  ++TF+VI+   TI RF+   A Y+L+P +P+R+ AIR+L H                 +FS  ++ TI+ NCVFM  ++    S  +EYVFT IYT E  IK +SRG  I +FT+LRD WNWLDF+VI +AYL  F   LGN+SALR+ RVLRALKT+T +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L +KCV         N T        F +   A       E+ NNE N+      +D L  C N + +     CPEGY+C++    NPNYGYT++DNF  + L  FRLMTQD+WENL+QLT+R+ G  ++++F+++IF GSFYLIN+ILA+VAM+Y +
Sbjct:   43 IEVAEEDLPK-PSSDLEAGKSLPFIYGD--PPPELLNVPLEDLDPYYKAQKTFIVISKGNTINRFNAESACYILNPFSPVRRGAIRILIHSYPLNIFLIVCHFLKVKLFSMFIMVTILSNCVFMTMSNPPEWSKIMEYVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD-LGNVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVVWPPVFPLINGTTNMNATASFSDKLYANSSFDYEEYINNEENYYFIPGSMDAL-LCGNSSDS---GRCPEGYMCLKAGR-NPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRSAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAE 443          

HSP 3 Score: 123.25 bits (308), Expect = 1.955e-27
Identity = 121/480 (25.21%), Postives = 205/480 (42.71%), Query Frame = 3
Query: 3678 EILDKVFTIIFTAEMLLK----WFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVN-NDTFERISAEIIPNKNACLIMKAMYGNVSWE-----NSQLNF-------DNVL-----------NGYLC-----------------------LFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQ------------------------------------KKRVGGSLEMFMTEDQKKYYN------AMKKMSSTAP-QKPIP----------------RPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQR-WYYFKVPWNMFDFVIVILSIV 4781
            +I++ VFT I+T E L+K     F  G   + +D W WLDF+++++A ++  +         +G   A+RT R LR L+ ++   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV     F  I+     N  A    K +Y N S++     N++ N+       D +L            GY+C                       LF++ T   W  +    + S G            Y  +FV  I  G+F+ +NL + V+   +  Q                                    KK+  GS E  +T+D            A+K++      ++P P                 P ++    ++ I ++   D+ I   I+LNT+ M +EH+    + ++ L   N VF  IFT E +LKLIA   +YYF+V WN+FD +IV +S+V
Sbjct:  173 KIMEYVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVD--------LGNVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVVWPPVFPLINGTTNMNATASFSDK-LYANSSFDYEEYINNEENYYFIPGSMDALLCGNSSDSGRCPEGYMCLKAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRSAG----------KTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATKAEAKAKEEEYEIMLEQLRKHAEACVCTSLSSKKKDDGSSEHDLTDDGGGRVRTQHDSIALKEVCELEELERPCPPCWYTFADIFLKWDCCTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLV 633          

HSP 4 Score: 61.6178 bits (148), Expect = 1.098e-8
Identity = 41/147 (27.89%), Postives = 80/147 (54.42%), Query Frame = 3
Query: 2391 LFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            +FI + I+ N V M++  P   PE +  ++   Y FT  +  EA +K+++    +G   + ++ WN  DF+++ ++ +   +D   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF
Sbjct:  150 MFIMVTILSNCVFMTMSNP---PEWSKIME---YVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLGNVSALRTFRVLRAL---KTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLF 287          

HSP 5 Score: 56.6102 bits (135), Expect = 3.103e-7
Identity = 78/328 (23.78%), Postives = 145/328 (44.21%), Query Frame = 3
Query:  561 RKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL-----MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVC---IQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWE-NLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            RKT   ++ H  F   ++  I+++   +A        + +    +EY   VFT I+ +E  +K  + G      TY  +AW WLDF+++ ++ +     +  +  LG + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + M++ +    IF ++G+ L+ G     C+ + +  L  F P    N         K E F       D     Q   Y+        GY+    + T  G  +  Y   D+  V          Q  +E NLY            +YF++ I FGSF+ +N+ + ++  +++  +  I+ ++
Sbjct:  961 RKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFK----TYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYH-CINTTSEEL--FPPEVVNN---------KSECFLLIEGGYDARWVNQKVNYDNVGM----GYLSLLQVATFKGWMDIMYAAVDSRNVE--------DQPSYEINLYMY----------IYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKIRGQD 1250          
BLAST of scna-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007955.1 (pep scaffold:Pmarinus_7.0:GL476358:329878:417380:1 gene:ENSPMAG00000007100.1 transcript:ENSPMAT00000007955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 497.664 bits (1280), Expect = 1.093e-145
Identity = 328/785 (41.78%), Postives = 454/785 (57.83%), Query Frame = 3
Query: 2226 SALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQI----RFAIKLS------KEIFGRCIVKKRKKLIKSHP-------MWNAHNIKCEKSYYELSVSNDVKIPEEQL---SNPELWFKY--SLKETEVPKFDEDPEINEVEIIYSTS---------------------------------PEDCLPNFISKLLRKC-YDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQ----PSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFN 4388
            SA+S L+    E +  ++     W      +  W CC  + K + ++ +I++DPFV+L IT+CI++NT+ M+++    +PE ++ L   N  FT  F  E  LK+ A  P  YFQ+ WN+FD IIV LSL+E+ L S  G+S+LR+FRLLRVFKLAKSW T+N+L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y   K      S     PRW+ +DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F+M M++GNLV+LNLFLALLLSSF  ++L   +DD  E N LQ AI RI R + ++K  I    R A+K S      K +     + K +  + +H        + + + +    +    S+ N   +  ++L   +NP L  +   ++ E++    DE+ E  + +I  S                                   PE+C           C  DV   T  GR WWN R    ++VEH +FE+ I+ MI++SS  L  ED  +  R  +K  LE  DKVFT +F  EMLLKW A+G  KYF +AWCWLDF+IV I++VSL+ + +G     + A K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+ LF GK+Y C+N    +R+   I+ N + C+ +        W+N ++NFDNV  GYL L QVATFKGW++IM  AVDS          P Y+ + + Y  F+    F +    +L+       FN
Sbjct:  699 SAISVLTNTMEELEESRQNCPPCWYKFANKYLIWECCSLWMKVKEILKMIVMDPFVDLSITICIILNTLFMALEHYPMTPEFDNALFVGNLVFTGIFTAEMVLKIAAQDPYYYFQQGWNIFDSIIVSLSLMELGLSSVDGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKMY---KECVCKISENCTLPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLVVLNLFLALLLSSFSGDNLSATDDDG-EMNNLQVAIGRIERGVSFIKRSICDVFRKALKRSCDNEEMKALDDLGGLDKMEIYVGNHTGVQGESIVKDGNGVASGAAGVGNSLKNHHVLDVDRLGFLTNPNLGVRVPIAVGESDFENRDEEDEKTQKQIGKSEQKLDTVSSSEGSTVDIQKEGVVEVPVELVEEMMEPEECFTEGCLHRFPYCRLDV--GTDRGRSWWNLRRACYRIVEHNWFESVIVFMILLSSGALAFEDIYIEQRKTIKTVLEYADKVFTYVFILEMLLKWVAYGFQKYFTNAWCWLDFLIVDISIVSLMATALGYDQ--LSAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFSGKYYYCLNKTDGQRLPISIVDNYSMCIALNDTTNETLWKNVKVNFDNVGIGYLALLQVATFKGWMDIMYAAVDSRDTRVNVLVVPHYSTAALIYEMFILACFFHSSLKAHLYRPFSSSTFN 1475          

HSP 2 Score: 333.954 bits (855), Expect = 1.074e-92
Identity = 201/415 (48.43%), Postives = 263/415 (63.37%), Query Frame = 3
Query:  261 PEVIISNENIESDLHSHYTPIKKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHP----VFSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKC----------VKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYD 1454
            PE + + E   +   +      + +DD PK P+  LEVGKSLP   GD  P  +    PL +LDPFY  ++TF+V+ S K IFRFS T A Y+L+P NP+R+ AI++LTH     +FS  ++ TI+ NCVFM  +     +  VEY FT IYT E  +K ++RG  ++ FT+LRD WNWLDF VI +AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL++AVKQL D M+LTVF LS+F LIGLQL+ G L  KC          V  FN T    EP  +EN  + E    K E   +          C N +      SCPE +VC++    NPNYGYT+FD F  + L  FRLMTQDYWENLYQLT+R  G  +I +FM+VIF GSFYLIN+ILA+VAM+Y+
Sbjct:   19 PESLAAIEQRAAHEQAKKAKGFESEDDQPK-PSSDLEVGKSLPFMYGDMPP--ECVAEPLEDLDPFYSTQKTFIVLNSGKAIFRFSATPALYILTPFNPVRRYAIKILTHSWQRTLFSIFIMFTILTNCVFMTMSEPPTWTKNVEYTFTGIYTFESMVKILARGFCLHPFTFLRDPWNWLDFCVIVMAYVTEFID-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQAVKQLSDVMILTVFCLSVFALIGLQLFMGNLRHKCILWPIANQTNVTEFNETA---EPFNWENYVNNEDNQYKLEGSKDAL-------LCGNGSD---AGSCPEKFVCVKGGR-NPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKPYI-FFMVVIFLGSFYLINLILAVVAMAYE 414          

HSP 3 Score: 228.794 bits (582), Expect = 2.433e-60
Identity = 140/316 (44.30%), Postives = 212/316 (67.09%), Query Frame = 3
Query: 4770 LSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY 5693
            L +V   +  M+    VSPT  RV+R+ RIGRILRL++ AKGIRTLLF+L++SLPAL NI LLL ++MFIY+I GMS F+ V     ID++FNFETFG +MI LFQI+TS GW+G+L  ++N     C+ E        KG CG+ ++ +++ +SY+IISFLV++NMYIA+ILENFS AT++  E L++DD+++FYE WE++D  A  FI+ + L DF + +D+PL +PKPN ++L  +++P+  ND ++C+D+L   T+R LG+    D  +  +          K     ++ TL+R++E  A +VI +  + +
Sbjct: 1552 LCVVRIMLADMIQKYFVSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGVPDCDPEIEHPGSLVKGDCGNPMVGIIFFVSYIIISFLVVVNMYIAIILENFSVATEESSEPLSEDDFEMFYEIWEKFDPDATQFIAWERLPDFADALDEPLRVPKPNKIKLIAMDLPMVINDRIHCLDILFAFTKRVLGEGAGMDALKTQMEDRFMAANPSKTSYEPITTTLRRKQEEVAVRVIQRAYRRH 1867          

HSP 4 Score: 77.7962 bits (190), Expect = 2.933e-14
Identity = 68/270 (25.19%), Postives = 120/270 (44.44%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLN----KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV------------NNDTFERISAEIIPN-----------KNACLIMKA------------MYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVI 4373
            ++  FT I+T E ++K  A G       + +D W WLDF ++ +A V+  +         +G   A+RT R LR L+ +S   G++ +V ALIQA+  + +V+++ +    +F++IG+QLF G   +KC+             N+T E  + E   N           K+A L                + G  +      +FD     +L LF++ T   W  +    + + G   +P        Y +F+  I  G+F+ +NL + V+
Sbjct:  159 VEYTFTGIYTFESMVKILARGFCLHPFTFLRDPWNWLDFCVIVMAYVTEFID--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQAVKQLSDVMILTVFCLSVFALIGLQLFMGNLRHKCILWPIANQTNVTEFNETAEPFNWENYVNNEDNQYKLEGSKDALLCGNGSDAGSCPEKFVCVKGGRNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAG---KP--------YIFFMVVIFLGSFYLINLILAVV 409          

HSP 5 Score: 72.7886 bits (177), Expect = 9.248e-13
Identity = 59/247 (23.89%), Postives = 102/247 (41.30%), Query Frame = 3
Query: 3783 DFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNH-----------STIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQ 4490
            D  +V I L  ++  Y  +       F+ +R  R  R LR +   +G+R ++ AL+ ++P++FN+ L+  +   I+SI GM  F                               A     S  +   NF+   N  +CLFQ+ T  GW  ++A  ++S      P   H             +   +FVS+II      +N++I +I++NF+V  +    S E    +D + +Y   +K    A Q
Sbjct: 1551 DLCVVRIMLADMIQKYFVSPT----LFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNF-------------------------------AYVKKESGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGVPDCDPEIEHPGSLVKGDCGNPMVGIIFFVSYIIISFLVVVNMYIAIILENFSVATEE---SSEPLSEDDFEMFYEIWEKFDPDATQ 1759          

HSP 6 Score: 71.2478 bits (173), Expect = 2.276e-12
Identity = 54/195 (27.69%), Postives = 89/195 (45.64%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF-------------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            KTF         F+F +  AL IL PF                     +FI   I+ N V M++  P        + K   Y FT  +  E+ +K++A G    P  + ++ WN  DF +++++ V   +D   +S LR FR+LR  K   +   +  L  I+G  + A+  L  V+ + +F   +FA++G+QLF
Sbjct:   86 KTFIVLNSGKAIFRFSATPALYILTPFNPVRRYAIKILTHSWQRTLFSIFIMFTILTNCVFMTMSEPPT------WTKNVEYTFTGIYTFESMVKILARGFCLHPFTFLRDPWNWLDFCVIVMAYVTEFIDLGNVSALRTFRVLRALK---TISVIPGLKTIVGALIQAVKQLSDVMILTVFCLSVFALIGLQLF 271          

HSP 7 Score: 64.3142 bits (155), Expect = 3.127e-10
Identity = 37/98 (37.76%), Postives = 58/98 (59.18%), Query Frame = 3
Query: 4512 LKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQR-WYYFKVPWNMFDFVIVILSIVFWAIESM 4802
            +K+  I+  I ++   D+ I   I+LNT+ M +EH+    +   AL   N VF  IFT E +LK+ AQ  +YYF+  WN+FD +IV LS++   + S+
Sbjct:  739 MKVKEILKMIVMDPFVDLSITICIILNTLFMALEHYPMTPEFDNALFVGNLVFTGIFTAEMVLKIAAQDPYYYFQQGWNIFDSIIVSLSLMELGLSSV 836          

HSP 8 Score: 52.7582 bits (125), Expect = 1.171e-6
Identity = 43/169 (25.44%), Postives = 88/169 (52.07%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLG-----NXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRG 1016
            +R+   R++ H  F  +++  I+++   +A        + +    +EY   VFT ++ LE  +K ++ G       Y  +AW WLDF+++ ++ +      LG      + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G
Sbjct: 1191 LRRACYRIVEHNWFESVIVFMILLSSGALAFEDIYIEQRKTIKTVLEYADKVFTYVFILEMLLKWVAYGFQ----KYFTNAWCWLDFLIVDISIVSLMATALGYDQLSAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFSG 1355          
BLAST of scna-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008004.1 (pep scaffold:Pmarinus_7.0:GL477228:88466:118438:1 gene:ENSPMAG00000007222.1 transcript:ENSPMAT00000008004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 494.197 bits (1271), Expect = 1.145e-145
Identity = 274/694 (39.48%), Postives = 437/694 (62.97%), Query Frame = 3
Query: 3633 EDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQ-------KPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY 5693
            +DK   S   L   L  +D  +   F+ EM LK    GL+KYF   W  LD  +V ++     L+ + +    + + +++RTLRALRPLRA+SRW+GMR+VVNAL+ +IPSI NV+L+CL+FW++F I G+QLFGGKF++C++ +   R+ A  + N+  C  + A      W N+ +N+DN+L+ YL L QVAT +GWIE MADA DSTG+  QPSYN +     +F+ F+I G+FF LNLFIGV+IDNFN   KR  G+L   +TEDQ+K+Y  M+++  + P K IP+P+ ++    + +   + F+    +VI LN +++  EH+ Q E        IN VF  +F  E  LK++  R +YF+ PW++FDF +V +S+    +E+M + +  SP  +RV RV R+ R+LRL++S +GIR L+++L++SLPAL+NI LLL++IMF+Y ++G+S F ++ YS SI  + NFETF  +M +LF+++T+GGWN V+  ++    +          + I+ + Y  +++I S ++IINMY+A+ILENF++A +  + G+T DD D+FY  W ++D  A  F++ + L +F + + +P  IPKPN+V++A L++ I + + V+C+D+L+ +TR   G+       +  +   +  + +  P  +I  V    VS TL  +RE  AA VI +  + +
Sbjct: 1041 DDKYNSSNAQLMQVLRYMDIFYMAFFSMEMFLKMIGLGLHKYFTSFWTLLDCFLVLVSW----LNQLASAVPALKSLRSLRTLRALRPLRAISRWKGMRLVVNALVTSIPSISNVMLMCLLFWMVFGIAGVQLFGGKFFRCIDAEG-NRLPATEVANRTVCESLAA--EGYLWVNAIINYDNILSAYLALLQVATLEGWIEQMADASDSTGVDQQPSYNANIYSQMFFIIFVIIGSFFILNLFIGVVIDNFNSVHKR-EGALMALLTEDQQKFYKTMRRLYRSKPSKSIPQPQNRVLRFFYLLVHRRLFEYISTAVISLNMVMLASEHYKQSESFTNITKIINLVFTGLFMLEAALKILGNRIHYFRQPWDIFDFFVVCISLTEIVLETMASQVNFSPAILRVFRVVRLVRLLRLIRSVEGIRKLIYTLVISLPALINIGLLLLLIMFMYGVLGVSIFRDLPYSGSITNMVNFETFANSMTLLFRLNTAGGWNDVMGSVLGTKTQ----------NAILVIAYFTTFVIFSNIIIINMYVAIILENFNEAQEQEETGVTDDDIDMFYRVWGKFDPLATQFLACEQLPNFFDALKRPFRIPKPNTVKIAALQLAIVEGNKVHCLDVLKTMTRVIFGRVVKTEHLRQLSRQAQEKVMRRFPLRRIMHV----VSTTLALRREEKAAHVIQRAFRHW 1712          

HSP 2 Score: 204.142 bits (518), Expect = 7.045e-53
Identity = 111/255 (43.53%), Postives = 156/255 (61.18%), Query Frame = 3
Query: 2265 KVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSSG-----MSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLV-NGYQCVPFFLMTMI 3011
             VR     ++ L+    S  CC  +  F+  +  ++     E FIT+ I+ NTV+M+ID   N+P  +  L   N   TT F  EA LKL AL P  YF   WN+FDF +VI S+VE  LDS       +S++R FR+LRVFKLAK W+T+NLL  ++ + +G + NL ++  ++I+IFAV+GMQL G  Y  + N   F S  G  PRWNF DF  SF++VFRVLCGEWIE +++C++  N Y C+P F++T I
Sbjct:  530 SVRAARRPRERLVACLNSLRCCSAFVAFRQRLRTLVTSSVFETFITILIITNTVMMAIDY-YNAP-YSSALDIGNTVLTTIFIAEAVLKLTALFPRVYFHLGWNIFDFCVVITSVVEWILDSMSNTNINISIIRTFRILRVFKLAKKWKTLNLLIRVMKSAIGEMRNLTVIFALVIYIFAVIGMQLIGRDY--YHNRNKFSS--GQVPRWNFLDFYSSFLMVFRVLCGEWIEPLYECLVCSNIYYCIPLFILTYI 778          

HSP 3 Score: 181.03 bits (458), Expect = 9.489e-46
Identity = 112/265 (42.26%), Postives = 166/265 (62.64%), Query Frame = 3
Query:  675 YVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNE-FENLTDAEKWTVKYEFFNNETNWLDP----LRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYD 1454
            Y+FT IYT EF IK ++RG + + ++YLR+AWNWLDFIVI LAY+   FP L  LSALR+ R L   K +  +P +KT+VGA+ ++   L + M+L +F L I  L GLQ++RG L +KCV         F PN    +L+DAE W+    +  N++NWL      +  C N T     + CP  Y C+     NPN+G T+FDNF  +++ +F+++T DYWEN Y + +R +G   I +F++VI  G +Y++N++LA+VA SY+
Sbjct:    1 YIFTAIYTGEFLIKTLARGFVFHPYSYLRNAWNWLDFIVIILAYMTIAFPFLPGLSALRAFRAL---KMIAILPALKTIVGAIFKSAGLLLNVMLLMIFALIIISLFGLQIFRGVLRQKCV---------FLPNPGTSSLSDAE-WS---NYVQNKSNWLITDDIEIMVCGNGT---GTSHCPANYTCLPDIGENPNHGATSFDNFGWAMMTSFQIITIDYWENCYNMVLRASGQYFIGFFIVVIMLGGYYVVNLVLAVVASSYE 246          

HSP 4 Score: 76.2554 bits (186), Expect = 7.021e-14
Identity = 56/241 (23.24%), Postives = 107/241 (44.40%), Query Frame = 3
Query: 2313 CSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNS--PEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLV-----EIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKY-------------SNFKNETLFPSFKGAEPRW-----NFNDFTHSFMIVFRVLCGE-WIESMWD 2957
            C   C   +   + +V  +         +   ++M++  +++D   NS   ++   L+  + F+   F +E FLK+I LG  +YF   W + D  +V++S +      +P   S  SL R  R LR  +    W+ M L+   + T++ +I N+ ++  +   +F + G+QLFG K+             +   N T+  S       W     N+++   +++ + +V   E WIE M D
Sbjct:  999 CCGGCVGAFHAVRRMVFRLCHTTGFNGLVLFMVIMSSFTLTLDDKYNSSNAQLMQVLRYMDIFYMAFFSMEMFLKMIGLGLHKYFTSFWTLLDCFLVLVSWLNQLASAVPALKSLRSL-RTLRALRPLRAISRWKGMRLVVNALVTSIPSISNVMLMCLLFWMVFGIAGVQLFGGKFFRCIDAEGNRLPATEVANRTVCESLAAEGYLWVNAIINYDNILSAYLALLQVATLEGWIEQMAD 1238          

HSP 5 Score: 66.6254 bits (161), Expect = 5.823e-11
Identity = 37/127 (29.13%), Postives = 68/127 (53.54%), Query Frame = 3
Query: 3693 VFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCV 4058
            +FT I+T E L+K  A G       Y ++AW WLDFI++ +A +++   ++            +  LRA R L+ ++    ++ +V A+ ++   + NV+L+ +   +I S+ G+Q+F G    KCV
Sbjct:    2 IFTAIYTGEFLIKTLARGFVFHPYSYLRNAWNWLDFIVIILAYMTIAFPFL----------PGLSALRAFRALKMIAILPALKTIVGAIFKSAGLLLNVMLLMIFALIIISLFGLQIFRGVLRQKCV 118          

HSP 6 Score: 65.4698 bits (158), Expect = 1.398e-10
Identity = 50/170 (29.41%), Postives = 85/170 (50.00%), Query Frame = 3
Query: 3543 RCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYK 4052
            R +   LV    FETFI ++II +++ + ++  N P       AL+I + V T IF AE +LK  A     YF   W   DF +V  ++V  +L  +      +     +RT R LR  +   +W+ + +++  +  AI  + N+ ++  +   IF++IGMQL G  +Y 
Sbjct:  558 RQRLRTLVTSSVFETFITILIITNTVMMAIDYYNAPYSS----ALDIGNTVLTTIFIAEAVLKLTALFPRVYFHLGWNIFDFCVVITSVVEWILDSMSNTNINI---SIIRTFRILRVFKLAKKWKTLNLLIRVMKSAIGEMRNLTVIFALVIYIFAVIGMQLIGRDYYH 720          

HSP 7 Score: 65.0846 bits (157), Expect = 1.627e-10
Identity = 39/98 (39.80%), Postives = 60/98 (61.22%), Query Frame = 3
Query: 4536 SITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQ-RWYYFKVPWNMFDFVIVILSIVFWAIESMLN-NIPVS 4823
            ++  +  F+ FI  +I+ NT++M I++++ P    +ALD  N V   IF  E +LKL A     YF + WN+FDF +VI S+V W ++SM N NI +S
Sbjct:  563 TLVTSSVFETFITILIITNTVMMAIDYYNAP--YSSALDIGNTVLTTIFIAEAVLKLTALFPRVYFHLGWNIFDFCVVITSVVEWILDSMSNTNINIS 658          

HSP 8 Score: 52.373 bits (124), Expect = 1.171e-6
Identity = 37/113 (32.74%), Postives = 59/113 (52.21%), Query Frame = 3
Query: 2490 YFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLD-SSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFG 2813
            Y FT  +  E  +K +A G    P  Y +  WN  DFI++IL+ + I      G+S LRAFR L++  +  + +T      I+G    + G L  V+  ++ IFA++ + LFG
Sbjct:    1 YIFTAIYTGEFLIKTLARGFVFHPYSYLRNAWNWLDFIVIILAYMTIAFPFLPGLSALRAFRALKMIAILPALKT------IVGAIFKSAGLLLNVM--LLMIFALIIISLFG 105          

HSP 9 Score: 52.373 bits (124), Expect = 1.242e-6
Identity = 72/332 (21.69%), Postives = 145/332 (43.67%), Query Frame = 3
Query:  540 LSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMA-----KNSNSDTVEYV------FTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYL---MFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYW-ENLYQLTIRT--------NGDIHI-LYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            +   + +R+   RL     F+ LVL  +I++   +       +SN+  ++ +      +   +++E  +K I  GL      Y    W  LD  ++ +++L       P L +L +LR+LR LR L+ ++   GM+ VV AL+ ++  + + M++ +    +FG+ G+QL+ G   R C+ +                               E N L P  +  N T  E  +   EGY+ +            N+DN + + L   ++ T + W E +   +  T        N +I+  ++F++ +  GSF+++N+ + +V  +++ V 
Sbjct: 1004 VGAFHAVRRMVFRLCHTTGFNGLVLFMVIMSSFTLTLDDKYNSSNAQLMQVLRYMDIFYMAFFSMEMFLKMIGLGL----HKYFTSFWTLLDCFLVLVSWLNQLASAVPALKSLRSLRTLRALRPLRAISRWKGMRLVVNALVTSIPSISNVMLMCLLFWMVFGIAGVQLFGGKFFR-CIDA-------------------------------EGNRL-PATEVANRTVCE--SLAAEGYLWVN--------AIINYDNILSAYLALLQVATLEGWIEQMADASDSTGVDQQPSYNANIYSQMFFIIFVIIGSFFILNLFIGVVIDNFNSVH 1288          
BLAST of scna-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002291.1 (pep scaffold:Pmarinus_7.0:GL476946:177790:226078:1 gene:ENSPMAG00000002078.1 transcript:ENSPMAT00000002291.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 483.797 bits (1244), Expect = 1.939e-142
Identity = 297/605 (49.09%), Postives = 417/605 (68.93%), Query Frame = 3
Query: 3927 RIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDS-TGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAI--ESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLN-GLMNEDPKVCNKEK--------GTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERL 5705
            ++VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+  F GKF KCVN+     ++  IIPN+NACL       ++ W+N  +NFDNV +GYL L QV+TFKGW++IM  AVDS      QP +  S  YY +FV FIIFGAFF LNLFIGVIIDNFN QKK+ GG  ++F+TE+Q+KY+NAMKK+ S  P+KP+PRP  K   + + +   Q F+I IM +I LN + M IE  +Q E +KTAL+  N VFI IFT E +LK+ A R Y+F  PWN+FDF +V LS+   A+   S L+NI V PT  RVVR+FR+GRILRL++ A+GIRTLLF+L++SLPAL NI LLL ++MFI+++ GMS F  + ++  IDE+FNFETFG +M+ LFQI+TS GW+G+L   L++++P  C  E         G CG+  I   + ++Y+IISFL+++NMYIAVILENF+ AT +  E L++DD+++FY+ W ++D  A  FIS   L +F++ +D+PL +PKPN + +A++++PI + D ++C+++L  LT+R LGQ    +     + +        +V    V+ TL+RQ++  AA   +K  KAY + L
Sbjct: 1066 QVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNFFKGKFSKCVNSTDDSTMNESIIPNQNACLEQSP---SLRWKNLPVNFDNVASGYLALLQVSTFKGWMDIMYAAVDSRQNNTEQPRFEESLGYYLFFVIFIIFGAFFILNLFIGVIIDNFNQQKKKFGGE-DIFLTEEQRKYHNAMKKLGSKKPRKPVPRPNNKYQGMAYDLVHWQAFEIGIMVLICLNMLTMMIEADEQSEAMKTALNITNIVFIGIFTTECVLKMFALRQYFFTFPWNVFDFAVVTLSVFDLAMADNSWLSNI-VEPTLFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNFGYLKHTAGIDEIFNFETFGGSMLCLFQITTSAGWDGLLAPTLLSKEPD-CEPEAVHVGTNVVGNCGNKAIGCAFFVTYIIISFLIVVNMYIAVILENFNVATAESSEPLSEDDFEMFYDIWGKFDPNATQFISFTELPNFIDSLDEPLRVPKPNQLAVAVMDLPIVEGDRIHCLEVLFALTKRVLGQGEGLEGLREQMEERFIAANPEQVNLEPVTTTLQRQQQEMAA---LKIQKAYRKYL 1661          

HSP 2 Score: 313.153 bits (801), Expect = 1.569e-86
Identity = 184/399 (46.12%), Postives = 253/399 (63.41%), Query Frame = 3
Query:  366 LEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK-------SFNHTLLYFEPNEFE-------NLTDAEKWTVKYEF-FNNETNWLDP--LRQCQNYTYNE----------WNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            LE  +++P   G+  P+K +S  PL +LDP+Y  K TF+V+   KTIFRF+  KA  L +  NPIR+ +I++LTH +F+ L++ TI+ NCVFMA N+    VEYVFT IY  E  +K ++RG     FTYLRD WNWLD  V+ +A      P   NLSALR  RV+RALKT++ VPG+KT+V AL+++VK+L D  +LT+F LSIF LI LQL++G L  KCV+       +F +   Y E  EF        N+T     T++  F F   +  L P       NY +++           N +CP+G++C +    NPNYGYTN+DNF  + L  FRLMTQDYWENLYQLT+R +G +++++F+MVIF GSFYLIN+ILA+VA SY++   A Q E
Sbjct:   56 LEADRTMPFVYGE-VPQKMISE-PLEDLDPYYRNKMTFLVLNKGKTIFRFNACKALCLFTVFNPIRRISIKILTHTLFTILIMATILTNCVFMAINTELKVVEYVFTAIYMFEALVKILARGFFFGAFTYLRDPWNWLDLAVLVIACFT-SIPGFANLSALRMFRVMRALKTISVVPGLKTIVRALIQSVKKLSDVTILTLFCLSIFALIALQLFKGNLKNKCVRWPIPGNSNFINISQYLEDKEFYRKRKRSCNVTWLGNRTLQTGFSFPCVSARLSPSYFISTDNYYFHKNVPLLCSNSSENNTCPDGFICFKAGK-NPNYGYTNYDNFGWAFLSLFRLMTQDYWENLYQLTLRASGKVYMIFFVMVIFLGSFYLINLILAVVAKSYEEQNQATQQE 450          

HSP 3 Score: 96.6709 bits (239), Expect = 4.394e-20
Identity = 83/291 (28.52%), Postives = 131/291 (45.02%), Query Frame = 3
Query: 3663 LKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKD-AWCWLDFIIVTIALVSLVL---SYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNH-----------STIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQ 4490
            +K AL I + VF  IFT E +LK FA  L +YF    W   DF +VT+++  L +   S++         F+ +R  R  R LR +   +G+R ++ AL+ ++P++FN+ L+  V   IFS+ GM  FG           + + +A I                    +   NF+      LCLFQ+ T  GW  ++A  + S     +P   H             I  A+FV++II      +N++I VI++NFNV       S E    +D + +Y+   K    A Q
Sbjct: 1299 MKTALNITNIVFIGIFTTECVLKMFA--LRQYFFTFPWNVFDFAVVTLSVFDLAMADNSWLSNIVEPT-LFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNFG-----------YLKHTAGI--------------------DEIFNFETFGGSMLCLFQITTSAGWDGLLAPTLLSKEPDCEPEAVHVGTNVVGNCGNKAIGCAFFVTYIIISFLIVVNMYIAVILENFNVATAE---SSEPLSEDDFEMFYDIWGKFDPNATQ 1552          

HSP 4 Score: 77.0258 bits (188), Expect = 4.572e-14
Identity = 59/219 (26.94%), Postives = 105/219 (47.95%), Query Frame = 3
Query: 2343 KFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMS---------LLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLV 2969
            K+Q +   ++     E+ I + I +N + M I+  + S  M   L   N  F   F  E  LK+ AL  + +F   WNVFDF +V LS+ ++ + D+S +S         ++R FR+ R+ +L +  Q +  L   +  ++ A+ N+ ++L +++FIF+V GM  FG                G +  +NF  F  S + +F++       + WD +L 
Sbjct: 1259 KYQGMAYDLVHWQAFEIGIMVLICLNMLTMMIEADEQSEAMKTALNITNIVFIGIFTTECVLKMFALR-QYFFTFPWNVFDFAVVTLSVFDLAMADNSWLSNIVEPTLFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNFG----------YLKHTAGIDEIFNFETFGGSMLCLFQIT----TSAGWDGLLA 1462          

HSP 5 Score: 74.7146 bits (182), Expect = 1.980e-13
Identity = 45/133 (33.83%), Postives = 70/133 (52.63%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFA----FGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV 4058
            L++++ VFT I+  E L+K  A    FG   Y +D W WLD  ++ IA          T   G     A+R  R +R L+ +S   G++ +V ALIQ++  + +V ++ L    IF++I +QLF G    KCV
Sbjct:  152 LKVVEYVFTAIYMFEALVKILARGFFFGAFTYLRDPWNWLDLAVLVIACF--------TSIPGFANLSALRMFRVMRALKTISVVPGLKTIVRALIQSVKKLSDVTILTLFCLSIFALIALQLFKGNLKNKCV 276          

HSP 6 Score: 55.4546 bits (132), Expect = 1.667e-7
Identity = 44/165 (26.67%), Postives = 75/165 (45.45%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDF-IIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETL 2846
            I+      + I   I+ N V M+I+T          LK   Y FT  +  EA +K++A     G   Y ++ WN  D  ++VI     IP   + +S LR FR++R  K       +  +   +  +V  + ++ I+    + IFA++ +QLF     N KN+ +
Sbjct:  125 ILTHTLFTILIMATILTNCVFMAINTE---------LKVVEYVFTAIYMFEALVKILARGFFFGAFTYLRDPWNWLDLAVLVIACFTSIP-GFANLSALRMFRVMRALKTISVVPGLKTIVRALIQSVKKLSDVTILTLFCLSIFALIALQLFK---GNLKNKCV 276          
BLAST of scna-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002303.1 (pep scaffold:Pmarinus_7.0:GL476946:177796:226078:1 gene:ENSPMAG00000002078.1 transcript:ENSPMAT00000002303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 484.952 bits (1247), Expect = 2.380e-142
Identity = 297/605 (49.09%), Postives = 417/605 (68.93%), Query Frame = 3
Query: 3927 RIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDS-TGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIE--SMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLN-GLMNEDPKVCNKEK--------GTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERL 5705
            ++VVNAL+ AIPSI NVLLVCL+FWLIFSI+G+  F GKF KCVN+     ++  IIPN+NACL       ++ W+N  +NFDNV +GYL L QV+TFKGW++IM  AVDS      QP +  S  YY +FV FIIFGAFF LNLFIGVIIDNFN QKK+ GG  ++F+TE+Q+KY+NAMKK+ S  P+KP+PRP  K   + + +   Q F+I IM +I LN + M IE  +Q E +KTAL+  N VFI IFT E +LK+ A R Y+F  PWN+FDF +V LS+   A+   S L+NI V PT  RVVR+FR+GRILRL++ A+GIRTLLF+L++SLPAL NI LLL ++MFI+++ GMS F  + ++  IDE+FNFETFG +M+ LFQI+TS GW+G+L   L++++P  C  E         G CG+  I   + ++Y+IISFL+++NMYIAVILENF+ AT +  E L++DD+++FY+ W ++D  A  FIS   L +F++ +D+PL +PKPN + +A++++PI + D ++C+++L  LT+R LGQ    +     + +        +V    V+ TL+RQ++  AA   +K  KAY + L
Sbjct: 1149 QVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNFFKGKFSKCVNSTDDSTMNESIIPNQNACLEQSP---SLRWKNLPVNFDNVASGYLALLQVSTFKGWMDIMYAAVDSRQNNTEQPRFEESLGYYLFFVIFIIFGAFFILNLFIGVIIDNFNQQKKKFGGE-DIFLTEEQRKYHNAMKKLGSKKPRKPVPRPNNKYQGMAYDLVHWQAFEIGIMVLICLNMLTMMIEADEQSEAMKTALNITNIVFIGIFTTECVLKMFALRQYFFTFPWNVFDFAVVTLSVFDLAMADNSWLSNI-VEPTLFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNFGYLKHTAGIDEIFNFETFGGSMLCLFQITTSAGWDGLLAPTLLSKEPD-CEPEAVHVGTNVVGNCGNKAIGCAFFVTYIIISFLIVVNMYIAVILENFNVATAESSEPLSEDDFEMFYDIWGKFDPNATQFISFTELPNFIDSLDEPLRVPKPNQLAVAVMDLPIVEGDRIHCLEVLFALTKRVLGQGEGLEGLREQMEERFIAANPEQVNLEPVTTTLQRQQQEMAA---LKIQKAYRKYL 1744          

HSP 2 Score: 313.923 bits (803), Expect = 1.362e-86
Identity = 180/374 (48.13%), Postives = 246/374 (65.78%), Query Frame = 3
Query:  366 LEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEP--NEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            LE  +++P   G+  P+K +S  PL +LDP+Y  K TF+V+   KTIFRF+  KA  L +  NPIR+ +I++LTH +F+ L++ TI+ NCVFMA N+    VEYVFT IY  E  +K ++RG     FTYLRD WNWLD  V+ +A      P   NLSALR  RV+RALKT++ VPG+KT+V AL+++VK+L D  +LT+F LSIF LI LQL++G L  KCV+       +  P  + F N++   +    Y F  N      PL  C N   +  N +CP+G++C +    NPNYGYTN+DNF  + L  FRLMTQDYWENLYQLT+R +G +++++F+MVIF GSFYLIN+ILA+VA SY++   A Q E
Sbjct:   54 LEADRTMPFVYGE-VPQKMISE-PLEDLDPYYRNKMTFLVLNKGKTIFRFNACKALCLFTVFNPIRRISIKILTHTLFTILIMATILTNCVFMAINTELKVVEYVFTAIYMFEALVKILARGFFFGAFTYLRDPWNWLDLAVLVIACFT-SIPGFANLSALRMFRVMRALKTISVVPGLKTIVRALIQSVKKLSDVTILTLFCLSIFALIALQLFKGNLKNKCVR-------WPIPGNSNFINISQYLEDKDNYYFHKNV-----PL-LCSN---SSENNTCPDGFICFKAGK-NPNYGYTNYDNFGWAFLSLFRLMTQDYWENLYQLTLRASGKVYMIFFVMVIFLGSFYLINLILAVVAKSYEEQNQATQQE 407          

HSP 3 Score: 97.0561 bits (240), Expect = 3.710e-20
Identity = 81/290 (27.93%), Postives = 129/290 (44.48%), Query Frame = 3
Query: 3663 LKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVL---SYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNH-----------STIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQ 4490
            +K AL I + VF  IFT E +LK FA     +F   W   DF +VT+++  L +   S++         F+ +R  R  R LR +   +G+R ++ AL+ ++P++FN+ L+  V   IFS+ GM  FG           + + +A I                    +   NF+      LCLFQ+ T  GW  ++A  + S     +P   H             I  A+FV++II      +N++I VI++NFNV       S E    +D + +Y+   K    A Q
Sbjct: 1382 MKTALNITNIVFIGIFTTECVLKMFALR-QYFFTFPWNVFDFAVVTLSVFDLAMADNSWLSNIVEPT-LFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNFG-----------YLKHTAGI--------------------DEIFNFETFGGSMLCLFQITTSAGWDGLLAPTLLSKEPDCEPEAVHVGTNVVGNCGNKAIGCAFFVTYIIISFLIVVNMYIAVILENFNVATAE---SSEPLSEDDFEMFYDIWGKFDPNATQ 1635          

HSP 4 Score: 88.5817 bits (218), Expect = 1.162e-17
Identity = 75/286 (26.22%), Postives = 125/286 (43.71%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFA----FGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV-----NNDTFERISAEIIP------NKNACLIMKAMYGNVSWENSQL-------------NFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQK 4445
            L++++ VFT I+  E L+K  A    FG   Y +D W WLD  ++ IA          T   G     A+R  R +R L+ +S   G++ +V ALIQ++  + +V ++ L    IF++I +QLF G    KCV      N  F  IS  +        +KN  L+      N +  +  +             N+DN    +L LF++ T   W  +    + ++G           +Y  +FV  I  G+F+ +NL + V+  ++  Q +      E    E Q+
Sbjct:  150 LKVVEYVFTAIYMFEALVKILARGFFFGAFTYLRDPWNWLDLAVLVIACF--------TSIPGFANLSALRMFRVMRALKTISVVPGLKTIVRALIQSVKKLSDVTILTLFCLSIFALIALQLFKGNLKNKCVRWPIPGNSNFINISQYLEDKDNYYFHKNVPLLCSNSSENNTCPDGFICFKAGKNPNYGYTNYDNFGWAFLSLFRLMTQDYWENLYQLTLRASG----------KVYMIFFVMVIFLGSFYLINLILAVVAKSYEEQNQATQQEAERKKDELQE 417          

HSP 5 Score: 77.0258 bits (188), Expect = 4.824e-14
Identity = 59/219 (26.94%), Postives = 105/219 (47.95%), Query Frame = 3
Query: 2343 KFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMS---------LLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLV 2969
            K+Q +   ++     E+ I + I +N + M I+  + S  M   L   N  F   F  E  LK+ AL  + +F   WNVFDF +V LS+ ++ + D+S +S         ++R FR+ R+ +L +  Q +  L   +  ++ A+ N+ ++L +++FIF+V GM  FG                G +  +NF  F  S + +F++       + WD +L 
Sbjct: 1342 KYQGMAYDLVHWQAFEIGIMVLICLNMLTMMIEADEQSEAMKTALNITNIVFIGIFTTECVLKMFALR-QYFFTFPWNVFDFAVVTLSVFDLAMADNSWLSNIVEPTLFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNFG----------YLKHTAGIDEIFNFETFGGSMLCLFQIT----TSAGWDGLLA 1545          

HSP 6 Score: 55.4546 bits (132), Expect = 1.493e-7
Identity = 73/310 (23.55%), Postives = 137/310 (44.19%), Query Frame = 3
Query: 2367 IILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDF-IIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLF----------------------------GDKYSNFKNETL--------------FPSFK-GAEPRW---NFNDFTHSFMIVFRVLCGEWIESMWDCML-VNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRI 3140
            I+      + I   I+ N V M+I+T          LK   Y FT  +  EA +K++A     G   Y ++ WN  D  ++VI     IP   + +S LR FR++R  K       +  +   +  +V  + ++ I+    + IFA++ +QLF                             D Y   KN  L              F  FK G  P +   N+++F  +F+ +FR++  ++ E+++   L  +G   + FF+M + LG+  L+NL LA++  S+  ++   +++   + ++LQE ++++
Sbjct:  123 ILTHTLFTILIMATILTNCVFMAINTE---------LKVVEYVFTAIYMFEALVKILARGFFFGAFTYLRDPWNWLDLAVLVIACFTSIP-GFANLSALRMFRVMRALKTISVVPGLKTIVRALIQSVKKLSDVTILTLFCLSIFALIALQLFKGNLKNKCVRWPIPGNSNFINISQYLEDKDNYYFHKNVPLLCSNSSENNTCPDGFICFKAGKNPNYGYTNYDNFGWAFLSLFRLMTQDYWENLYQLTLRASGKVYMIFFVMVIFLGSFYLINLILAVVAKSYEEQNQATQQEAERKKDELQEMLEQL 422          
BLAST of scna-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000617.1 (pep scaffold:Pmarinus_7.0:GL477322:572:57208:-1 gene:ENSPMAG00000000554.1 transcript:ENSPMAT00000000617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.166 bits (692), Expect = 2.990e-76
Identity = 163/394 (41.37%), Postives = 238/394 (60.41%), Query Frame = 3
Query:  366 LEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQT--FVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPV-FSFLVLTTIIINCVFMAKNSN------SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNE------WNTS----CPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETG 1490
            LE  + LP   GD    K+L   PL +LDPFY  + T  F+V+   K I+RF+ T + YL SP NP+R+ AI++L H   F+ +++ TI+ NCVFMA +        +    Y   TIY +E  IK ++RG  + +FT+LRD WNWLD +V+    + +  P    +S+L++ RVLR LKT++  PG+KT+V AL+++VK+L D ++LT+F LSIF LIG QL+ G L  KCV                       W      ++NET  L  L+   NY  ++       N+S    CPEGY+C++    NPN+G+TN+D+F  + L  FRLMTQD WE LYQ T+R++G +++++F+MVIF GSFYLIN+ILA+VA SY+D   A+Q ++  
Sbjct:   57 LEAERKLPFVYGDV--PKELISEPLEDLDPFYRNQMTSPFLVMNRKKRIYRFNATNSLYLFSPFNPVRRIAIKILIHIYPFTMVIVGTILTNCVFMAMDKKLNMPLWNKNSRYTMNTIYMMEVVIKVLARGFFMGQFTFLRDPWNWLDLLVVIFTIVTYVNPK-QKMSSLKTFRVLRVLKTISVFPGLKTIVKALIQSVKKLFDVIILTIFCLSIFALIGQQLFMGNLKNKCVL----------------------WPNGNRTWDNET--LAYLKDTNNYYKSDNQPILCGNSSGAGECPEGYLCLKIGE-NPNFGFTNYDHFGWAFLSLFRLMTQDSWEYLYQQTLRSSGKVYMIFFVMVIFLGSFYLINLILAVVAKSYEDQNRAMQNKDKA 422          

HSP 2 Score: 108.997 bits (271), Expect = 4.197e-24
Identity = 55/117 (47.01%), Postives = 76/117 (64.96%), Query Frame = 3
Query: 2319 WTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLL 2666
            W  CP + + + L  L+  DPF++L ITLCIV+NTV MS++    S +    L+  N FFT TF  E  LK+IA+ P  YFQE WN FD ++V +SLVE+ L D   +S+LR+FRL+
Sbjct:  707 WEWCPVWIRIKRLAKLVASDPFMDLAITLCIVLNTVFMSLEHDSMSEDFKKVLRNGNVFFTGTFTAEMVLKIIAMDPYYYFQEKWNQFDSVVVTVSLVEMWLPDFDNLSVLRSFRLV 823          

HSP 3 Score: 85.8853 bits (211), Expect = 5.887e-17
Identity = 68/280 (24.29%), Postives = 126/280 (45.00%), Query Frame = 3
Query: 3636 DKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV----NNDTFERISAEIIPNKN---ACLIMKAMYGNVS--------------WENSQL---NFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            DK L    W K +   ++ ++ +    ++L + F  G   + +D W WLD ++V   +V+ V               +++T R LR L+ +S + G++ +V ALIQ++  +F+V+++ +    IF++IG QLF G    KCV     N T++  +   + + N          + GN S               EN      N+D+    +L LF++ T   W  +    + S+G           +Y  +FV  I  G+F+ +NL + V+  ++  Q +
Sbjct:  153 DKKLNMPLWNKNSRYTMNTIYMMEVVIKVLARGFFMGQFTFLRDPWNWLDLLVVIFTIVTYV--------NPKQKMSSLKTFRVLRVLKTISVFPGLKTIVKALIQSVKKLFDVIILTIFCLSIFALIGQQLFMGNLKNKCVLWPNGNRTWDNETLAYLKDTNNYYKSDNQPILCGNSSGAGECPEGYLCLKIGENPNFGFTNYDHFGWAFLSLFRLMTQDSWEYLYQQTLRSSG----------KVYMIFFVMVIFLGSFYLINLILAVVAKSYEDQNR 414          

HSP 4 Score: 62.003 bits (149), Expect = 1.433e-9
Identity = 47/166 (28.31%), Postives = 82/166 (49.40%), Query Frame = 3
Query: 2364 LIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLF 2849
            LI + PF  + I   I+ N V M++D   N P  N   K + Y   T + +E  +K++A    +G   + ++ WN  D ++VI ++V        MS L+ FR+LRV K    +  +  +   +  +V  + ++ I+    + IFA++G QLF     N KN+ + 
Sbjct:  129 LIHIYPFT-MVIVGTILTNCVFMAMDKKLNMPLWN---KNSRYTMNTIYMMEVVIKVLARGFFMGQFTFLRDPWNWLDLLVVIFTIVTYVNPKQKMSSLKTFRVLRVLKTISVFPGLKTIVKALIQSVKKLFDVIILTIFCLSIFALIGQQLF---MGNLKNKCVL 287          

HSP 5 Score: 58.151 bits (139), Expect = 2.037e-8
Identity = 32/75 (42.67%), Postives = 43/75 (57.33%), Query Frame = 3
Query: 4560 DIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIA-QRWYYFKVPWNMFDFVIVILSIV 4781
            D+ I   I+LNT+ M +EH    E  K  L   N  F   FT E +LK+IA   +YYF+  WN FD V+V +S+V
Sbjct:  730 DLAITLCIVLNTVFMSLEHDSMSEDFKKVLRNGNVFFTGTFTAEMVLKIIAMDPYYYFQEKWNQFDSVVVTVSLV 804          
BLAST of scna-1 vs. Ensembl Yeast
Match: CCH1 (Voltage-gated high-affinity calcium channel; involved in calcium influx in response to some environmental stresses as well as exposure to mating pheromones; interacts and partially co-localizes with Mid1p; however, evidence suggests CCH1 is not required for Mid1p function [Source:SGD;Acc:S000003449])

HSP 1 Score: 142.124 bits (357), Expect = 4.776e-34
Identity = 143/602 (23.75%), Postives = 271/602 (45.02%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVN-ALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPR--PKLKIANIIFSITINQK---FDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRW-----YYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPT-XXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGT---CGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKD--VQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLG 5426
            LD  F   F+ E ++K  A G     N Y ++ W ++DF ++    ++L+ +Y+         FK +  LRALR L   +     R   N  +   +  IF   L+ L     F++ G+ +F G+   C N+ +  R  A+     +  +    +     ++   L+ D+  + +  L+Q+ + +GW++++ + ++S+G+G   +   S     + V F      F LNLF+  I++N    + R  GS   + T ++K +  + K +S   P K IP      ++    + + + +K   +  F+  V+ L+ I+M +     P  L         V+ +  T  FL++            YF+  WN     I+I++ +  A+     ++P S   F  +   F +   L ++     +  LL + + SLP +L++     ++  +YAI     F       +  +  NF T  K+MI+LF+ S   GWN ++  L   +P   + +  T   CGS   A + L+S+ IIS  + +NM++++I+ NFS   +    + G+ + +   + E W ++DT   G + L YL   +   D PL 
Sbjct: 1245 LDCAFIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFIDFCVLISMWINLI-AYLKNNGNLSRIFKGLTALRALRCLTISNT---ARQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRLGTC-NDGSLGR--ADCYNEYSNSVFQWDIMSPRVYQQPYLHLDSFASAFSSLYQIISLEGWVDLLENMMNSSGIGTPATVMGSAGNALFLVLFNFLSMVFILNLFVSFIVNN----QARTTGS--AYFTIEEKAWLESQKLLSQAKP-KAIPNLIELSRVRQFFYQLAVEKKNFYYASFLQVVLYLH-IIMLLSRSYNPGNLIG----YQGVYFMFSTSVFLIQEALHMCGEGPRLYFRQKWNSIRLSIIIIAFIMNAVAF---HVPASHYWFHNIKGFFLLVIFLFIIPQNDTLTELLETAMASLPPILSLTYTWGVLFLVYAIALNQIFGLTRLGSNTTDNINFRTVIKSMIVLFRCSFGEGWNYIMADLTVSEPYCSSDDNSTYTDCGSETYAYLLLMSWNIISMYIFVNMFVSLIIGNFSYVYRSGGSRSGINRSEIKKYIEAWSKFDTDGTGELELSYLPRIMHSFDGPLS 1824          

HSP 2 Score: 78.5666 bits (192), Expect = 8.624e-15
Identity = 50/199 (25.13%), Postives = 106/199 (53.27%), Query Frame = 3
Query:  876 KTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPL-RQCQNYTYNEWNT-SCPEGYVCIQ----TKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYD 1454
            + V    GM +++  L   + QL +   + V+    FG++G+Q+++G+  R+CV        +F P   E+ TD  ++ +++        +LDP+ ++ QNY Y + +  S  +G++C Q        NP  G  +FDN + S+   F +M+ + + +L   T+ ++     L+F++ IF  + +L+N+++A++  S++
Sbjct:  535 RLVNVDTGMPSILRGLKYGIPQLVNVSSMLVYFWIFFGILGVQIFQGSFRRQCV--------WFNP---EDPTDTYQYDMQFC-----GGYLDPVTKRKQNYIYEDGSEGSVSKGFLCPQYSKCVSNANPYNGRISFDNIVNSMELVFVIMSANTFTDLMYYTMDSDEMAACLFFIVCIFVLTIWLLNLLIAVLVSSFE 717          

HSP 3 Score: 54.299 bits (129), Expect = 2.072e-7
Identity = 82/399 (20.55%), Postives = 161/399 (40.35%), Query Frame = 3
Query: 3741 FGLNKYF-KDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYK-CV-----------------------------NNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNV------QKKRVGGSLEM-FMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKI-ANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVF--WAIESMLNNI 4814
            FG  + F + +W  +D +      + + LS I +     G  +  + L  LR LR V+   GM  ++  L   IP + NV  + + FW+ F I+G+Q+F G F + CV                              N  +E  S   +     C        N +  N +++FDN++N    +F + +   + ++M   +DS  +              +F+  I     + LNL I V++ +F +      +KK + GS +  ++      Y+   K  ++        +  L I +++ F   I    DI + + + ++T   C         +    D+   + + I +   L+  +   W +   P  ++DF+I I+++V    A+E +L ++
Sbjct:  483 FGTPRAFARSSWNRIDLVSSVSFWLGMFLS-IKSYDTKTG-IRIFKPLAILRILRLVNVDTGMPSILRGLKYGIPQLVNVSSMLVYFWIFFGILGVQIFQGSFRRQCVWFNPEDPTDTYQYDMQFCGGYLDPVTKRKQNYIYEDGSEGSVSKGFLCPQYSKCVSNANPYNGRISFDNIVNSMELVFVIMSANTFTDLMYYTMDSDEMAAC----------LFFIVCIFVLTIWLLNLLIAVLVSSFEIANEEYKKKKFIYGSRKTGYVARIVTGYWKYFKLKANQTKFPNWSQKGLAIYSHVEFIFVILIICDIGMRASVKVSTSANC-------NNILLKTDRGISIVLFIESLARLVLYLPNMWKFLTKPSYVYDFIISIITLVISCLAVEGVLGHM 862          
BLAST of scna-1 vs. Ensembl Nematostella
Match: EDO35661 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKR1])

HSP 1 Score: 539.265 bits (1388), Expect = 1.366e-162
Identity = 336/765 (43.92%), Postives = 488/765 (63.79%), Query Frame = 3
Query: 3450 EDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIA-LVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVG--GSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQI-NKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLM----NEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTG---------ENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY 5693
            E C P         C D  F      +W   R K  +LVEH+ FE  I+ +I  SS++L  ED  L S+P LK  L+IL+ +F +IFT EMLLKW   G   YF + W  LDF+IV ++ +VSL   +   G   +   +++RTLRA RPLRA+SR+EGM++V+ +L+ AIP I NVLLVCL+FWLIFSI+G+Q+FGGKF KCV+    E+  A ++PNK  CL          WENS +NFD V  G+L L QVATF+GW+EIM DAVD+T +  QP   ++   Y +FV FII G FFTLNLFIGVIIDNFN  K+++   GS+++F+T  Q+ + NA+K  ++  P+K I RP+ K    ++ +  ++KF++FIM  I +N +VM ++H+D    L     QI N +F  +F  E +L++IA R  YF  PWN+FDFVIVI SI+   +E++  ++ ++P+ +RVVRVFR+GR+LR  ++A+GIR LLFSL++S PAL NI  LL +I+FIYAI+GMS F +V  + ++++V NFETFG + ++LF++ TS GWN +L+ LM    + DP       G CG+  +A +YL S+++I FL++INMYIAVILEN++Q  +  + G+T +D +LFY+ WE +D  A  +I    L DFV +++  L IPKPN    A+L IP+ + D ++C+DLL+ L +R +    + D+          E       P  + G  +  I +  +KR +E  AAKVIV+ ++ Y
Sbjct:  790 EPCFPTSWCVCRLACMDSGFCA----VWKVMRYKVRRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGFKTYFTNPWNILDFVIVIVSIMVSLATIF---GNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGG-EKCPASVVPNKTVCL-----SNGYRWENSNINFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDNFNQLKQQMEAVGSMDVFLTSTQRNWMNALKSAATKKPKKRIRRPQNKFQGELYDMVQSRKFEVFIMLFITINMVVMMVQHYDH---LAVWSKQILNLIFTSVFILEAILRIIALRKGYFLNPWNVFDFVIVISSIIGIIVENLQTSLVINPSLLRVVRVFRVGRLLRFFEAARGIRRLLFSLVISTPALFNIGALLFLIIFIYAIIGMSIFGHVKKTEALNDVVNFETFGSSFVLLFRLMTSAGWNDILDPLMISEPDCDPNYRGLPSGNCGNKYMAPIYLGSFVVIIFLILINMYIAVILENYNQVMEQEKIGITNEDIELFYQMWELFDPNATQYIPYADLSDFVHQMEGNLRIPKPNKAACALLNIPLVKGDKIHCLDLLQALVKRIVSGFEDVDSEGFKIVMQRMEERFQAAFPS-RTGH-KSTITTMEIKRHQE--AAKVIVRAIRGY 1534          

HSP 2 Score: 231.491 bits (589), Expect = 4.973e-61
Identity = 141/343 (41.11%), Postives = 210/343 (61.22%), Query Frame = 3
Query:  471 QTFVVIAS--DKT-IFRFSTTKAFYLLSPLNPIRKTAIRLLT--HPV----FSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYE-FFNNETNWL----DPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            Q+F+VIA    KT ++RF+ +K+ YL  P NPIR+ +++L+T  +P+        VL TI++NCVF+A  +  +  EYVF  IYT+E   K I++G  ++ + YLRD WNWLDFIV+ L  +    P + NLS + + RV RAL+T++ V G+K +V  LL ++K L D MVLT+F + IF LIG+QL+ G L  KC                  L   E  +V Y  + +N + W     +P+  C N T +    +CP  Y C+    GNPN+GYT+FD+F  +LL  F+L+T D+WEN+Y   I T G  +++YF +VIFFG F+L+N++LA+VA SY++
Sbjct:    1 QSFLVIAGKFGKTQVYRFNRSKSLYLFGPENPIRQFSLKLITNQYPLQLHNRHMFVLLTILVNCVFLAMTNPPEQPEYVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVTIS-PDVANLSGIPTFRVFRALRTISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRNKCA-----------------LPVPENLSVPYRTYASNSSIWYLEDNEPIL-CGNTTGSR---TCPTNYTCLPHAGGNPNFGYTSFDHFGWALLTGFQLITLDFWENVYNNVIYTMGPWYVVYFAVVIFFGPFFLVNLVLAVVAASYEN 321          

HSP 3 Score: 207.994 bits (528), Expect = 8.488e-54
Identity = 104/204 (50.98%), Postives = 140/204 (68.63%), Query Frame = 3
Query: 2385 VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLD-------SSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNG 2975
            +E+FI +CI++NT++MSI+ P     +   +  +N  FT  F LE  LKLIALG   Y +  WN+FD I+VI+S+V+  ++        +G+S+LR FRLLRV KLAKSW TMN L   IG ++GA+GNL ++L II++IFAV+GMQL G+ Y+  K       F G+ PRWNF DF HSFM++FRVLCGEWIE +WDCML  G
Sbjct:  505 MEIFIIVCILLNTLVMSIEHPRLEDPLLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDFIVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTPDK-------FGGSIPRWNFKDFPHSFMMIFRVLCGEWIEPLWDCMLATG 701          

HSP 4 Score: 81.2629 bits (199), Expect = 4.218e-15
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = 3
Query: 3687 DKVFTIIFTAEMLLKWFA--FGLNKY--FKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV------------------------NNDTF---ERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKK 4448
            + VF  I+T EM  K  A  F L++Y   +D W WLDFI+V +  V++        +  +     + T R  R LR +S  +G++ +VN L+ ++  +++V+++ L F  IF++IGMQLF G+   KC                         +N+         +   P    CL       N  +     +FD+     L  FQ+ T   W  +  + +          Y     Y  YF   I FG FF +NL + V+  ++  + K     +E   TE+++K
Sbjct:   77 EYVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVTI--------SPDVANLSGIPTFRVFRALRTISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRNKCALPVPENLSVPYRTYASNSSIWYLEDNEPILCGNTTGSRTCPTNYTCLPHAGGNPNFGYT----SFDHFGWALLTGFQLITLDFWENVYNNVI----------YTMGPWYVVYFAVVIFFGPFFLVNLVLAVVAASYENEVK--ASKME---TEEERK 335          

HSP 5 Score: 76.2554 bits (186), Expect = 1.315e-13
Identity = 52/194 (26.80%), Postives = 92/194 (47.42%), Query Frame = 3
Query: 2448 DNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSL---VEIPLDSSGMSLLRAFRLLRVFKLAKS---WQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEP----------RW-----NFNDFTHSFMIVFRVLCGE-WIESMWDCM 2963
            D+ P +   L+  N  F   F +E  LK I LG + YF   WN+ DF+IVI+S+   +     +  ++ +R+ R LR F+  ++   ++ M ++   +   +  IGN+ +V  +   IF+++G+Q+FG K+    +E          P          RW     NF+     F+ + +V   E W+E M D +
Sbjct:  852 DSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGFKTYFTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGGEKCPASVVPNKTVCLSNGYRWENSNINFDTVDQGFLALLQVATFEGWMEIMEDAV 1045          

HSP 6 Score: 75.8702 bits (185), Expect = 1.826e-13
Identity = 62/231 (26.84%), Postives = 104/231 (45.02%), Query Frame = 3
Query: 3663 LKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLN 4355
            L   + I ++VFT IF  EM+LK  A G   Y + AW   D I+V I++V  +++     AGG G    +RT R LR L+    W  M  ++  + +++ ++ N+ ++  +   IF+++GMQL G  +                 P+K    I +       W     NF +  + ++ +F+V   + WIE + D + +TG           +    FV   I G F  LN
Sbjct:  531 LLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDFIVNKFVPDAGGTG-ISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSY----------------TPDKFGGSIPR-------W-----NFKDFPHSFMMIFRVLCGE-WIEPLWDCMLATG----------PVAMLLFVPAFILGNFIILN 721          

HSP 7 Score: 70.8626 bits (172), Expect = 5.884e-12
Identity = 73/229 (31.88%), Postives = 117/229 (51.09%), Query Frame = 3
Query: 2343 KFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVIL------------SLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGD-KYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVP 2990
            KFQ  +  ++     E+FI L I +N V+M +   D+    +   +  N  FT+ F LEA L++IAL  + YF   WNVFDF+IVI             SLV  P     + + R  RLLR F+ A+  +   LLF ++ +T  A+ N+  +L +IIFI+A++GM +FG  K +   N+ +           NF  F  SF+++FR++       + D ++++   C P
Sbjct: 1135 KFQGELYDMVQSRKFEVFIMLFITINMVVMMVQHYDHLAVWSK--QILNLIFTSVFILEAILRIIAL-RKGYFLNPWNVFDFVIVISSIIGIIVENLQTSLVINPSLLRVVRVFRVGRLLRFFEAARGIR--RLLFSLVIST-PALFNIGALLFLIIFIYAIIGMSIFGHVKKTEALNDVV-----------NFETFGSSFVLLFRLMTSAGWNDILDPLMISEPDCDP 1346          

HSP 8 Score: 67.3958 bits (163), Expect = 5.873e-11
Identity = 42/151 (27.81%), Postives = 75/151 (49.67%), Query Frame = 3
Query: 2388 ELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSN 2828
             +F+ L I++N V +++  P   PE         Y F   + +E F K+IA G       Y ++ WN  DFI+VIL  V I  D + +S +  FR+ R  +   + + +  +   +  ++  + ++ ++    I IFA++GMQLF  +  N
Sbjct:   53 HMFVLLTILVNCVFLAMTNPPEQPE---------YVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVTISPDVANLSGIPTFRVFRALRTISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRN 194          

HSP 9 Score: 62.7734 bits (151), Expect = 1.557e-9
Identity = 37/85 (43.53%), Postives = 54/85 (63.53%), Query Frame = 3
Query: 4530 IFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWY-YFKVPWNMFDFVIVILSIV 4781
            +   T  +  +IFI+  I+LNT+VM IEH    + L T ++  N+VF  IF  E +LKLIA  +  Y +V WN+FD ++VI+SIV
Sbjct:  496 LLKFTNGKVMEIFIIVCILLNTLVMSIEHPRLEDPLLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIV 580          

HSP 10 Score: 53.9138 bits (128), Expect = 8.931e-7
Identity = 47/201 (23.38%), Postives = 91/201 (45.27%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNS----NSDTVEYV-------FTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXX-----XKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTL-LYFEPNEFENLTDAEKW 1109
            +R    RL+ H VF  ++L  I  + + +A       +  T++ V       F  I+T+E  +K I  G      TY  + WN LDF+++ ++ ++    + GN        +        L+ ++   GMK V+ +LL A+  + + +++ +    IF ++G+Q++ G    KCV            PN+   L++  +W
Sbjct:  816 MRYKVRRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGFK----TYFTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGK-FGKCVDEGGEKCPASVVPNKTVCLSNGYRW 1011          
BLAST of scna-1 vs. Ensembl Nematostella
Match: EDO46797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP56])

HSP 1 Score: 489.189 bits (1258), Expect = 2.558e-145
Identity = 292/680 (42.94%), Postives = 441/680 (64.85%), Query Frame = 3
Query: 3531 WWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVG--GSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNE----DPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEA 5552
            W   RC+    VEH++FE FI+  +++SS TL  ED +L  +P L+ AL  L+ +F  IF+ E +LK   FG   YF   W  LD +IV++  VS+   +       +  F++ RT+R LRPLRA+SR  GM++V+NAL  AIP I +VL+V ++FWL+FSI G+QLF GKFYKCVN +  E++S  +IPNK ACL     + +  W N+ +NFDNV+NG+L L QVAT++GW+E+MADAVDST +  QPSY  + I YAYFV FII G+FF LNLF+GVIIDNFN  KK+     S+ M +TE Q+K+   +   +   P     RP       +F +  + +F++FI++VIM N  +M ++H+DQP  L T +   N V + IF  E ++K+IA R +YFK  W++FDFV+V+ SIV   +     +  VSP  +RV+RVFR+ R+LR+V+ AK IR LL ++I+S+PAL NI  LL ++MFIYAI+GMS F N+    +++++ NFETF  ++I++F++ T  GWN +L+ L+ +    DP       G CG  I AV YL++Y++  FL+I+NMYIAV+L+N ++A ++ + GL++D +  +Y  +  + +  + F+ L+ L +F+  +DKP  I  P+   +  ++IP+ + D V+C DLL++L ++ L Q  E+
Sbjct:  779 WLKFRCRVRCFVEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFVSYFTSVWNCLDALIVSVC-VSVACLFENPN---LSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVNAED-EKLSPSVIPNKTACL----DHPDYRWVNANVNFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDNFNTLKKKYEEINSMGMLLTESQRKWVQILMAAAKRKPPSNRLRPTDCFRGKLFDLVSSNQFEVFILTVIMCNMGMMMVQHYDQP-PLTTVIG--NYVLVGIFLLEAIIKIIAMRLHYFKKAWSIFDFVVVVSSIVGMYLGMSTESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSFGNIKKQGALNDLVNFETFSSSIILIFRLGTGTGWNDILDALVVQPPHCDPNFGGLPNGNCGFPIGAVFYLVTYIVSVFLIIVNMYIAVLLDNVNRAHENDEFGLSKDKFKSYYHTFANF-SMGKQFLPLRVLPEFLAALDKPFKIAHPSEELIRKMKIPVREGDLVHCFDLLKVLVKKILEQHGES 1445          

HSP 2 Score: 225.713 bits (574), Expect = 2.439e-59
Identity = 153/479 (31.94%), Postives = 244/479 (50.94%), Query Frame = 3
Query:  489 ASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDXXXXXXXXXXXXXIIDRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIES---EPRFSICDYDSTDRN--LDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPRSIAVGK 1910
            +S    +RFS T +   L P++P+R   I L+THP F  +V   I++NC+ +  N   +  EY+FT IYTLE   K ISRG + + + YLRD WNWLD +V+ L+YL    P + +LS +R+LRVLRA +T++ + G++ +V +LL ++K L D +VL +F L +  LIGLQL+ G L  KCV                 L  A   T+     NN ++W     +     ++     CP  Y C+     NP++G+TNFD+   SL+ AF+++T D+WENLY   +R+ G+ +++YF++ IF  SFYL+N++LA+V MSY                           + D    +  V  S     Q    P ++  W   S V +  + +S +     ++S+ + ++  +S   E R S      +  +   D+ +++ PLES+        Y    E E T P+ P S   I +G+
Sbjct:   27 SSGYQAYRFSRTASLLCLGPVHPLRMFCILLITHPYFEIIVTLVILVNCIILGLNDPPEEAEYIFTAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLSYLS-LAPDIASLSGIRTLRVLRAFRTISALKGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALIGLQLFTGELRNKCV-----------------LETANATTI-----NNPSSWYHREGEPLLCGFSSTAGRCPANYTCVAHVGPNPDHGFTNFDDIGWSLVMAFQILTMDFWENLYDRVLRSMGEWYMMYFVVGIFSCSFYLLNLVLAVVYMSYHH----------------------EMNLTDNEVTQSQVTHSPVTQSQVTHSPVTQS-WVTHSPVTQSRVSQSRVTQSLVTQSWLMQSLVTQSPVTESRVSQSRVTQSRAHPKTDTIQVLEPLESHL-------YPPDEEEEETKPLTPPSLNGIVLGE 452          

HSP 3 Score: 164.466 bits (415), Expect = 1.445e-40
Identity = 97/232 (41.81%), Postives = 137/232 (59.05%), Query Frame = 3
Query: 2328 CPCYFKF-QSLVALI--ILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSS-GMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMI 3011
            CP Y +  ++  AL+  I  P  +  I   I++NTV++++       ++   L   N  FT  F LE  +K+ A G  +Y    WN+FD +I+I S V   L +S G+S+ R  RLLRV  LA+SW+TM  L   I  +V  I N+  +LG+II++FAVVGM++FG  Y+       F S +G  PRWNF DFTHSFM+VFR+LC EW+E +WDCM V     + FFL  +I
Sbjct:  460 CPKYPRLSRACSALVEFIQRPLFDGIIAGLILLNTVVLTMYYHGMPDDLTFVLDILNAIFTGLFILEMIVKIFAFGLVKYICNKWNLFDSVIIITSAVAYFLGTSTGVSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPHYT----AEAFGS-RGI-PRWNFTDFTHSFMMVFRILCSEWVEPLWDCMRVTNTAALLFFLPALI 685          

HSP 4 Score: 116.316 bits (290), Expect = 7.412e-26
Identity = 137/611 (22.42%), Postives = 265/611 (43.37%), Query Frame = 3
Query: 3663 LKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGS-------------LEMFMTEDQKKYYN-----------------------AMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIE--HWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWY-YFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYS--HSIDEVF------------------------NFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQE 5300
            L   L+IL+ +FT +F  EM++K FAFGL KY  + W   D +I+   + S V  ++GT  G        R LR LR L     WE M  ++ A+  ++  IFN+  +  V   +F+++GM++FG  +       T E   +  IP                W     NF +  + ++ +F++     W+E + D +  T          +T    +F+  +I G F  LNLF+ +++++F  +++ +                  +  T   + YY                         M     T+ Q+     K +     F    ++ F+ FI+  +M+++  +  E  H  Q   L+ AL+ +N +F  IF+ EF+LK+I   +  YF   WN  D +IV + +   ++  +  N  +S    R  R  R  R LR +    G++ ++ +L  ++P + ++ ++ ++   +++I G+  F+   Y   ++ DE                          NF+      + L Q++T  GW  V+   ++   K+   ++ +  + +IA  Y + ++I+    ++N+++ VI++NF+   K  +E
Sbjct:  508 LTFVLDILNAIFTGLFILEMIVKIFAFGLVKYICNKWNLFDSVII---ITSAVAYFLGTSTG----VSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPHY-------TAEAFGSRGIPR---------------W-----NFTDFTHSFMMVFRILC-SEWVEPLWDCMRVT----------NTAALLFFLPALIVGNFIVLNLFVALLLNSFAKKEEDLHREASEQPYVNPCSCLAHLTRTRKTRMYYTQAVNNNKNTKRYIVEIDDCFPECCMNACGCTSGQQHFCWLKFRCRVRCF--VEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFVSYFTSVWNCLDALIVSVCV---SVACLFENPNLS--VFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVNAEDEKLSPSVIPNKTACLDHPDYRWVNANVNFDNVINGFLALLQVATYEGWMEVMADAVDST-KI--DQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDNFNTLKKKYEE 1063          

HSP 5 Score: 81.6481 bits (200), Expect = 2.623e-15
Identity = 60/213 (28.17%), Postives = 107/213 (50.23%), Query Frame = 3
Query: 2388 ELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMS---------LLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGD-KYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFF 2996
            E+FI   I+ N  +M +   D  P         NY     F LEA +K+IA+    YF++ W++FDF++V+ S+V + L  S  S         +LR FR+ R+ ++ +  + +  L + I  ++ A+ N+  +L +++FI+A++GM  FG+ K     N+ +           NF  F+ S +++FR+  G     + D ++V    C P F
Sbjct: 1115 EVFILTVIMCNMGMMMVQHYDQPPLTT---VIGNYVLVGIFLLEAIIKIIAMR-LHYFKKAWSIFDFVVVVSSIVGMYLGMSTESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSFGNIKKQGALNDLV-----------NFETFSSSIILIFRLGTGTGWNDILDALVVQPPHCDPNF 1312          

HSP 6 Score: 80.4925 bits (197), Expect = 6.306e-15
Identity = 71/260 (27.31%), Postives = 122/260 (46.92%), Query Frame = 3
Query: 3687 DKVFTIIFTAEMLLKWFAFGLNK----YFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCVNNDTFERISAEIIPNKNA----------CLIMK------AMYGNVSW-----ENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFN 4388
            + +FT I+T EM+ K  + G  K    Y +D W WLD ++V ++ +SL        A  + +   +RTLR LR  R +S  +G+R +VN+L++++  + +VL++ L    + ++IG+QLF G+   KCV     E  +A  I N ++          C          A Y  V+      ++   NFD++    +  FQ+ T   W  +    + S G            Y  YFV  I   +F+ LNL + V+  +++
Sbjct:   88 EYIFTAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLSYLSL--------APDIASLSGIRTLRVLRAFRTISALKGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALIGLQLFTGELRNKCV----LETANATTINNPSSWYHREGEPLLCGFSSTAGRCPANYTCVAHVGPNPDHGFTNFDDIGWSLVMAFQILTMDFWENLYDRVLRSMG----------EWYMMYFVVGIFSCSFYLLNLVLAVVYMSYH 325          

HSP 7 Score: 72.4034 bits (176), Expect = 1.916e-12
Identity = 58/233 (24.89%), Postives = 109/233 (46.78%), Query Frame = 3
Query: 2334 CYFKFQSLVALIILDPFVELFITLCIVMNTVLMSID--TPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSL-VEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGA---IGNLCIVLGIIIFIFAVVGMQLFGDKY---SNFKNETLFPS--------FKGAEPRW-----NFNDFTHSFMIVFRVLCGE-WIESMWDCM 2963
            C+ KF+  V   +   + E FI   +++++  +  +       P++   L   N+ F   F LE  LK+I  G   YF   WN  D +IV + + V    ++  +S+ R+FR +R  +  ++   +  + ++I     A   IG++ +V  +   +F++ G+QLF  K+    N ++E L PS            + RW     NF++  + F+ + +V   E W+E M D +
Sbjct:  778 CWLKFRCRVRCFVEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFVSYFTSVWNCLDALIVSVCVSVACLFENPNLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVNAEDEKLSPSVIPNKTACLDHPDYRWVNANVNFDNVINGFLALLQVATYEGWMEVMADAV 1010          

HSP 8 Score: 55.8398 bits (133), Expect = 1.837e-7
Identity = 64/282 (22.70%), Postives = 119/282 (42.20%), Query Frame = 3
Query:  669 VEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAY---LMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGY----TNFDNFIVSLLCAFRLMTQDYW-ENLYQLTIRTNGD---------IHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            + ++F  I++LEF +K I  G +    +Y    WN LD +++ +      +F  P L    + R++R LR L+ ++ + GMK V+ AL  A+  +   +V+++    +F + G+QL+ G    KCV                   +AE   +      N+T  LD                             +P+Y +     NFDN I   L   ++ T + W E +      T  D         I   YF++ I  GSF+++N+ + ++  +++ ++
Sbjct:  830 LNFLFAAIFSLEFILKVIGFGFV----SYFTSVWNCLDALIVSVCVSVACLFENPNLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFY-KCV-------------------NAEDEKLSPSVIPNKTACLD-----------------------------HPDYRWVNANVNFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDNFNTLK 1058          

HSP 9 Score: 53.5286 bits (127), Expect = 9.496e-7
Identity = 71/268 (26.49%), Postives = 136/268 (50.75%), Query Frame = 3
Query: 4557 FDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKV-----PWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVF--------NFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDY 5321
            FD  I  +I+LNT+V+ + +   P+ L   LD +N     IFTG F+L++I + + +  V      WN+FD VI+I S V + +         + T + + R+ R+ R+L L +S + +  L+ ++  S+  + NI  +L +I++++A+VGM  F      H   E F        NF  F  + +++F+I  S  W   L   M    +V N           A+++ +  LI+   +++N+++A++L +F++  +D+    ++  Y
Sbjct:  482 FDGIIAGLILLNTVVLTMYYHGMPDDLTFVLDILNA----IFTGLFILEMIVKIFAFGLVKYICNKWNLFDSVIIITSAVAYFLG--------TSTGVSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFG----PHYTAEAFGSRGIPRWNFTDFTHSFMMVFRILCS-EWVEPLWDCM----RVTNTA---------ALLFFLPALIVGNFIVLNLFVALLLNSFAKKEEDLHREASEQPY 719          
BLAST of scna-1 vs. Ensembl Nematostella
Match: EDO36844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI0])

HSP 1 Score: 266.159 bits (679), Expect = 1.490e-71
Identity = 179/511 (35.03%), Postives = 281/511 (54.99%), Query Frame = 3
Query: 3666 KLALEILDKVFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGG-MGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMS-STAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIA---QRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNV------AYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVC 5153
            +  ++I   VF  IFT EM++K  A GL    + Y +  W  +D  +V I+ V ++++    G    +G  +  R LR LRPLR +SR  G++IVV  LI ++  I N++L+   F++IF I+G+QLF GKF+ C +         E + N              SW N + NFDN+    L LF  +T  GW+ IM D +D+ G+  QP  NH+     YFV F++   F  LN+ +GV+++NF   +  +    ++   +  KK     ++++   A  +  PRP+      I ++  +  FD+ I +VI LN + M +EH+ QP+ L   L   N VF  +F  E +LK+ A   +R  Y K  WN  D +IVILSIV  A+E M   +P++PT IRV+RV RI R+L+L+K+A+GIR LL ++  +LP + N+ +L +++ FI++ +G+  F  +           +DE  NF +FG AM+ LF+IST   WNG+L   ++  P VC
Sbjct:  962 RRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTDATVPVTTKTECLENGG------------SWVNREYNFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVENFQKCRTLIEMEKKIDEEKKNKKEEKMRREIAEDEALSEHYPRPR----KFIHAVCTHGYFDLGIAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKR--YIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGKIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWNGILKDTIS--PDVC 1452          

HSP 2 Score: 112.079 bits (279), Expect = 1.868e-24
Identity = 62/209 (29.67%), Postives = 111/209 (53.11%), Query Frame = 3
Query: 2337 YFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLV---------EIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGE 2936
            Y + +  +  +    + +L I   I +N + M+++       +  FLKCANY FT  F LEA LK+ ALG ++Y ++ WN  D +IVILS+V         E+P++ + + ++R  R+ RV KL K+ + +  L   +   +  +GNL ++  ++ FIF+ +G++LFG        E    + +G +   NF  F  + + +FR+  G+
Sbjct: 1233 YPRPRKFIHAVCTHGYFDLGIAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFG----KIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGD 1437          

HSP 3 Score: 110.923 bits (276), Expect = 3.922e-24
Identity = 74/208 (35.58%), Postives = 113/208 (54.33%), Query Frame = 3
Query: 2397 ITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEI-PLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGA--EPRWNFNDFTHSFMIVFRVLCGE-WIESMWDCMLVNGYQCVPFFLMTM 3008
            I   I +NT+ M I+      +M   L+  NY FT  FG+E  +KLI LG   Y ++ +N+FD  IVI+S+VE+   D SG+S+LR+FRLLRVFKL +    +    +++  T+  +     +L I +F  +++GM LFG KY        FP+ +G     R NF+D   + + VF+VL  E W   M+D M         +F++ M
Sbjct:  417 IMGAIFVNTLTMGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVELFGDDDSGISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYR-------FPNDEGVMETSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMRATSKWAGLYFILLM 617          

HSP 4 Score: 90.5077 bits (223), Expect = 6.162e-18
Identity = 87/345 (25.22%), Postives = 144/345 (41.74%), Query Frame = 3
Query:  528 AFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMAKNSNS-----------DTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFF--------PVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAE-KWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLY----------QLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAI 1472
            + Y+ +P N  R     L  +  F   VL  I++NCV MA    S           D   YVF  I+T+E  +K I+ GL I    YLR  WN +D  ++ ++++             +LG L   R+LR LR L+ ++  PG+K VV  L+ ++K + + +++      IFG++G+QL++G                    +F   TDA    T K E   N  +W+       N  Y                          NFDN   +LL  F   T+D W N+           +  IR +   +++YF+  +    F ++N+++ +V  ++   R  I
Sbjct:  910 SLYVFAPDNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALEGPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKG--------------------KFHYCTDATVPVTTKTECLENGGSWV-------NREY--------------------------NFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVENFQKCRTLI 1201          

HSP 5 Score: 84.3445 bits (207), Expect = 4.758e-16
Identity = 62/237 (26.16%), Postives = 104/237 (43.88%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNF 4385
            LEI + +FT IF  EM++K    G   Y KDA+   D  IV I++V L     G    G+   ++ R LR  + +R +     +R  +  +I  + ++   L + ++F    SI+GM LFGGK+                 PN    +           E S+ NFD++    + +FQV T + W  +M D + +T          S     YF+  +  G +   NL + ++++ F
Sbjct:  443 LEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVEL----FGDDDSGISVLRSFRLLRVFKLVRFL---PALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYR---------------FPNDEGVM-----------ETSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMRAT----------SKWAGLYFILLMTIGNYILFNLLVAILVEGF 636          

HSP 6 Score: 83.5741 bits (205), Expect = 8.157e-16
Identity = 64/237 (27.00%), Postives = 100/237 (42.19%), Query Frame = 3
Query: 3867 AMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCV-------------------------------NNDTFERISAEIIPNKNA----CLIMKAMYGNVS--------WEN--------------SQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKR 4403
            A+R +R LRPLRA++R   +RI+V  L+  +P + NVL +C + + IF I+G+Q++ G    +CV                                N   +  ++  IP   A    C +    Y N S        W                  ++FDN+L  ++ +FQV T +GW +IM    D+ G  N          + YFV  I+ G++F  NL + VI   F   K+R
Sbjct:    3 AVRAIRVLRPLRAINRVPSIRILVTLLLDTLPMLGNVLAMCSLIFSIFGIVGVQMWQGVLRSRCVAQLPGNLSANQLNISAFYQPGGSSDLVCSLPENSGDKHCTSAFIPASTAHGRECGLTYEQYSNRSNYTNVCANWNQYYTLCADMGINPLYDAVSFDNILIAWVAIFQVITLEGWTDIMYYIQDAHGFWN----------FIYFVVLIVIGSYFMTNLCLVVITTQFQETKQR 229          

HSP 7 Score: 75.0998 bits (183), Expect = 3.116e-13
Identity = 45/226 (19.91%), Postives = 105/226 (46.46%), Query Frame = 3
Query:  876 KTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTL--------LYFEPNEFENL----------------------TDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVR 1463
            + +  VP ++ +V  LL+ +  L + + +   + SIFG++G+Q+++G L  +CV      L         +++P    +L                          +  + YE ++N +N+ +    C N+  N++ T C +  +       NP Y   +FDN +++ +  F+++T + W ++       +G  + +YF+++I  GS+++ N+ L ++   + + +
Sbjct:   14 RAINRVPSIRILVTLLLDTLPMLGNVLAMCSLIFSIFGIVGVQMWQGVLRSRCVAQLPGNLSANQLNISAFYQPGGSSDLVCSLPENSGDKHCTSAFIPASTAHGRECGLTYEQYSNRSNYTN---VCANW--NQYYTLCADMGI-------NPLYDAVSFDNILIAWVAIFQVITLEGWTDIMYYIQDAHGFWNFIYFVVLIVIGSYFMTNLCLVVITTQFQETK 227          

HSP 8 Score: 71.2478 bits (173), Expect = 4.347e-12
Identity = 53/212 (25.00%), Postives = 98/212 (46.23%), Query Frame = 3
Query: 2397 ITLCIVMNTVLMSIDTPDNSPEM--NHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDS------SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGA---IGNLCIVLGIIIFIFAVVGMQLFGDKYS---------NFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGE-WIESMWD 2957
            + L I++N V+M+++ P   P       +    Y F   F +E  +K+IALG    P+ Y +  WNV D  +V++S V++ + +      S + +LR FR LR  +  +       L +++ T + +   IGN+ ++      IF ++G+QLF  K+            K E L          +NF++   + + +F     + W+  M+D
Sbjct:  937 VLLFILLNCVVMALEGPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTDATVPVTTKTECLENGGSWVNREYNFDNLAKALLTLFVFSTKDGWVNIMYD 1148          

HSP 9 Score: 65.855 bits (159), Expect = 2.125e-10
Identity = 78/270 (28.89%), Postives = 131/270 (48.52%), Query Frame = 3
Query: 4500 PRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWY-YFKVPWNMFDFVIVILSIV--FWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVF------NFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQA 5282
            PR   K  +   S   ++ F   IM  I +NT+ M IE++ QP+K+   L+  N +F  IF  E ++KLI   +Y Y K  +N+FD  IVI+S+V  F   +S ++ +          R FR+ R+ +LV+    +R  L  +I ++  ++    LL++ MF  +I+GM+ F    Y    DE        NF+    A++ +FQ+ T   WN V+   M    K              A +Y I  + I   ++ N+ +A+++E F+ A
Sbjct:  394 PRRCAKFRDGCASSVDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVELFGDDDSGISVL----------RSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGG-KYRFPNDEGVMETSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMRATSK-------------WAGLYFILLMTIGNYILFNLLVAILVEGFASA 639          
BLAST of scna-1 vs. Ensembl Nematostella
Match: EDO35497 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLD1])

HSP 1 Score: 208.764 bits (530), Expect = 1.843e-57
Identity = 175/538 (32.53%), Postives = 290/538 (53.90%), Query Frame = 3
Query: 3543 RCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIG-TGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWY-YFKVPWNMFDFVIVILSIVFWAIESMLN-NIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSH-----SIDEVFNFETFGKAMIILFQISTSGGWNGVL 5120
            R +   +  H+ F+  I++ II S   L +E  ++  +   +  ++I   VFTIIFT EML+K  A GL      Y +D W  LD  +V ++ + ++++Y        +G  +  R LR LRPLR + R  G+++VV  L+ ++  I N +L+  +F+++F I+G+QLF GKFY C  +          + +K  C    A      W N + NFD++L   + LF V+T  GW+EIM   +D+  +  QP  N++     YF+ F++ G F  LN+ +GV+++NF   ++R+    +       KK  N M+         P+   +LK    I  I  ++ +DI I ++I +N I M +EH+  P+     ++  N  F  +F  E ++K+IA  +  Y K  WN+ D  IV+LS+    +E ++  +   +PT IR +RV RI R+L+LVK AKG+R+LL +L  +LP + N+ LL  ++ FIY+ +G+  F ++  SH       +   +F  FG AM+ LF+I+T   WNG+L
Sbjct:    9 RQRMRAVCSHRAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEGDSH--------VISKQEC----ANSTRGQWVNRRYNFDDLLQALISLFVVSTKDGWVEIMHHGIDAVDVDVQPIVNYAEWRLVYFIPFLLLGGFLVLNMIVGVVVENFQRCRERMDEEEQARPHRKGKKARNQMQDSLYYESYGPL---RLK----IHFICTHRNWDITIAAIICINVICMSLEHYKMPQVF---VETTNYFFTSVFVIEVVVKVIALGFVRYPKDRWNLIDLAIVLLSVTGIVLELLVKVDHLFNPTVIRTLRVLRITRVLKLVKLAKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLFGSLECSHDYPCQGFNRHAHFRDFGTAMLTLFRIATGDNWNGIL 524          

HSP 2 Score: 77.7962 bits (190), Expect = 2.239e-14
Identity = 86/350 (24.57%), Postives = 151/350 (43.14%), Query Frame = 3
Query:  540 LSP-LNPIRKTAIRLLTHPVFSFLVLTTIIINCVFMA-----------KNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWN----------WLDFIVIGLAYLMFFFP-VLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYW-ENLYQLTIRTNGDIH---------ILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETG 1490
            +SP L   R+    + +H  F +++L  II +C  +A           K    D    VFT I+T+E  IK ++ GL++   TYLRD W+          W+D IV    Y     P VLG L   R+LR LR L+ +   PG+K VV  LL ++K + + +++      +FG++G+QL++G                                 K+ +   +++ +   ++C N T  +W                N  Y   NFD+ + +L+  F + T+D W E ++      + D+          ++YF+  +  G F ++N+I+ +V  ++   R  +  EE  
Sbjct:    1 MSPCLFRFRQRMRAVCSHRAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIV---TYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKG---------------------------------KFYYCEGDSHVISK-QECANSTRGQWV---------------NRRY---NFDDLLQALISLFVVSTKDGWVEIMHHGIDAVDVDVQPIVNYAEWRLVYFIPFLLLGGFLVLNMIVGVVVENFQRCRERMDEEEQA 295          

HSP 3 Score: 75.485 bits (184), Expect = 1.120e-13
Identity = 57/233 (24.46%), Postives = 109/233 (46.78%), Query Frame = 3
Query: 2331 PCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPE--MNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEI---------PLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLF--------GDKYSNFKNETLFPSFKG--AEPRWNFNDFTHSFMIVFRVLCGE-WIESM 2951
            PC F+F+  +  +      +  I + I+ +  +++I+ PD + +      +  +   FT  F +E  +KL+A    LGP  Y ++ W+V D  +V++S ++I         P     + + RA R LR  ++ +    + L+   +  ++  IGN  ++  I   +F ++G+QLF        GD +   K E    S +G     R+NF+D   + + +F V   + W+E M
Sbjct:    3 PCLFRFRQRMRAVCSHRAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEGDSHVISKQECA-NSTRGQWVNRRYNFDDLLQALISLFVVSTKDGWVEIM 234          

HSP 4 Score: 64.3142 bits (155), Expect = 3.040e-10
Identity = 55/193 (28.50%), Postives = 102/193 (52.85%), Query Frame = 3
Query: 2388 ELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLD----------SSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGE 2936
            ++ I   I +N + MS++     P++  F++  NYFFT+ F +E  +K+IALG  +Y ++ WN+ D  IV+LS+  I L+           + +  LR  R+ RV KL K  + +  L   +   +  + NL ++  ++ FI++ +G+QLFG    + +    +P  +G     +F DF  + + +FR+  G+
Sbjct:  334 DITIAAIICINVICMSLEHY-KMPQV--FVETTNYFFTSVFVIEVVVKVIALGFVRYPKDRWNLIDLAIVLLSVTGIVLELLVKVDHLFNPTVIRTLRVLRITRVLKLVKLAKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLFG----SLECSHDYPC-QGFNRHAHFRDFGTAMLTLFRIATGD 518          
BLAST of scna-1 vs. Ensembl Nematostella
Match: EDO46991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU9])

HSP 1 Score: 206.838 bits (525), Expect = 2.306e-53
Identity = 198/663 (29.86%), Postives = 341/663 (51.43%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNND--TFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIA-QRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXX-XXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAY--SHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEK------GTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPK--PNS---VQLAMLEIPICQNDTVYCVDLLEILTRRFLG-QKPEADTGENNLNKLKPDLK 5597
            L   D  FT +FT E+ +K  A+G+      + + A+  LDF++V +++VS+ L      +  +   + +R LR LRPLRA++R +G++ VV  +  A+ +I N++LV ++F  +F++IG+QLF G F+ C + +  T      + I  K   L    +  +  W+    NF++V    L LF V TF+GW  I+  ++DST +   P  N+      Y+V +II  AFF +N+F+G +I  F  + +      E+   ++Q+K      K   T  ++ IP  +L+    ++ +  +Q F+  I + I  NTI++ ++++++P+     LD  N  F  +F  E +LKL A +   YF   WN+FDFV+V+ S     ++  +N +     F        R  R+++L+    GI+TLL++ I S  AL  + LL+IM  FIYA+VGM  F  +A      I+   NF+TF +++++LF+ +T   W  ++    +     C+         G CG+   A  Y  S+  I   +IIN+++AVI++NF   T+D    L     D F   W EYD +A G +    +   +++I  PLG  K  P+     +L  + +P+ ++ TV     L  L R  L  ++PE   G+ +L K   +++
Sbjct:  866 LNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALR---DSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGTFFSCTDAEKITKRECQGQYIEFKGPGLT-NPVVKDREWQPQTFNFNDVPQAMLTLFTVMTFEGWPGILESSMDSTDVDEGPFLNNRPWVAIYYVIYIIIIAFFMINIFVGFVIVTFQNEGEEEFKDCEL--DKNQRKCVEFALKARPT--RRYIPTNRLQFH--VWRVVTSQPFEYLIFAFITGNTILLMMQYYNEPKLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGS----VVDITMNEVSSEQMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFGRIAIDPETQINRNNNFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCDPNAYPQDTDGLCGTDF-AYAYFCSFYAICSFLIINLFVAVIMDNFDYLTRD-WSILGPHHLDEFVRVWSEYDPEASGCVKHVDIVTVLKRIAPPLGFGKFCPHREACKRLVSMNMPLNRDGTVNFNATLFGLVRTSLSIKRPE---GKGSLEKANEEMR 1509          

HSP 2 Score: 130.183 bits (326), Expect = 5.313e-30
Identity = 109/384 (28.39%), Postives = 188/384 (48.96%), Query Frame = 3
Query:  414 RKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLT-------HPVFSFLVLTTIIINCVFMAK------------NSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDF--IVIGLAYLM--FFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWEN-LYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGD 1493
            R KL+G P     P   K+Q        K        +A + L+  NPIR TAI L T          F  ++L TI  NC  +A             N   +  E+VF  I+T+E  +K I+ G +++   YLR+ WN LDF  +V+GLA ++   + P   ++ ALR+ RVLR L+ V+ VP ++ V+ ++++A+  L    +L VF++ I+ +IG++L+ G L   C  +      + EP+     T++E ++                  C N            G VC++   G PNYG TNFDN  ++ L  F+ +T + W + +Y +          LYF+ +I +GSF+++N++L +++  +   +   +A+++G+
Sbjct:   15 RAKLNGQPKYGKPPPQPKRQ-------KKPTNAVRPKRALFCLTLGNPIRSTAISLFTVFFLDVFRTPFDVMILITIFANCAALAAFQPLPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCS--TESEGYS------------------CSN---------AGPGQVCLKKWEG-PNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAIGNSWPWLYFVTLIIWGSFFVLNLVLGVLSGEF--AKEKARAQKSGE 359          

HSP 3 Score: 126.331 bits (316), Expect = 7.637e-29
Identity = 86/263 (32.70%), Postives = 137/263 (52.09%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFAFGL----NKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYK-CVNNDTFERISAEIIP---NKNACLIMKAMYGNV---SWENSQ---LNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLE 4421
            LE+ + VF  IFT E +LK  A+G       Y ++ W  LDF+IV + L ++++      +  +   KA+R  R LRPLR VS    +++V+N++I+A+  +F++ L+ +   +I++IIG++LF GK +  C +N T +    E  P            A  G V    WE       NFDN+    L +FQ  T +GW ++M    D+ G         ++  + YFV+ II+G+FF LNL +GV+   F  +K R   S E
Sbjct:  109 LEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTPDSFDV---KALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTESEGYSCSNAGPGQVCLKKWEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAIG---------NSWPWLYFVTLIIWGSFFVLNLVLGVLSGEFAKEKARAQKSGE 359          

HSP 4 Score: 98.5969 bits (244), Expect = 2.482e-20
Identity = 84/306 (27.45%), Postives = 148/306 (48.37%), Query Frame = 3
Query: 2088 RVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSS------GMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ 2981
            +  +  SFR R EN+ I+ +   K NQ+D                 SA S     D     RKK+++K++   L+  C       +F +  +V                + +N++ ++++  +    +  FL  AN  F   F LE  +K+  LG   YF   +N FD ++VI SL+E+ L  +      G+S+LR  RLLR+FK+ + W +++ L   +  ++ +I  L ++L + + IF+++GMQ+FG K+ N  +E +        PR NF+ F  + + VF++L GE     W+ ++  G Q
Sbjct:  399 KADRKPSFRRRKENDDISKN---KENQED-----------------SAASDQGWID-----RKKKILKRFHHRLRRSCRKAVKTQWFYWTVIV---------------FVFLNSLTLALEHYNQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTEAMDQRPIGISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKF-NLGDEDV--------PRSNFDSFWRALVTVFQILTGE----DWNAVMYTGIQ 651          

HSP 5 Score: 85.1149 bits (209), Expect = 2.582e-16
Identity = 87/320 (27.19%), Postives = 145/320 (45.31%), Query Frame = 3
Query: 3471 ISKLLRKCYDVVFETPPGRLWWNS---RCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKV---FTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQP-SYNHST-------IYYAYFVSFIIFGAFFTLNLFIGVIIDNFN 4388
            + K  RKC +   +  P R +  +   +    ++V  Q FE  I   I  +++ L ++  N P     KL   +LD     FT +F  E +LK FAF    YF D W   DF++V  ++V + ++ + +    M AF   R  RALR ++ +++  G++ ++   I++  ++  V L+ ++ + I++++GMQ+FG             RI+  I P                  N   NF       + LF+ AT + W  IM    D+      P +Y   T         YAYF SF    +F  +NLF+ VI+DNF+
Sbjct: 1117 LDKNQRKCVEFALKARPTRRYIPTNRLQFHVWRVVTSQPFEYLIFAFITGNTILLMMQYYNEP-----KLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGSVVDITMNEVSSEQ--MFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFG-------------RIA--IDPETQI--------------NRNNNFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCDPNAYPQDTDGLCGTDFAYAYFCSFYAICSFLIINLFVAVIMDNFD 1400          

HSP 6 Score: 84.3445 bits (207), Expect = 4.208e-16
Identity = 64/237 (27.00%), Postives = 112/237 (47.26%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNF 4385
            L+  +K+F  +FT EM++K +  G + YF   +   D ++V  +L+ L L+        +G    +R +R LR  +    W  +  +V +L+ ++ SI  +LL+  +F +IFS++GMQ+FGGKF           +  E +P                      NFD+     + +FQ+ T + W  +M   + S G G   S   S I   YF+  ++ G +  LN+F+ + +DN 
Sbjct:  490 LDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTE-AMDQRPIG-ISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKF----------NLGDEDVPRS--------------------NFDSFWRALVTVFQILTGEDWNAVMYTGIQSWG-GITESL--SAIPILYFIFLVVVGNYILLNVFLAIAVDNL 691          

HSP 7 Score: 78.5666 bits (192), Expect = 2.479e-14
Identity = 61/213 (28.64%), Postives = 109/213 (51.17%), Query Frame = 3
Query: 2394 FITLCIVMNTVLMSIDTPDNS-PEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPL--DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIG---TTVGAIGNLCIVLGIIIFIFAVVGMQLF---------GDKYSNFKNETLFPSFKGA------------EPR-WNFNDFTHSFMIVFRVLCGE 2936
            FI L I++++ +++ + P NS  + N  L   +YFFT  F +E  +K+IA G       + +  +N+ DF++V +S+V I L   SS +S++R  R+LRV +  ++      L  ++      V  IGN+ +V  +  F+FAV+G+QLF          +K +  + +  +  FKG             +P+ +NFND   + + +F V+  E
Sbjct:  838 FILLLIIVSSCMLAAEDPLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALRDSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGTFFSCTDAEKITKRECQGQYIEFKGPGLTNPVVKDREWQPQTFNFNDVPQAMLTLFTVMTFE 1050          

HSP 8 Score: 78.1814 bits (191), Expect = 3.385e-14
Identity = 65/220 (29.55%), Postives = 97/220 (44.09%), Query Frame = 3
Query: 2364 LIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSS------GMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFG----DKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGE-WIESMWDCMLVNGYQCVP 2990
            ++   PF E  I   I  NT+L+ +   +        L   N  FT+ F LE  LKL A  P+ YF + WN+FDF++V+ S+V+I ++             R FR LR+ KL      +  L      +  A+  + +++ +  FI+AVVGMQ+FG    D  +                  NF  F  S M++FR   GE W   M  C      +C P
Sbjct: 1150 VVTSQPF-EYLIFAFITGNTILLMMQYYNEPKLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGSVVDITMNEVSSEQMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFGRIAIDPETQINRNN------------NFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCDP 1356          

HSP 9 Score: 75.0998 bits (183), Expect = 3.126e-13
Identity = 58/178 (32.58%), Postives = 103/178 (57.87%), Query Frame = 3
Query:  528 AFYLLSPLNPIRKTAIRLLTHPVF-SFLVLTTIIINCVFMAK---NSNS------DTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFF----PVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGT 1019
            + ++ S  N  R    R+ T+  F +F++L  I+ +C+  A+   NSNS      +  +Y FT ++T+E TIK I+ G+I+++ ++ R A+N LDF+V+ ++ +          +  +  LR LRVLR L+ +    G+K VV  +  AVK + + M++TV    +F +IG+QL++GT
Sbjct:  812 SLFIFSNTNCFRVVCHRIATNSYFVNFILLLIIVSSCMLAAEDPLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALRDSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGT 989          

HSP 10 Score: 74.7146 bits (182), Expect = 3.699e-13
Identity = 56/205 (27.32%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2310 FCSWTCCPCYFKFQSLVALIILDPF---VELFITLCIVMNTVLMSIDTP---DNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPL-----DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSN--FKNETLFPSFKGAEP 2873
            FC     P      SL  +  LD F    ++ I + I  N   ++   P    +S  +N  L+ A + F   F +E+ LK+IA G    P  Y +  WN+ DF+IV++ L  I +     DS  +  LRAFR+LR  +L     ++ ++   I   +  + ++ +++  ++ I+A++G++LF  K  +  + N T  P+F    P
Sbjct:   48 FCLTLGNPIRSTAISLFTVFFLDVFRTPFDVMILITIFANCAALAAFQPLPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHP 252          

HSP 11 Score: 72.4034 bits (176), Expect = 2.078e-12
Identity = 64/241 (26.56%), Postives = 137/241 (56.85%), Query Frame = 3
Query: 4569 IMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWY-YFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEV--FNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQA 5282
            ++  + LN++ + +EH++QPE L   LD+ NK+F+ +FT E ++K+    ++ YF   +N FD ++VI S++   +   ++  P+  + +R VR+ RI ++ R   S   +  L+ SL+ S+ +++ + LLL + M I++++GM  F    ++   ++V   NF++F +A++ +FQI T   WN V+   +     +            I ++Y I  +++   +++N+++A+ ++N + A
Sbjct:  464 VIVFVFLNSLTLALEHYNQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTEAMDQRPIGISMLRCVRLLRIFKVTRYWSS---LSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGG-KFNLGDEDVPRSNFDSFWRALVTVFQILTGEDWNAVMYTGIQSWGGITESLSA------IPILYFIFLVVVGNYILLNVFLAIAVDNLADA 694          
BLAST of scna-1 vs. Ensembl Medaka
Match: ENSORLT00000044887.1 (sodium channel protein type 4 subunit alpha B [Source:NCBI gene;Acc:101167997])

HSP 1 Score: 1156.74 bits (2991), Expect = 0.000e+0
Identity = 770/1924 (40.02%), Postives = 1112/1924 (57.80%), Query Frame = 3
Query:  168 TGTFFDCAAEKFQILTKEVLQYHDAYTEISKPEVIISNENIESDLHSHYTPIKKKQDDVP-KEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYK-KQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPV--------FSFLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNW--LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDXXXXXXXXXXXXXIIDRIDEELGVESS--EDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSICDYDSTDRNLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPRSIAVGKRIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMF------GMKRITEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMI----SEINQYIKNPELQSALSALSIYDAETKVRKKELIKQWLL--KTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPL-DSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSV-SNDVK---IPEEQ--LSNPELWFKYSL----KETEVPKF-------------------------------DEDPEINEVEIIYSTSPEDCLPNF-ISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIAL-VSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKE--------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAY 5693
             G  F    E FQ  T + L         +  E  I+ E  E+    HY   ++   DV    P P LE GK LP    D  P   L G+PL ++DPFY+K K+TF+V+   K IFRFS T A Y+ SP +PIR+ AI++L H              ++ TI+ NC FMA +     +  +EY FT IYT E  IK ++RG  +  FT+LRD WNWLDF VI +AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL++AVK+L D M+LTVF LS+F LIGLQL+ G L +KCV++  H +    P       + + WT   EF  +E N+  ++  +       +     CP+G+ C++    NPNYGYT+FD F  + L  FRLMTQDYWENLY  T+R+ G  ++++F++VIF GSFYLIN+ILA+VAM+Y++   A  AE    E E +   E     I + ++++ V+ +   D        P      S++   R Q+L+    +D   S    + ++       FS             TR    + S F  +++   ++   ++    +    P  +   +    S  +FS +L +  SK  L      + NS++F        K    +D  G     L   L            +++ ES+ +        +   M+    S  N   +     SA S L+    E +   K+    W +    +  W C PC+ + + LV +++ DPF++L IT+CIV+NT+ M+++    + E N  L   N  F+  F  E  LK+IAL P  YFQ  WN+FD IIV LSL+E+ L D  G+S+LR+FRLLRVFKLA+SW T+N L  IIG ++GA+GNL +VL II+FIFAVVGMQLFG  Y +   +    S   + PRW+  DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F++ M++GNLVLLNLFLALLLSSF S++L   +DD  E N L  AI RI R + W++ Q+        + F   + ++R+K  ++  M     +    +    +V    V+   +PE+   ++NP+L     +     +TE P+                                +E+ E +E+    +  P++C P+  +S+   +C D+      G++WW  R    ++VEH +FE+FII MI++SS  L  ED  +  R  +K+ LE  DK+FT IF  EM+LKW A+G  KYF + WCWLDF IV ++  VS+  + +   +  +   + +RT RALRPLRA SR+ G+R+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKF +CV+   +     EI  NK+ C   K       W   ++NFDNV  GYL L QVATFKGW++IM  AVDS  +  QP    +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK+++ G  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP   +    F +   Q FDI IM +I+ N I M +E  +Q  +++  L  +N  FIV+FT E L+K++A R Y+F + WN+FDFV+VILSIV   +  ++    VSPT  RV+R+ RIGRILRL++ AKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GM+ F+ V     ID++FNFETFG +MI LFQI+TS GW+ +L+ ++N  P+ C+          +G CG+  + + + ++Y+IISFL+++NMYIA+ILENFS AT++  E L++DD+++FYE WE++D +A  FI    L DF + + +PL I KPN ++L  +++P+   D ++C+D+L   T+R LG+  E D  +  + +        K+    ++ TL+R++E  +A +I +  + +
Sbjct:    2 AGCVFPMGPESFQRFTPDSL---------AAIEQRIAQE--EARRKKHY---QEDLGDVELPRPRPDLEAGKQLPRIFADIPPH--LLGVPLEDIDPFYFKDKRTFIVLNKGKAIFRFSATSALYIFSPFHPIRRLAIKILVHSYPYAQSFAQVVLFIMCTILTNCCFMAMSEPTPWAKYLEYTFTGIYTFESLIKILARGFCVGPFTFLRDPWNWLDFSVIVMAYVTEFVD-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQAVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVRTTAHCINGTLPTNTSFYCNNKTWTSIKEFTEDEDNYYKVEGAKDALICGNSSDAGKCPDGFECLKAGR-NPNYGYTSFDTFGWAFLSLFRLMTQDYWENLYHQTLRSAGKTYMVFFVVVIFLGSFYLINLILAVVAMAYEEQNQATIAEACQKEKEFQLAME-----ILKKEQQIAVQKTVESDARTSLDASPFGPPLDSLEERRRSQALMGVADSDANLSDEKLLQSLHPFLARSFST-----------RTRRGSQVSSIFNFRLRSRGSEGEMADDEYSV----PGDVEGVRSRTYSGGTFSGILPQPWSKRRLSTFSTASKNSQVFYPTLNINGKLFVAVDQNGVSPAPLQGQL------PACTMEKVKEESVPTS-----TTELSTMLLPRPSSTNGSERRGRAPSATSYLTDAMEELEESHKKCHPCWYVFAHQYLVWECSPCWLRLKQLVKIMVTDPFLDLAITVCIVLNTLFMAMEHYPMTEEFNGMLTIGNLVFSGIFTAEMVLKVIALDPYYYFQTGWNIFDSIIVCLSLMELGLSDVEGLSVLRSFRLLRVFKLARSWPTLNTLIKIIGNSIGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDCVCKI---SKDCSLPRWHMKDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCILVFMLVMVIGNLVLLNLFLALLLSSFSSDNLSAPDDD-GEMNNLHIAIHRITRGLAWLRRQV-------VDFFNGNLKRRRQKRKEAKAMMKLKRLSTIHTEVNGAVIGRHVEKYVVPEDDSYMTNPDLTISVPIAPGESDTEFPEEEEEEEEEEGEGEEKDDISLSEGSTVDLRKPGEEEDEYSELAE-EAMDPDNCFPDVCVSRF--QCCDIDTTAGLGKIWWRLRKTCFQIVEHSWFESFIIFMILLSSGALAFEDIYIEQRRMVKVVLEFADKIFTYIFILEMILKWLAYGFKKYFTNYWCWLDFFIVDVSSGVSICCNTLWLLS--VTTMRVLRTFRALRPLRAASRFAGIRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCVSRSGYIHDFREI-NNKSECE-AKNDTSQYYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRAVEEQPVKEINLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKRKIRGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNTLQGFFFDLVGKQAFDIIIMVLILFNMITMMVETDEQSPQMEKILYHVNLAFIVVFTIECLIKIVALRCYFFTIGWNIFDFVVVILSIVGIVLADIIEKYFVSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMANFAYVKRQAGIDDMFNFETFGNSMICLFQITTSAGWDSLLSPILNNSPEECDANIPHTGTTVRGNCGNPSVGITFFVTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFEMFYEVWEKFDPEATQFIEYAKLSDFADALSEPLRIAKPNRIKLISMDLPMVSGDKIHCLDILFAFTKRVLGESGEMDALKQQMEEKFMMANPSKISYEPITTTLRRKQEEVSATIIQRCYRRH 1857          
BLAST of scna-1 vs. Ensembl Medaka
Match: scn12aa (sodium channel protein type 4 subunit alpha [Source:NCBI gene;Acc:101159774])

HSP 1 Score: 897.116 bits (2317), Expect = 0.000e+0
Identity = 559/1230 (45.45%), Postives = 770/1230 (62.60%), Query Frame = 3
Query: 2205 IKNPELQSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFG------RCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWF------------------------------KYSLKETEV-------PKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCN--------KEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTER--LKQNRKL 5723
            ++   + S++S  S    E    +++    W    K +  W+CCP + K +  V  +++DPF++L IT+CIV+NT+ M+++    + E N  L   N  FT  F  E  LKL AL P  YFQ+ WN+FD +IV LSL+E+ L +  G+S+LR+FRLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y ++  +    +F    PRW+  DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F++ M++GNLV+LNLFLALLLSSF S++L   ++D  + N +Q AI RI   I W          L + I G      R    K K+  +S  +   H       Y E  ++ D    +  ++NP L                                K SL E           + D+  E++E     S  PEDC P F  +   +C ++   T  G  WW  R    ++VEH +FETFII MI++SS  L  ED  +  R  +K+ LE  DKVF+ IF  EM LKW A+G  KYF + WCWLDF+IV ++L+SLV + +G       A K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKF KCVN   F   S  I+ NK+ CL M        W   ++NFDNV  GYL L QVATFKGW+EIM  AVDS G+  QPS   +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK+++GG  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP   +    F +   Q FDI IM +I++N + M +E  +Q E++++ L+ IN VFIVIFT E L+K+ A R Y+F V WN+FDFV++ILSIV   +  ++    VSPT  RV+R+ RIGR+LRL+++AKGIRTLLF+L++S+PAL NI LLL ++MFIYAI GM+ F+ V     ID++FNFETFG ++I LFQISTS GW+ +L+ +M+  P+ C+          +G CG+  + + + +SY+IISFL+++NMYIA+ILENFS AT++  E L++DD+++FYE WE++D++A  FI    L  F + + +PL I KPN + L  +++P+   D ++C+D+L   T+R LG+  E DT +  + +        K+    +++TL+R+ E  +A +I +  + +  R  LKQ   L
Sbjct:  567 VRRKRVMSSVSFFSDAMDELTESRQKCPPCWYSFAKRYLIWSCCPWWLKLKEWVKFMVMDPFLDLGITICIVLNTLFMALEHYPMTDEFNTMLSVGNLVFTGIFTAEMVLKLTALDPYYYFQQGWNIFDGVIVCLSLMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDYVCKI---AFDCQLPRWHMKDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCILVFMLVMVIGNLVVLNLFLALLLSSFSSDNLSAPDED-GDLNNIQIAIARINSGISW----------LFRNIIGFFNRSLRGEKNKTKEANESIKVAVNHTESNGGIYGEKYITPD---EDSYITNPNLTVMVPIAPGESDVEFLEEEENSESSDDEEKAEKISLSEGSTVDLRKPGEEADDLSELSE----DSMEPEDCFPQFCLRHC-QCCNIDISTGLGLAWWRLRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIERRKVIKVILEYADKVFSYIFVLEMFLKWIAYGFKKYFTNYWCWLDFLIVDVSLISLVANSLGYS--DFAAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGKCVNRTGFIH-SITIVNNKSDCLAMNDT--QFYWTTVKVNFDNVGLGYLSLLQVATFKGWMEIMNAAVDSRGVEEQPSREINLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKRKLGGH-DLFMTEEQKKYYNAMKKLGSKKPQKPIPRPANILQAFFFDLVSKQAFDIMIMMLIIVNMVTMMVETDEQSEQMESILNTINLVFIVIFTTECLIKIFALRCYFFTVAWNIFDFVVIILSIVGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRAAKGIRTLLFALMMSMPALFNIGLLLFLVMFIYAIFGMANFAYVKKQDGIDDMFNFETFGNSIICLFQISTSAGWDNLLSPIMSNSPEECDIHFINTGTNTRGNCGNPSMGIAFFVSYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFEMFYEVWEKFDSEATQFIEFSMLSSFADALSEPLRIAKPNKIHLISMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDTLKQQMEEKFMMTNPSKISHEPITSTLRRKLEEVSAIIIQRGYRRHLVRRQLKQASYL 1768          

HSP 2 Score: 236.498 bits (602), Expect = 5.930e-62
Identity = 136/298 (45.64%), Postives = 189/298 (63.42%), Query Frame = 3
Query:  597 FSFLVLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTL-LYFEPNEFENLTDAEKWTVKYEFFNNETNW--LDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            F   + T I +    M    +     Y FT IYT E  IK  +RG     FT+LRD WNWLDFIVI +AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L +KCV+S  H +   + PN    + +   W+   +F  NE N+   +  +      Y      CP+G+ C++    NPNY YT+FD F  + L  FRLMTQDYWE L+  T+R+ G  ++++F++VIF GSFYL+N+ILA+VAM+Y++   A  AE
Sbjct:   34 FCLFLKTEICLRAALMGCILSRHAYRYTFTGIYTFESAIKIFARGFCTMPFTFLRDPWNWLDFIVIVMAYVTEFID-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGLLRQKCVRSLGHCINSSYIPNT-TFVCNNRTWSSPTDFLTNEDNFYKTEGAKDGLICGYGSDAGKCPDGFECLKVGR-NPNYDYTSFDTFGWAFLALFRLMTQDYWEELFHQTLRSAGKTYMVFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIAE 328          

HSP 3 Score: 82.4185 bits (202), Expect = 5.282e-15
Identity = 67/276 (24.28%), Postives = 121/276 (43.84%), Query Frame = 3
Query: 3696 FTIIFTAEMLLKWFAFGLNK----YFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNF---DNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTI---------------------------------YYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            FT I+T E  +K FA G       + +D W WLDFI++ +A V+  +         +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV +     I++  IPN       +       +  ++ NF   +   +G +C +     K       D  +   +G  P+Y++++                                  Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:   62 FTGIYTFESAIKIFARGFCTMPFTFLRDPWNWLDFIVIVMAYVTEFID--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGLLRQKCVRS-LGHCINSSYIPNTTFVCNNRTWSSPTDFLTNEDNFYKTEGAKDGLICGYGSDAGK-----CPDGFECLKVGRNPNYDYTSFDTFGWAFLALFRLMTQDYWEELFHQTLRSAGKTYMVFFVLVIFLGSFYLVNLILAVVAMAYEEQNQ 323          

HSP 4 Score: 63.1586 bits (152), Expect = 3.239e-9
Identity = 49/145 (33.79%), Postives = 78/145 (53.79%), Query Frame = 3
Query: 4386 NVQKKRVGGSLEMF------MTEDQKK----YYNAMKK--MSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIA-QRWYYFKVPWNMFDFVIVILSIV 4781
            +V++KRV  S+  F      +TE ++K    +Y+  K+  + S  P        LK+   +  + ++   D+ I   I+LNT+ M +EH+   ++  T L   N VF  IFT E +LKL A   +YYF+  WN+FD VIV LS++
Sbjct:  566 SVRRKRVMSSVSFFSDAMDELTESRQKCPPCWYSFAKRYLIWSCCPWW------LKLKEWVKFMVMDPFLDLGITICIVLNTLFMALEHYPMTDEFNTMLSVGNLVFTGIFTAEMVLKLTALDPYYYFQQGWNIFDGVIVCLSLM 704          

HSP 5 Score: 56.9954 bits (136), Expect = 2.348e-7
Identity = 35/114 (30.70%), Postives = 63/114 (55.26%), Query Frame = 3
Query: 2490 YFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            Y FT  +  E+ +K+ A G    P  + ++ WN  DFI+++++ V   +D   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF
Sbjct:   60 YTFTGIYTFESAIKIFARGFCTMPFTFLRDPWNWLDFIVIVMAYVTEFIDLGNVSALRTFRVLRAL---KTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLF 170          

HSP 6 Score: 54.299 bits (129), Expect = 1.627e-6
Identity = 73/322 (22.67%), Postives = 138/322 (42.86%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLG-----NXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK--SFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNG-------DIHI---LYFMMVIFFGSFYLINVILAIV 1439
            +RKT  +++ H  F   ++  I+++   +A        +      +EY   VF+ I+ LE  +K I+ G       Y  + W WLDF+++ ++ +      LG      + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    KCV    F H++                        NN+++ L       N T   W T                     NFDN  +  L   ++ T   W  +    + + G       +I++   +YF++ I FGSF+ +N+ + ++
Sbjct: 1037 LRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIERRKVIKVILEYADKVFSYIFVLEMFLKWIAYGFK----KYFTNYWCWLDFLIVDVSLISLVANSLGYSDFAAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGK-FGKCVNRTGFIHSI---------------------TIVNNKSDCL-----AMNDTQFYWTTV------------------KVNFDNVGLGYLSLLQVATFKGWMEIMNAAVDSRGVEEQPSREINLYMYIYFVVFIIFGSFFTLNLFIGVI 1309          
BLAST of scna-1 vs. Ensembl Medaka
Match: scn12aa (sodium channel protein type 4 subunit alpha [Source:NCBI gene;Acc:101159774])

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 546/1162 (46.99%), Postives = 750/1162 (64.54%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDS-SGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQ-CVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFG------RCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKL--LR--KCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCN--------KEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTER--LKQNRKL 5723
            K +  W+CCP + K +  V  +++DPF++L IT+CIV+NT+ M+++    + E N  L   N  FT  F  E  LKL AL P  YFQ+ WN+FD +IV LSL+E+ L +  G+S+LR+FRLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLFG  Y ++  +    +F    PRW+  DF HSF+IVFRVLCGEWIE+MWDCM V G   C+  F++ M++GNLV+LNLFLALLLSSF S++L   ++D  + N +Q AI RI   I W          L + I G      R    K K+  +S  +   H       Y E  ++ D    +  ++NP L          VP     P  ++VE +      +   +    +  LR  +C ++   T  G  WW  R    ++VEH +FETFII MI++SS  L  ED  +  R  +K+ LE  DKVF+ IF  EM LKW A+G  KYF + WCWLDF+IV ++L+SLV + +G       A K++RTLRALRPLRA+SR+EGMR+VVNALI AIPSI NVLLVCL+FWLIFSI+G+ LF GKF KCVN   F   S  I+ NK+ CL M        W   ++NFDNV  GYL L QVATFKGW+EIM  AVDS G+  QPS   +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QK+++ G  ++FMTE+QKKYYNAMKK+ S  PQKPIPRP   +    F +   Q FDI IM +I++N + M +E  +Q E++++ L+ IN VFIVIFT E L+K+ A R Y+F V WN+FDFV++ILSIV   +  ++    VSPT  RV+R+ RIGR+LRL+++AKGIRTLLF+L++S+PAL NI LLL ++MFIYAI GM+ F+ V     ID++FNFETFG ++I LFQISTS GW+ +L+ +M+  P+ C+          +G CG+  + + + +SY+IISFL+++NMYIA+ILENFS AT++  E L++DD+++FYE WE++D++A  FI    L  F + + +PL I KPN + L  +++P+   D ++C+D+L   T+R LG+  E DT +  + +        K+    +++TL+R+ E  +A +I +  + +  R  LKQ   L
Sbjct:  496 KRYLIWSCCPWWLKLKEWVKFMVMDPFLDLGITICIVLNTLFMALEHYPMTDEFNTMLSVGNLVFTGIFTAEMVLKLTALDPYYYFQQGWNIFDGVIVCLSLMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDYVCKI---AFDCQLPRWHMKDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCILVFMLVMVIGNLVVLNLFLALLLSSFSSDNLSAPDED-GDLNNIQIAIARINSGISW----------LFRNIIGFFNRSLRGEKNKTKEANESIKVAVNHTESNGGIYGEKYITPD---EDSYITNPNL-------TVMVPI---APGESDVEFLEEEENSESSDDEEKAVICLRHCQCCNIDISTGLGLAWWRLRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIERRKVIKVILEYADKVFSYIFVLEMFLKWIAYGFKKYFTNYWCWLDFLIVDVSLISLVANSLGYS--DFAAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGKCVNRTGFIH-SITIVNNKSDCLAMNDT--QFYWTTVKVNFDNVGLGYLSLLQVATFKGWMEIMNAAVDSRGVEEQPSREINLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKRKISGH-DLFMTEEQKKYYNAMKKLGSKKPQKPIPRPANILQAFFFDLVSKQAFDIMIMMLIIVNMVTMMVETDEQSEQMESILNTINLVFIVIFTTECLIKIFALRCYFFTVAWNIFDFVVIILSIVGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRAAKGIRTLLFALMMSMPALFNIGLLLFLVMFIYAIFGMANFAYVKKQDGIDDMFNFETFGNSIICLFQISTSAGWDNLLSPIMSNSPEECDIHFINTGTNTRGNCGNPSMGIAFFVSYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFEMFYEVWEKFDSEATQFIEFSMLSSFADALSEPLRIAKPNKIHLISMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDTLKQQMEEKFMMTNPSKISHEPITSTLRRKLEEVSAIIIQRGYRRHLVRRQLKQASYL 1624          

HSP 2 Score: 310.842 bits (795), Expect = 5.313e-85
Identity = 182/399 (45.61%), Postives = 249/399 (62.41%), Query Frame = 3
Query:  324 KKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQ-TFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPV-FS--------FLVLTTIIINCVFMAKNSN---SDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            + ++   P +P   LE GK LP   GD  P  +L G+PL ++DPFYY+ Q TFVV+   K IFRFS+T A Y+ SP + IR  AI++L H   FS        + ++ TI+ NC FMA +     +  +EY FT IYT E  IK  +RG     FT+LRD WNWLDFIVI +AY+  F   LGN+SALR+ RVLRALKT++ +PG+KT+VGAL+++VK+L D M+LTVF LS+F LIGLQL+ G L +KCV+S  H +         N +     T  Y F+  E       +      Y      CP+G+ C++    NPNY YT+FD F  + L  FRLMTQDYWE L+  T+R+ G  ++++F++VIF GSFYL+N+ILA+VAM+Y++   A  AE
Sbjct:   38 EAQRGGEPLKPRADLEAGKQLPRIFGDIPP--ELVGVPLEDIDPFYYRNQKTFVVLNKGKAIFRFSSTSALYIFSPFHFIRSIAIKILVHSYPFSATITDSIFYFIMFTILTNCFFMAMSDPPTWTKYLEYTFTGIYTFESAIKIFARGFCTMPFTFLRDPWNWLDFIVIVMAYVTEFID-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGLLRQKCVRSLGHCI---------NSSYIPNTTFVYNFYKTEGA-----KDGLICGYGSDAGKCPDGFECLKVGR-NPNYDYTSFDTFGWAFLALFRLMTQDYWEELFHQTLRSAGKTYMVFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIAE 418          

HSP 3 Score: 118.242 bits (295), Expect = 5.516e-26
Identity = 118/454 (25.99%), Postives = 193/454 (42.51%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLKWFAFGLNK----YFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF-YKCVNNDTFERISAEIIPN----------KNACLIMKAMYGNVSWENSQ---------------LNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQ---------KKRVGGSLEMFMTEDQKKYYN----AMKKMSSTAPQKPI-----------------------PRPK---------------------LKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIA-QRWYYFKVPWNMFDFVIVILSIV 4781
            L+  FT I+T E  +K FA G       + +D W WLDFI++ +A V+  +         +G   A+RT R LR L+ +S   G++ +V ALIQ++  + +V+++ +    +F++IG+QLF G    KCV +     I++  IPN          + A   +   YG+ + +                   +FD     +L LF++ T   W E+    + S G            Y  +FV  I  G+F+ +NL + V+   +  Q         +K     L M     +++  N    A ++  +T PQ                           R K                     LK+   +  + ++   D+ I   I+LNT+ M +EH+   ++  T L   N VF  IFT E +LKL A   +YYF+  WN+FD VIV LS++
Sbjct:  164 LEYTFTGIYTFESAIKIFARGFCTMPFTFLRDPWNWLDFIVIVMAYVTEFID--------LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGLLRQKCVRSLG-HCINSSYIPNTTFVYNFYKTEGAKDGLICGYGSDAGKCPDGFECLKVGRNPNYDYTSFDTFGWAFLALFRLMTQDYWEELFHQTLRSAG----------KTYMVFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIAEAWQKEREFQLAMEHLRREQRVGNGKRAAQQQQETTVPQDSFRGDCWRSSMSNNFLFSFHLELTESRQKCPPCWYSFAKRYLIWSCCPWWLKLKEWVKFMVMDPFLDLGITICIVLNTLFMALEHYPMTDEFNTMLSVGNLVFTGIFTAEMVLKLTALDPYYYFQQGWNIFDGVIVCLSLM 598          

HSP 4 Score: 63.929 bits (154), Expect = 2.169e-9
Identity = 54/200 (27.00%), Postives = 89/200 (44.50%), Query Frame = 3
Query: 2304 KTFCSWTCCPCYFKFQSLVALIILDPF------------------------VELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALG----PEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLF 2810
            KTF         F+F S  AL I  PF                        +  FI   I+ N   M++  P   P    +L+   Y FT  +  E+ +K+ A G    P  + ++ WN  DFI+++++ V   +D   +S LR FR+LR     K+   +  L  I+G  + ++  L  V+ + +F   +FA++G+QLF
Sbjct:   86 KTFVVLNKGKAIFRFSSTSALYIFSPFHFIRSIAIKILVHSYPFSATITDSIFYFIMFTILTNCFFMAMSDP---PTWTKYLE---YTFTGIYTFESAIKIFARGFCTMPFTFLRDPWNWLDFIVIVMAYVTEFIDLGNVSALRTFRVLRAL---KTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLF 276          

HSP 5 Score: 55.4546 bits (132), Expect = 7.109e-7
Identity = 74/337 (21.96%), Postives = 144/337 (42.73%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEY---VFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLG-----NXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVK--SFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNG-------DIHI---LYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE 1484
            +RKT  +++ H  F   ++  I+++   +A        +      +EY   VF+ I+ LE  +K I+ G       Y  + W WLDF+++ ++ +      LG      + +LR+LR LR L+ ++   GM+ VV AL+ A+  + + +++ +    IF ++G+ L+ G    KCV    F H++                        NN+++ L       N T   W T                     NFDN  +  L   ++ T   W  +    + + G       +I++   +YF++ I FGSF+ +N+ + ++  +++  +  I   +
Sbjct:  893 LRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIERRKVIKVILEYADKVFSYIFVLEMFLKWIAYGFK----KYFTNYWCWLDFLIVDVSLISLVANSLGYSDFAAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGK-FGKCVNRTGFIHSI---------------------TIVNNKSDCL-----AMNDTQFYWTTV------------------KVNFDNVGLGYLSLLQVATFKGWMEIMNAAVDSRGVEEQPSREINLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKRKISGHD 1180          
BLAST of scna-1 vs. Ensembl Medaka
Match: ENSORLT00000035153.1 (sodium channel protein type 2 subunit alpha [Source:NCBI gene;Acc:101155239])

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 569/1195 (47.62%), Postives = 750/1195 (62.76%), Query Frame = 3
Query: 2253 DAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETE-------------VPKFDEDPEINEVE-------------------IIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVC--NKE------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLK 5708
            D E   RKK     W    + F  W CCP + K +  V LI++DPF +L IT+CIV+NT+ M+++      E    L   N  FT  F  E  LK+IAL P  YFQE WN+FD IIV +SLVE+      ++LLR+ RLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLF  +Y    N +   + +  +PRW+  DF HSF+IVFRVLCGEWIE+MWDCM V G  +C+  ++M M++GNLV+LNLFLALLLSSF +++L   E+DS + N LQ AI RI R   ++K          K I      K++K+  K + +      K    Y   S SND  +    ++NP L     +   E                 DED E++  E                   +  S  P  C P    + + KC  V  +    + WW  R    ++VEH +FE+FII MI++SS  L  ED     R  +K+ LE  DK+FT IF  EMLLKW A+G  KYF +AWCWLDF+IV ++LVSLV + +      +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSIFNVLLVCL+FWLIFSI+G+ LF GKFYKC+N         E IPNK  C        ++ W+N ++N+DNV  GYL L QVATFKGW++IM  AVDS     QP +  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK++  S ++FMTEDQKKYYNAMKK+ S  PQKPIPRP  KI   IF I   Q FDI IM +I LN + M +E  DQ EK    L  IN VFIVIF+GE LLK+I  R Y+F   WN+FD V+VILSI    +  ++ +  VSPT  RV+R+ RIGR+LRL+KSAKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TSGGW+ +L+ ++N +   C  NKE      KG CG+  + + + +SY+IISFL+++NMYIAVILENF+ AT++  + L++DD+++FYE WE +D  A  FI    L DF + ++ PL +PKPN + L  +++PI   D ++C+D+L   T+R LG+  E D     + +        KV    ++ TL+R+ E  +A VI +  + YT+ +K
Sbjct:  649 DVEKNSRKK-CPPCWYKFAENFLIWDCCPAWQKIKKFVKLIVMDPFADLTITICIVLNTLFMAMEHHPMQDEFTKMLSIGNKVFTGIFTAEMVLKIIALDPYYYFQERWNIFDGIIVTISLVELCF---SINLLRSLRLLRVFKLAKSWPTLNSLLKIIGNSVGAMGNLTLVLAIIVFIFAVVGMQLFEREYR--YNVSKISADR--KPRWHMMDFFHSFLIVFRVLCGEWIETMWDCMEVAGVTKCLIVYMMVMVVGNLVMLNLFLALLLSSFSADNLAAIEEDS-DLNNLQIAIKRICRGFDFIK-------SFLKNICNSNCHKEKKEKTKDNNVNLTGVDKSGDKYIVNSKSNDSIM--SFINNPSLTVTVPIAAVESDFEVLNTEDFSSASSDDEDEELSSSEGSTINDYEAGEIADSVGGELEESNDPSPCFPAVCLQNI-KCCQVNVDVGFWKAWWKLRQTCFRIVEHSWFESFIIFMILLSSGALAFEDVYSEQRKTIKIILEFADKMFTYIFILEMLLKWLAYGFAKYFTNAWCWLDFLIVDVSLVSLVANALELT--DLGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYKCINKTDGVECDPENIPNKTFC----TNETDLIWKNLKINYDNVGMGYLALLQVATFKGWMDIMYAAVDSGEPDEQPVFERNIKMYLYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKI--STDLFMTEDQKKYYNAMKKLGSKKPQKPIPRPSNKIQGFIFDIISKQAFDIVIMVLIWLNMVTMMVETADQSEKQTYILRVINYVFIVIFSGECLLKMIGLRHYFFMNGWNIFDLVVVILSIAGVFLAKIIEDYFVSPTLFRVIRLARIGRVLRLIKSAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSSFAYVKKDKGIDDLFNFETFGNSMICLFQITTSGGWDTLLDPILNSNIDDCDRNKEHPGSNTKGDCGNPPVGIAFFVSYIIISFLIVVNMYIAVILENFNVATEESTDPLSEDDFEMFYEVWERFDPGATQFIHYYSLSDFADALNPPLQVPKPNRIDLIFMDLPIVSGDRIHCLDILFAFTKRVLGEGGEMDILREQMEERFMASNPSKVSYEPITTTLRRKEELRSATVIQRAFRRYTKNIK 1816          

HSP 2 Score: 314.309 bits (804), Expect = 5.577e-86
Identity = 185/393 (47.07%), Postives = 248/393 (63.10%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHP-------------VFSFLVLTTIIINCVFMAKNSNSDT-------VEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWL----DPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            +PN  L  GK LP   GD      L   PL ELDP YY ++TF+V+   K IFRF+   A Y L P NPIR+ +I++L H              +F+ L++ TI+ NC  M ++S++D+       VEY FT IYT E  +K ++RG  + EFT+LRD WNWLDF VI LAYL  F    G LSALR+ RVLRA K ++ +PG+KT+VGAL ++VK+L D M+LTVF LS+F L+GLQL+ G L  KCV+   H      P E  NLT  E W +  E  N+   +L    DPL  C N TY      CPEGY C+   +  P++GYT+FD+F  + L  FRLMTQD+WENLYQ T+R +G  ++++F++VIF GSFYLIN+ILA+VAM+Y++
Sbjct:   50 KPNRDLMAGKPLPILYGDI--PNGLVSTPLEELDPAYYNQKTFIVLNKRKMIFRFNAAPALYFLGPFNPIRRLSIKILVHSYPLHKVDIDSPCRLFNVLIMCTILTNCALMTRSSSADSNSTWTKPVEYTFTAIYTFESLVKILARGFCLGEFTFLRDPWNWLDFSVIVLAYLNEF-ADFGRLSALRTFRVLRAFKAISVIPGLKTIVGALFQSVKKLTDVMILTVFCLSVFALVGLQLFMGHLKNKCVRQPEHV----TPEE--NLT--EYWRILIENANSNHYFLSGKRDPLL-CGNSTYA---GKCPEGYTCVSFGS-TPDFGYTSFDSFGWAFLALFRLMTQDFWENLYQQTLRASGKPYMIFFVLVIFLGSFYLINLILAVVAMAYEE 426          

HSP 3 Score: 80.1073 bits (196), Expect = 2.305e-14
Identity = 70/276 (25.36%), Postives = 122/276 (44.20%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLK----WFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCVNNDTFERISAE---------IIPNKNA-----------CLIMKAMYGNVSWEN------------SQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K     F  G   + +D W WLDF ++       VL+Y+   A   G   A+RT R LR  +A+S   G++ +V AL Q++  + +V+++ +    +F+++G+QLF G    KCV     E ++ E         +I N N+            L   + Y     E                +FD+    +L LF++ T   W  +    + ++G   +P       Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  174 VEYTFTAIYTFESLVKILARGFCLGEFTFLRDPWNWLDFSVI-------VLAYLNEFA-DFGRLSALRTFRVLRAFKAISVIPGLKTIVGALFQSVKKLTDVMILTVFCLSVFALVGLQLFMGHLKNKCVRQP--EHVTPEENLTEYWRILIENANSNHYFLSGKRDPLLCGNSTYAGKCPEGYTCVSFGSTPDFGYTSFDSFGWAFLALFRLMTQDFWENLYQQTLRASG---KP-------YMIFFVLVIFLGSFYLINLILAVVAMAYEEQSQ 429          

HSP 4 Score: 61.6178 bits (148), Expect = 1.097e-8
Identity = 59/220 (26.82%), Postives = 101/220 (45.91%), Query Frame = 3
Query: 2391 LFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDF----------THSFMIVFR--VLCGEWIESMWDCMLVNGYQCVPF 2993
            + I   I+ N  LM+  +  +S   + + K   Y FT  +  E+ +K++A    LG   + ++ WN  DF +++L+ +    D   +S LR FR+LR F   K+   +  L  I+G    ++  L  V+ + +F   +FA+VG+QLF     + KN+ +    +   P  N  ++           H F+   R  +LCG    S +      GY CV F
Sbjct:  145 VLIMCTILTNCALMTRSSSADSN--STWTKPVEYTFTAIYTFESLVKILARGFCLGEFTFLRDPWNWLDFSVIVLAYLNEFADFGRLSALRTFRVLRAF---KAISVIPGLKTIVGALFQSVKKLTDVMILTVFCLSVFALVGLQLF---MGHLKNKCVRQP-EHVTPEENLTEYWRILIENANSNHYFLSGKRDPLLCG---NSTYAGKCPEGYTCVSF 352          

HSP 5 Score: 55.0694 bits (131), Expect = 1.077e-6
Identity = 71/334 (21.26%), Postives = 143/334 (42.81%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA----KNSNSDTVEYV-------FTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTN---------GDIHI-LYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            +R+T  R++ H  F   ++  I+++   +A     +    T++ +       FT I+ LE  +K ++ G       Y  +AW WLDF+++ ++ +           LG + +LR+LR LR L+ ++   GM+ VV ALL A+  + + +++ +    IF ++G+ L+ G    KC+   +   +  +P    N T          F  NET+ +             W                       N+DN  +  L   ++ T   W ++    + +           +I + LYF++ I FGSF+ +N+ + ++  +++  +  I  +
Sbjct: 1094 LRQTCFRIVEHSWFESFIIFMILLSSGALAFEDVYSEQRKTIKIILEFADKMFTYIFILEMLLKWLAYGFA----KYFTNAWCWLDFLIVDVSLVSLVANALELTDLGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFY-KCINKTDG--VECDPENIPNKT----------FCTNETDLI-------------WKNL------------------KINYDNVGMGYLALLQVATFKGWMDIMYAAVDSGEPDEQPVFERNIKMYLYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKISTD 1379          
BLAST of scna-1 vs. Ensembl Medaka
Match: ENSORLT00000043679.1 (sodium channel protein type 2 subunit alpha [Source:NCBI gene;Acc:101155239])

HSP 1 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 564/1237 (45.59%), Postives = 759/1237 (61.36%), Query Frame = 3
Query: 2187 SEINQYIKNPEL----QSALSALSIYDAETKVRKKELIKQW--LLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGY-QCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIR-----------------FAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKS---YYELSVSNDVKIPEEQLSNPELWF---------KYSLKETEVPKFDEDPEINEVE-------------------IIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVC--NKE------KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLK 5708
            S++  Y++ PE     QS +S ++    E +  +K+    W    + F  W CCP + K +  V LI++DPF +L IT+CIV+NT+ M+++      E    L   N  FT  F  E  LK+IAL P  YFQE WN+FD IIV +SLVE+      ++LLR+ RLLRVFKLAKSW T+N L  IIG +VGA+GNL +VL II+FIFAVVGMQLF  +Y    N +   + +  +PRW+  DF HSF+IVFRVLCGEWIE+MWDCM V G  +C+  ++M M++GNLV  + F +    +  +      E+DS + N LQ AI RI R   ++K  ++                  ++   K+ FG   +     L   H   N +    +KS   Y   S SND  +    ++NP L            + +  TE    DED E++  E                   +  S  P  C P    + + KC  V  +    + WW  R    ++VEH +FE+FII MI++SS  L  ED     R  +K+ LE  DK+FT IF  EMLLKW A+G  KYF +AWCWLDF+IV ++LVSLV + +      +GA K++RTLRALRPLRA+SR+EGMR+VVNAL+ AIPSIFNVLLVCL+FWLIFSI+G+ LF GKFYKC+N         E IPNK  C        ++ W+N ++N+DNV  GYL L QVATFKGW++IM  AVDS     QP +  +   Y YFV FIIFG+FFTLNLFIGVIIDNFN QKK++  S ++FMTEDQKKYYNAMKK+ S  PQKPIPRP  KI   IF I   Q FDI IM +I LN + M +E  DQ EK    L  IN VFIVIF+GE LLK+I  R Y+F   WN+FD V+VILSI    +  ++ +  VSPT  RV+R+ RIGR+LRL+KSAKGIRTLLF+L++SLPAL NI LLL ++MFIYAI GMS F+ V     ID++FNFETFG +MI LFQI+TSGGW+ +L+ ++N +   C  NKE      KG CG+  + + + +SY+IISFL+++NMYIAVILENF+ AT++  + L++DD+++FYE WE +D  A  FI    L DF + ++ PL +PKPN + L  +++PI   D ++C+D+L   T+R LG+  E D     + +        KV    ++ TL+R+ E  +A VI +  + YT+ +K
Sbjct:  648 SDLMDYLEGPEARQRAQSLVSVITSTVEELEESRKKCPPCWYKFAENFLIWDCCPAWQKIKKFVKLIVMDPFADLTITICIVLNTLFMAMEHHPMQDEFTKMLSIGNKVFTGIFTAEMVLKIIALDPYYYFQERWNIFDGIIVTISLVELCF---SINLLRSLRLLRVFKLAKSWPTLNSLLKIIGNSVGAMGNLTLVLAIIVFIFAVVGMQLFEREYR--YNVSKISADR--KPRWHMMDFFHSFLIVFRVLCGEWIETMWDCMEVAGVTKCLIVYMMVMVVGNLVFTSCFHSFSADNLAAI-----EEDS-DLNNLQIAIKRICRGFDFIKSFLKNICNSNCHKEKKEKTKDKSLGEFKKPFGTNDLHNHT-LKNFHTNSNVNLTGVDKSGDKYIVNSKSNDSIM--SFINNPSLTVTVPIAAVESDFEVLNTEDFSSDEDEELSSSEGSTINDYEAGEIADSVGGELEESNDPSPCFPAVCLQNI-KCCQVNVDVGFWKAWWKLRQTCFRIVEHSWFESFIIFMILLSSGALAFEDVYSEQRKTIKIILEFADKMFTYIFILEMLLKWLAYGFAKYFTNAWCWLDFLIVDVSLVSLVANALELT--DLGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYKCINKTDGVECDPENIPNKTFC----TNETDLIWKNLKINYDNVGMGYLALLQVATFKGWMDIMYAAVDSGEPDEQPVFERNIKMYLYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKI--STDLFMTEDQKKYYNAMKKLGSKKPQKPIPRPSNKIQGFIFDIISKQAFDIVIMVLIWLNMVTMMVETADQSEKQTYILRVINYVFIVIFSGECLLKMIGLRHYFFMNGWNIFDLVVVILSIAGVFLAKIIEDYFVSPTLFRVIRLARIGRVLRLIKSAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSSFAYVKKDKGIDDLFNFETFGNSMICLFQITTSGGWDTLLDPILNSNIDDCDRNKEHPGSNTKGDCGNPPVGIAFFVSYIIISFLIVVNMYIAVILENFNVATEESTDPLSEDDFEMFYEVWERFDPGATQFIHYYSLSDFADALNPPLQVPKPNRIDLIFMDLPIVSGDRIHCLDILFAFTKRVLGEGGEMDILREQMEERFMASNPSKVSYEPITTTLRRKEELRSATVIQRAFRRYTKNIK 1859          

HSP 2 Score: 298.13 bits (762), Expect = 6.892e-81
Identity = 180/379 (47.49%), Postives = 238/379 (62.80%), Query Frame = 3
Query:  351 EPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPFYYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFLVLTTIIINCVFM-------AKNSNS---DTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDD 1457
            +PN  L  GK LP   GD      L   PL ELDP YY ++TF+V+   K IFRF+   A Y L P NPIR+ +I++L H       L  + I+C  +        +N NS     VEY FT IYT E  +K ++RG  + EFT+LRD WNWLDF VI LAYL  F    G LSALR+ RVLRA K ++ +PG+KT+VGAL ++VK+L D M+LTVF LS+F L+GLQL+ G L  KCV+   H      P E  NLTD  K+ +++         LDPL  C N TY      CPEGY C+   +  P++GYT+FD+F  + L  FRLMTQD+WENLYQ T+R +G  ++++F++VIF GSFYLIN+ILA+VAM+Y++
Sbjct:   50 KPNRDLMAGKPLPILYGDI--PNGLVSTPLEELDPAYYNQKTFIVLNKRKMIFRFNAAPALYFLGPFNPIRRLSIKILVHS----YPLHKVDIDCELIWFKMGHTLRNCNSTWTKPVEYTFTAIYTFESLVKILARGFCLGEFTFLRDPWNWLDFSVIVLAYLNEF-ADFGRLSALRTFRVLRAFKAISVIPGLKTIVGALFQSVKKLTDVMILTVFCLSVFALVGLQLFMGHLKNKCVRQPEHV----TPEE--NLTD-RKYFLQW--------LLDPLL-CGNSTYA---GKCPEGYTCVSFGS-TPDFGYTSFDSFGWAFLALFRLMTQDFWENLYQQTLRASGKPYMIFFVLVIFLGSFYLINLILAVVAMAYEE 401          

HSP 3 Score: 84.3445 bits (207), Expect = 1.353e-15
Identity = 68/269 (25.28%), Postives = 121/269 (44.98%), Query Frame = 3
Query: 3684 LDKVFTIIFTAEMLLK----WFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFY-KCVNNDTFERISAEIIPNKNAC--------LIMKAMYGNVSWEN-----------------SQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKK 4400
            ++  FT I+T E L+K     F  G   + +D W WLDF ++       VL+Y+   A   G   A+RT R LR  +A+S   G++ +V AL Q++  + +V+++ +    +F+++G+QLF G    KCV      R    + P +N          L+   + GN ++                      +FD+    +L LF++ T   W  +    + ++G   +P       Y  +FV  I  G+F+ +NL + V+   +  Q +
Sbjct:  160 VEYTFTAIYTFESLVKILARGFCLGEFTFLRDPWNWLDFSVI-------VLAYLNEFA-DFGRLSALRTFRVLRAFKAISVIPGLKTIVGALFQSVKKLTDVMILTVFCLSVFALVGLQLFMGHLKNKCV------RQPEHVTPEENLTDRKYFLQWLLDPLLCGNSTYAGKCPEGYTCVSFGSTPDFGYTSFDSFGWAFLALFRLMTQDFWENLYQQTLRASG---KP-------YMIFFVLVIFLGSFYLINLILAVVAMAYEEQSQ 404          

HSP 4 Score: 62.3882 bits (150), Expect = 5.636e-9
Identity = 64/238 (26.89%), Postives = 112/238 (47.06%), Query Frame = 3
Query: 2340 FKFQSLVALIILDPFVELF-ITLCIVMNTVLM---SIDTPDNSPEMNHFLKCAN--------YFFTTTFGLEAFLKLIA----LGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIF---IFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFM-IVFRVLCGEWIESMWDCMLVNGYQCVPF 2993
            F+F +  AL  L PF  +  +++ I++++  +    ID      +M H L+  N        Y FT  +  E+ +K++A    LG   + ++ WN  DF +++L+ +    D   +S LR FR+LR F   K+   +  L  I+G    ++  L  V+ + +F   +FA+VG+QLF     + KN+ +    +   P  N  D  +    ++  +LCG    S +      GY CV F
Sbjct:  100 FRFNAAPALYFLGPFNPIRRLSIKILVHSYPLHKVDIDCELIWFKMGHTLRNCNSTWTKPVEYTFTAIYTFESLVKILARGFCLGEFTFLRDPWNWLDFSVIVLAYLNEFADFGRLSALRTFRVLRAF---KAISVIPGLKTIVGALFQSVKKLTDVMILTVFCLSVFALVGLQLF---MGHLKNKCVRQP-EHVTPEENLTDRKYFLQWLLDPLLCG---NSTYAGKCPEGYTCVSF 327          

HSP 5 Score: 55.0694 bits (131), Expect = 1.056e-6
Identity = 76/325 (23.38%), Postives = 146/325 (44.92%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA----KNSNSDTVEYV-------FTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFF-----FPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVC-IQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAE 1481
            +R+T  R++ H  F   ++  I+++   +A     +    T++ +       FT I+ LE  +K ++ G       Y  +AW WLDF+++ ++ +           LG + +LR+LR LR L+ ++   GM+ VV ALL A+  + + +++ +    IF ++G+ L+ G    KC+   +   +  +P    N T          F  NET+ +      +N   N  N     GY+  +Q  T         F  ++  +  A      D  E   Q     N  ++ LYF++ I FGSF+ +N+ + ++  +++  +  I  +
Sbjct: 1137 LRQTCFRIVEHSWFESFIIFMILLSSGALAFEDVYSEQRKTIKIILEFADKMFTYIFILEMLLKWLAYGFA----KYFTNAWCWLDFLIVDVSLVSLVANALELTDLGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFY-KCINKTDG--VECDPENIPNKT----------FCTNETDLI-----WKNLKINYDNVGM--GYLALLQVAT---------FKGWMDIMYAAV-----DSGEPDEQPVFERNIKMY-LYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKISTD 1422          
BLAST of scna-1 vs. Planmine SMEST
Match: SMESG000017743.1 (SMESG000017743.1)

HSP 1 Score: 3242.6 bits (8406), Expect = 0.000e+0
Identity = 1691/1694 (99.82%), Postives = 1692/1694 (99.88%), Query Frame = 3
Query:  642 MAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDXXXXXXXXXXXXXIIDRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSICDYDSTDRNLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPRSIAVGKRIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRKL 5723
            MAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNLSALRSLRVLRALKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEE GDEAERKEQEEMREKIIDRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSICDYDSTDRNLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPRSIAVGKRIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEIN YIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMILGNLVLLNLFLALLLSSFGSESLQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFIILMIIISSLTLTLEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTFIRVVRVFRIGRILRLVKSAKGIRTLLFSLIVSLPALLNIALLLIMIMFIYAIVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNK+KGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRKL
Sbjct:    1 MAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNLSALRSLRVLRALKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEEAGDEAERKEQEEMREKIIDRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSLIKSGLNDEFNSKSYQVSNVDIESEPRFSICDYDSTDRNLDSTRLVCPLESYFKGKIKFNYADKSESEATTPILPRSPRSIAVGKRIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINHYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMILGNLVLLNLFLALLLSSFGSESLQKREDDSNETNKLQEAIDRIYRAIVWVKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFIILMIIISSLTLTLEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTFIRVVRVFRIGRILRLVKSAKGIRTLLFSLIVSLPALLNIALLLIMIMFIYAIVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKDKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQNRKL 1694          
BLAST of scna-1 vs. Planmine SMEST
Match: SMESG000077545.1 (SMESG000077545.1)

HSP 1 Score: 1576.99 bits (4082), Expect = 0.000e+0
Identity = 961/1727 (55.65%), Postives = 1205/1727 (69.77%), Query Frame = 3
Query:  642 MAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNE-WNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDXXXXXXXXXXXXXIIDRIDEELGVESSEDLNY----QNPVR-PNSKDGWSIQSYVRKQSLIKSGLNDEF-NSKSYQ-VSNVDIESEPRFSICDYDSTDRNL--DSTRLVCP---LESYFKGKIKFNYADKSESEATTPILPRSPRSIAVGKRIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVE------IPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQI-----RFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHN----------IKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKV--EKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQN 5714
            M KNS S+ VE +FT IYT EF IKA++RGLI+ +FTYLRDAWNWLDFIVIGLAY+M+    LG LSALRSLRVLRALKTVTT+PGMKTVV +LL A+ +LRDA+VLTVF+LSIF LIGLQ+YRGTLL KCVK F+++ +  E  E +++     W +K +++NN  NW +P+  C N+T N    ++C E Y CI+T   NPN+GYT+FDNF VSLLCAFRLMTQDYWENLYQL IRTNGD+H++YFMMVIFFGSFYLINVIL+IVAMSYDDVR+A  AE+  +EAE+K +EE RE+I++ +D EL   +S+DL +     +P+  P++     I   +R Q+L KS ++     +KS Q +S ++++ +   +   +  ++ N+  DS    CP     + FK   +FN   K   +       +     ++  +    L+S SP+    +SK+  D  +L+                       QLS N   +V   ++F   +E ES  S+I +   +D + + + IN+    PE++  +SALS+++ E K+RK+++  Q   KTFC+W CCP Y   + +V+ I+LDPF+ELFIT+CIV+NTV MSIDT DNS  M + +   N FF   F  EA +KLIA GP  YF E WNVFDF+IV+LS+VE      I      +SLLR FRLLR+FKLAKSWQTMNLLF IIG T+GAIGNLCIVL II+FIFAVVGMQ+FG +Y  FKN+T FP   G  PRWNF DFTHSFMIVFRVLCGE++ESMWDCM VNG  C+PFFL TMILGNLV+LNLFLALLLSSF SESLQ+RED+S + NKLQEA+ R+YRAIVWVKV++         KL K I       +R + IK    W+++           IK  K+  E   S +V  P+       LW      E   PKFD DP+INE E+I+   P DCLP+ I   L +  +   E+   + WW  RC A K+V+H+FFETFI++MI+ SSLTLTLEDK LP+R  LK  LE +D  FT+IF  EM+LKWFA GL KYFKDAWCWLDF IV +AL+S    +        GAFKA+RTLRALRPLRAVSRW+GM+IVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF+KCV+++   R+   ++ NK+ C  ++    NVSW NSQ+NFDNVLNGYL LFQ+ATFKGW +IMADAVD T +  QP YN++T YY YFV FIIFGAFFTLNLFIGVIIDNFNVQKK++GGSLE+FMT+ QK+YY+AMKKMSS +PQKP+PRPK  IA I ++I  NQKFDI IM  IMLNTIVMC+E   Q ++L  ALD +NKVF++IF  E ++K+IA RWYYFK+PWN+FDF+IVI SI FW IE  +    VSPT IRV+RVFRIGR+LRLVKSA+GIRTLLFSL+VSLPAL NI LLL++IMFIYAI+G+S FS VAYS+ ID  FNFETFGKAMIILFQISTSGGWN +L+GLMN      N    +C                           +ILENFSQATKDVQ GLTQDDYDLFYECWEEYD  A GF+ LK L +FV KI +PLGIP+PN ++LAMLEIPIC+  T+ CVDL++ LT+ FLG   E ++G N +  LKP  K  K+  +K ++SNT   QRE +AA+ I  +++    R K+N
Sbjct:    1 MTKNSESENVETIFTAIYTAEFIIKALARGLIVYQFTYLRDAWNWLDFIVIGLAYMMYVNSALGKLSALRSLRVLRALKTVTTIPGMKTVVSSLLMAIIKLRDALVLTVFMLSIFALIGLQMYRGTLLHKCVKVFDNSSIGAETYENDSIL---LWNIKMDYYNNPENWQNPITFCHNFTSNNVIKSTCNEEYECIRTDNENPNFGYTSFDNFGVSLLCAFRLMTQDYWENLYQLIIRTNGDVHMIYFMMVIFFGSFYLINVILSIVAMSYDDVRMADMAEDEEEEAEKKVEEEKREQILELLDHELDA-TSDDLAFCAIGDHPLYYPDNIIKSCID--IRIQNLPKSHVSLYLPRTKSLQEISKLNVDQKSDIAESKHKESNDNMLIDS----CPSLHRTNRFKVYQQFNVFRKLIEDNR-----KESSKYSLDDKRFSDLAS-SPV---NTSKAQHDSLILN----------------------HQLSSNKINKVDSKVNF---IERESRISNIVL---EDLEGLYNNINE----PEMKKRISALSVFECENKLRKRDIYLQRFNKTFCNWECCPAYDYLKKIVSFIVLDPFMELFITICIVLNTVFMSIDTYDNSVSMIYIMNKVNLFFMVIFTFEAGMKLIAYGPRLYFSEKWNVFDFLIVVLSIVELTASKDISASKGNLSLLRTFRLLRIFKLAKSWQTMNLLFTIIGRTLGAIGNLCIVLAIIVFIFAVVGMQIFGRQYERFKNQTEFPKDNGKIPRWNFCDFTHSFMIVFRVLCGEYMESMWDCMRVNGIYCIPFFLATMILGNLVILNLFLALLLSSFSSESLQRREDESADVNKLQEALTRVYRAIVWVKVKLYSTYNHIGKKLMKII-------RRHRQIKYPFPWDSNESNPINIQAAIIKMNKN--ETEPSRNVHDPQLNQVAFNLWL-----ENYEPKFDADPDINEAEVIFWNQPYDCLPDSIRCFLVRHCNCCSESCITKAWWWIRCSAFKIVDHKFFETFILIMIVASSLTLTLEDKFLPTRKRLKDILEFMDLGFTVIFLVEMVLKWFAIGLTKYFKDAWCWLDFTIVLVALISYFKVF------DAGAFKAIRTLRALRPLRAVSRWDGMKIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFFKCVDSNNV-RLHESLVQNKSDCYELQKT-ENVSWVNSQINFDNVLNGYLSLFQIATFKGWTDIMADAVDVTEVNFQPKYNNNTFYYIYFVLFIIFGAFFTLNLFIGVIIDNFNVQKKKIGGSLELFMTDSQKRYYHAMKKMSSISPQKPVPRPKSTIAQIFYNIINNQKFDIVIMCFIMLNTIVMCLESHKQGKELSDALDHMNKVFVLIFALECVIKIIALRWYYFKIPWNVFDFIIVIFSIGFWVIEKFVIFNAVSPTLIRVIRVFRIGRVLRLVKSARGIRTLLFSLVVSLPALFNIGLLLMLIMFIYAIIGVSMFSEVAYSYGIDATFNFETFGKAMIILFQISTSGGWNSILDGLMNN-----NTSSVSC---------------------------IILENFSQATKDVQLGLTQDDYDLFYECWEEYDPGATGFMELKDLSEFVAKIGEPLGIPQPNKIRLAMLEIPICKGHTICCVDLMDKLTKNFLG---EFNSG-NPMMDLKPKSK-NKITSKKFVISNTFLYQRELWAARKITGFLREMVARKKEN 1617          

HSP 2 Score: 75.485 bits (184), Expect = 4.297e-13
Identity = 82/317 (25.87%), Postives = 145/317 (45.74%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEYV---FTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVL--GNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRT----------NGDIHILYFMMVIFFGSFYLINVILAIV 1439
            IR +A +++ H  F   +L  I+ + + +         +    D +E++   FT I+ +E  +K  + GL      Y +DAW WLDF ++ +A L+ +F V   G   A+R+LR LR L+ V+   GMK VV AL++A+  + + +++ +    IF +IG+QL+ G    KCV S N  L     +  +N +D       YE           L++ +N +   W  S                    NFDN +   L  F++ T   W ++    +            N   + +YF++ I FG+F+ +N+ + ++
Sbjct:  936 IRCSAFKIVDHKFFETFILIMIVASSLTLTLEDKFLPTRKRLKDILEFMDLGFTVIFLVEMVLKWFAIGLT----KYFKDAWCWLDFTIVLVA-LISYFKVFDAGAFKAIRTLRALRPLRAVSRWDGMKIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFF-KCVDSNNVRL---HESLVQNKSDC------YE-----------LQKTENVS---WVNS------------------QINFDNVLNGYLSLFQIATFKGWTDIMADAVDVTEVNFQPKYNNNTFYYIYFVLFIIFGAFFTLNLFIGVI 1205          
BLAST of scna-1 vs. Planmine SMEST
Match: SMESG000077545.1 (SMESG000077545.1)

HSP 1 Score: 1566.21 bits (4054), Expect = 0.000e+0
Identity = 958/1727 (55.47%), Postives = 1203/1727 (69.66%), Query Frame = 3
Query:  642 MAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVLGNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNE-WNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTNGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDXXXXXXXXXXXXXIIDRIDEELGVESSEDLNY----QNPVR-PNSKDGWSIQSYVRKQSLIKSGLNDEF-NSKSYQ-VSNVDIESEPRFSICDYDSTDRNL--DSTRLVCP---LESYFKGKIKFNYADKSESEATTPILPRSPRSIAVGKRIVGSLSSFSPMLDERSSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVE------IPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQI-----RFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHN----------IKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKV--EKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQN 5714
            M KNS S+ VE +FT IYT EF IKA++RGLI+ +FTYLRDAWNWLDFIVIGLAY+M+    LG LSALRSLRVLRALKTVTT+PGMKTVV +LL A+ +LRDA+VLTVF+LSIF LIGLQ+YRGTLL KCVK F+++ +  E  E +++     W +K +++NN  NW +P+  C N+T N    ++C E Y CI+T   NPN+GYT+FDNF VSLLCAFRLMTQDYWENLYQL IRTNGD+H++YFMMVIFFGSFYLINVIL+IVAMSYDDVR+A  AE+  +EAE+K +EE RE+I++ +D EL   +S+DL +     +P+  P++     I   +R Q+L KS ++     +KS Q +S ++++ +   +   +  ++ N+  DS    CP     + FK   +FN   K   +       +     ++  +    L+S SP+    +SK+  D  +L+                       QLS N   +V   ++F   +E ES  S+I +   +D + + + IN+    PE++  +SALS+++ E K+RK+++  Q   KTFC+W CCP Y   + +V+ I+LDPF+ELFIT+CIV+NTV MSIDT DNS  M + +   N FF   F  EA +KLIA GP  YF E WNVFDF+IV+LS+VE      I      +SLLR FRLLR+FKLAKSWQTMNLLF IIG T+GAIGNLCIVL II+FIFAVVGMQ+FG +Y  FKN+T FP   G  PRWNF DFTHSFMIVFRVLCGE++ESMWDCM VNG  C+PFFL TMILGNLV+LNLFLALLLSSF SESLQ+RED+S + NKLQEA+ R+YRAIVWVKV++         KL K I       +R + IK    W+++           IK  K+  E   S +V  P+       LW      E   PKFD DP+INE E+I+   P DCLP+ I   L +  +   E+   + WW  RC A K+V+H+FFETFI++MI+ SSLTLTLEDK LP+R  LK  LE +D  FT+IF  EM+LKWFA GL KYFKDAWCWLDF IV +AL+S    +        GAFKA+RTLRALRPLRAVSRW+GM+IVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF+KCV+++   R+   ++ NK+ C  ++    NVSW NSQ+NFDNVLNGYL LFQ+ATFKGW +IMADAVD T +  QP YN++T YY YFV FIIFGAFFTLNLFIGVIIDNFNVQKK++GGSLE+FMT+ QK+YY+AMKKMSS +PQKP+PRPK  IA I ++I  NQKFDI IM  IMLNTIVMC+E   Q ++L  ALD +NKVF++IF  E ++K+IA RWYYFK+PWN+FDF+IVI SI FW IE  +    VSPT IRV+RVFRIGR+LRLVKSA+GIRTLLFSL+VSLPAL NI LLL++IMFIYAI+G+S FS VAYS+ ID  FNFETFGKAMIILFQISTSGGWN +L+  M    K+      +C                           +ILENFSQATKDVQ GLTQDDYDLFYECWEEYD  A GF+ LK L +FV KI +PLGIP+PN ++LAMLEIPIC+  T+ CVDL++ LT+ FLG   E ++G N +  LKP  K  K+  +K ++SNT   QRE +AA+ I  +++    R K+N
Sbjct:    1 MTKNSESENVETIFTAIYTAEFIIKALARGLIVYQFTYLRDAWNWLDFIVIGLAYMMYVNSALGKLSALRSLRVLRALKTVTTIPGMKTVVSSLLMAIIKLRDALVLTVFMLSIFALIGLQMYRGTLLHKCVKVFDNSSIGAETYENDSIL---LWNIKMDYYNNPENWQNPITFCHNFTSNNVIKSTCNEEYECIRTDNENPNFGYTSFDNFGVSLLCAFRLMTQDYWENLYQLIIRTNGDVHMIYFMMVIFFGSFYLINVILSIVAMSYDDVRMADMAEDEEEEAEKKVEEEKREQILELLDHELDA-TSDDLAFCAIGDHPLYYPDNIIKSCID--IRIQNLPKSHVSLYLPRTKSLQEISKLNVDQKSDIAESKHKESNDNMLIDS----CPSLHRTNRFKVYQQFNVFRKLIEDNR-----KESSKYSLDDKRFSDLAS-SPV---NTSKAQHDSLILN----------------------HQLSSNKINKVDSKVNF---IERESRISNIVL---EDLEGLYNNINE----PEMKKRISALSVFECENKLRKRDIYLQRFNKTFCNWECCPAYDYLKKIVSFIVLDPFMELFITICIVLNTVFMSIDTYDNSVSMIYIMNKVNLFFMVIFTFEAGMKLIAYGPRLYFSEKWNVFDFLIVVLSIVELTASKDISASKGNLSLLRTFRLLRIFKLAKSWQTMNLLFTIIGRTLGAIGNLCIVLAIIVFIFAVVGMQIFGRQYERFKNQTEFPKDNGKIPRWNFCDFTHSFMIVFRVLCGEYMESMWDCMRVNGIYCIPFFLATMILGNLVILNLFLALLLSSFSSESLQRREDESADVNKLQEALTRVYRAIVWVKVKLYSTYNHIGKKLMKII-------RRHRQIKYPFPWDSNESNPINIQAAIIKMNKN--ETEPSRNVHDPQLNQVAFNLWL-----ENYEPKFDADPDINEAEVIFWNQPYDCLPDSIRCFLVRHCNCCSESCITKAWWWIRCSAFKIVDHKFFETFILIMIVASSLTLTLEDKFLPTRKRLKDILEFMDLGFTVIFLVEMVLKWFAIGLTKYFKDAWCWLDFTIVLVALISYFKVF------DAGAFKAIRTLRALRPLRAVSRWDGMKIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFFKCVDSNNV-RLHESLVQNKSDCYELQKT-ENVSWVNSQINFDNVLNGYLSLFQIATFKGWTDIMADAVDVTEVNFQPKYNNNTFYYIYFVLFIIFGAFFTLNLFIGVIIDNFNVQKKKIGGSLELFMTDSQKRYYHAMKKMSSISPQKPVPRPKSTIAQIFYNIINNQKFDIVIMCFIMLNTIVMCLESHKQGKELSDALDHMNKVFVLIFALECVIKIIALRWYYFKIPWNVFDFIIVIFSIGFWVIEKFVIFNAVSPTLIRVIRVFRIGRVLRLVKSARGIRTLLFSLVVSLPALFNIGLLLMLIMFIYAIIGVSMFSEVAYSYGIDATFNFETFGKAMIILFQISTSGGWNSILDEKM---WKLYFSSSVSC---------------------------IILENFSQATKDVQLGLTQDDYDLFYECWEEYDPGATGFMELKDLSEFVAKIGEPLGIPQPNKIRLAMLEIPICKGHTICCVDLMDKLTKNFLG---EFNSG-NPMMDLKPKSK-NKITSKKFVISNTFLYQRELWAARKITGFLREMVARKKEN 1619          

HSP 2 Score: 75.485 bits (184), Expect = 4.018e-13
Identity = 82/317 (25.87%), Postives = 145/317 (45.74%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEYV---FTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVL--GNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRT----------NGDIHILYFMMVIFFGSFYLINVILAIV 1439
            IR +A +++ H  F   +L  I+ + + +         +    D +E++   FT I+ +E  +K  + GL      Y +DAW WLDF ++ +A L+ +F V   G   A+R+LR LR L+ V+   GMK VV AL++A+  + + +++ +    IF +IG+QL+ G    KCV S N  L     +  +N +D       YE           L++ +N +   W  S                    NFDN +   L  F++ T   W ++    +            N   + +YF++ I FG+F+ +N+ + ++
Sbjct:  936 IRCSAFKIVDHKFFETFILIMIVASSLTLTLEDKFLPTRKRLKDILEFMDLGFTVIFLVEMVLKWFAIGLT----KYFKDAWCWLDFTIVLVA-LISYFKVFDAGAFKAIRTLRALRPLRAVSRWDGMKIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFF-KCVDSNNVRL---HESLVQNKSDC------YE-----------LQKTENVS---WVNS------------------QINFDNVLNGYLSLFQIATFKGWTDIMADAVDVTEVNFQPKYNNNTFYYIYFVLFIIFGAFFTLNLFIGVI 1205          
BLAST of scna-1 vs. Planmine SMEST
Match: SMESG000077545.1 (SMESG000077545.1)

HSP 1 Score: 1238.79 bits (3204), Expect = 0.000e+0
Identity = 727/1243 (58.49%), Postives = 889/1243 (71.52%), Query Frame = 3
Query: 2055 IKRQLSQNLRRRVSKNLSFRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDAETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVE------IPLDSSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTMIXXXXXXXXXXXXXXXXXXXXXXXQKREDDSNETNKLQEAIDRIYRAIVWVKVQI-----RFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHN----------IKCEKSYYELSVSNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDCLPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFXXXXXXXXXXXXXXEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKIGKV--EKIIVSNTLKRQRENFAAKVIVKYMKAYTERLKQN 5714
            +  QLS N   +V   ++F   +E ES  S+I +   +D + + + IN+    PE++  +SALS+++ E K+RK+++  Q   KTFC+W CCP Y   + +V+ I+LDPF+ELFIT+CIV+NTV MSIDT DNS  M + +   N FF   F  EA +KLIA GP  YF E WNVFDF+IV+LS+VE      I      +SLLR FRLLR+FKLAKSWQTMNLLF IIG T+GAIGNLCIVL II+FIFAVVGMQ+FG +Y  FKN+T FP   G  PRWNF DFTHSFMIVFRVLCGE++ESMWDCM VNG  C+PFFL TMILGNLV+LNLFLALLLSSF SESLQ+RED+S + NKLQEA+ R+YRAIVWVKV++         KL K I       +R + IK    W+++           IK  K+  E   S +V  P+       LW      E   PKFD DP+INE E+I+   P DCLP+ I   L +  +   E+   + WW  RC A K+V+H+FFETFI++MI+ SSLTLTLEDK LP+R  LK  LE +D  FT+IF  EM+LKWFA GL KYFKDAWCWLDF IV +AL+S    +        GAFKA+RTLRALRPLRAVSRW+GM+IVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKF+KCV+++   R+   ++ NK+ C  ++    NVSW NSQ+NFDNVLNGYL LFQ+ATFKGW +IMADAVD T +  QP YN++T YY YFV FIIFGAFFTLNLFIGVIIDNFNVQKK++GGSLE+FMT+ QK+YY+AMKKMSS +PQKP+PRPK  IA I ++I  NQKFDI IM  IMLNTIVMC+E   Q ++L  ALD +NKVF++IF  E ++K+IA RWYYFK+PWN+FDF+IVI SI FW IE  +    VSPT IRV+RVFRIGR+LRLVKSA+GIRTLLFSL+VSLPAL NI LLL++IMFIYAI+G+S FS VAYS+ ID  FNFETFGKAMIILFQISTSGGWN +L+GLMN      N    +C                           +ILENFSQATKDVQ GLTQDDYDLFYECWEEYD  A GF+ LK L +FV KI +PLGIP+PN ++LAMLEIPIC+  T+ CVDL++ LT+ FLG   E ++G N +  LKP  K  K+  +K ++SNT   QRE +AA+ I  +++    R K+N
Sbjct:   37 LNHQLSSNKINKVDSKVNF---IERESRISNIVL---EDLEGLYNNINE----PEMKKRISALSVFECENKLRKRDIYLQRFNKTFCNWECCPAYDYLKKIVSFIVLDPFMELFITICIVLNTVFMSIDTYDNSVSMIYIMNKVNLFFMVIFTFEAGMKLIAYGPRLYFSEKWNVFDFLIVVLSIVELTASKDISASKGNLSLLRTFRLLRIFKLAKSWQTMNLLFTIIGRTLGAIGNLCIVLAIIVFIFAVVGMQIFGRQYERFKNQTEFPKDNGKIPRWNFCDFTHSFMIVFRVLCGEYMESMWDCMRVNGIYCIPFFLATMILGNLVILNLFLALLLSSFSSESLQRREDESADVNKLQEALTRVYRAIVWVKVKLYSTYNHIGKKLMKII-------RRHRQIKYPFPWDSNESNPINIQAAIIKMNKN--ETEPSRNVHDPQLNQVAFNLWL-----ENYEPKFDADPDINEAEVIFWNQPYDCLPDSIRCFLVRHCNCCSESCITKAWWWIRCSAFKIVDHKFFETFILIMIVASSLTLTLEDKFLPTRKRLKDILEFMDLGFTVIFLVEMVLKWFAIGLTKYFKDAWCWLDFTIVLVALISYFKVF------DAGAFKAIRTLRALRPLRAVSRWDGMKIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFFKCVDSNNV-RLHESLVQNKSDCYELQKT-ENVSWVNSQINFDNVLNGYLSLFQIATFKGWTDIMADAVDVTEVNFQPKYNNNTFYYIYFVLFIIFGAFFTLNLFIGVIIDNFNVQKKKIGGSLELFMTDSQKRYYHAMKKMSSISPQKPVPRPKSTIAQIFYNIINNQKFDIVIMCFIMLNTIVMCLESHKQGKELSDALDHMNKVFVLIFALECVIKIIALRWYYFKIPWNVFDFIIVIFSIGFWVIEKFVIFNAVSPTLIRVIRVFRIGRVLRLVKSARGIRTLLFSLVVSLPALFNIGLLLMLIMFIYAIIGVSMFSEVAYSYGIDATFNFETFGKAMIILFQISTSGGWNSILDGLMNN-----NTSSVSC---------------------------IILENFSQATKDVQLGLTQDDYDLFYECWEEYDPGATGFMELKDLSEFVAKIGEPLGIPQPNKIRLAMLEIPICKGHTICCVDLMDKLTKNFLG---EFNSG-NPMMDLKPKSK-NKITSKKFVISNTFLYQRELWAARKITGFLREMVARKKEN 1210          

HSP 2 Score: 76.2554 bits (186), Expect = 2.436e-13
Identity = 84/334 (25.15%), Postives = 152/334 (45.51%), Query Frame = 3
Query:  558 IRKTAIRLLTHPVFSFLVLTTIIINCVFMA--------KNSNSDTVEYV---FTTIYTLEFTIKAISRGLIINEFTYLRDAWNWLDFIVIGLAYLMFFFPVL--GNXXXXXXXXXXXXXKTVTTVPGMKTVVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTLLYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCPEGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRT----------NGDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETG 1490
            IR +A +++ H  F   +L  I+ + + +         +    D +E++   FT I+ +E  +K  + GL      Y +DAW WLDF ++ L  L+ +F V   G   A+R+LR LR L+ V+   GMK VV AL++A+  + + +++ +    IF +IG+QL+ G    KCV S N  L     +  +N +D       YE           L++ +N +   W  S                    NFDN +   L  F++ T   W ++    +            N   + +YF++ I FG+F+ +N+ + ++  +++     +Q ++ G
Sbjct:  529 IRCSAFKIVDHKFFETFILIMIVASSLTLTLEDKFLPTRKRLKDILEFMDLGFTVIFLVEMVLKWFAIGLT----KYFKDAWCWLDFTIV-LVALISYFKVFDAGAFKAIRTLRALRPLRAVSRWDGMKIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFF-KCVDSNNVRL---HESLVQNKSDC------YE-----------LQKTENVS---WVNS------------------QINFDNVLNGYLSLFQIATFKGWTDIMADAVDVTEVNFQPKYNNNTFYYIYFVLFIIFGAFFTLNLFIGVIIDNFN-----VQKKKIG 810          
BLAST of scna-1 vs. Planmine SMEST
Match: SMESG000075431.1 (SMESG000075431.1)

HSP 1 Score: 488.034 bits (1255), Expect = 5.051e-152
Identity = 283/643 (44.01%), Postives = 425/643 (66.10%), Query Frame = 3
Query: 3873 RTLRALRPLRAVSRWEGMRIV-VNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCVNNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQVATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNLFIGVIIDNFN-VQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRPKLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQINKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAI-------------ESMLNNIPVSPTXXXXXXXXXXXXXXXXXKSAKGIRTLLFSLIVSLPXXXXXXXXXXXXXXXXXXVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGWNGVLNGLMNEDPKVCNK------------EKGTCGSYIIAVVYLISYLIISFLVIINMYIAVILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEKIDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADTGENNLNKLKPDLKI-------GKVEKIIVSNTLKRQRENFAAKVIV---KYMKA 5690
            R++R L  L    + EG ++  +NALI AIPSIFNVLLVC+VFWLIFSI G+Q F GKF+KC++++T ER++A ++PNK+ CL       N +W NS +NFDN  NG+L L+Q+ATF+GW+EIM DA+DSTG+  QP   +   YYAYFV FI+ G+FF LNLFIGVIIDNFN ++ K  G  +++F+T  Q+ YYN MKK+S+  P+K + RPK  +    + + ++ +F++ I+ +I LN +VM IEH+ Q       LD IN +F  IFT E ++K+   RW+YF+  WN+FDF+IV+LSI+   I             E  L    ++PT +RVVR+FRIGR+LRL+K AKGIR LLF+L++SLPAL NI  LL++I+FIY+IVGMS F N+  +  +D++ NFETF +++++LF+++T+GGWN +L  +  + P  CN               G CG+    ++Y+ +++ I +L+IINMYIA+ILENF+QA    + G+T+DD+++FY  WE YD  A  +I    L DFV ++D+PLGIPKPN + L   ++PI + D ++C+D+L  L +  +G   +++       K+K  +++        +V   +++ T+KR++E+ AAK +    K++KA
Sbjct:   61 RSIRTLDKLTEQLKNEGFQLSRINALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECL-----RQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWNIFDFIIVLLSIIDLVINMFRSFSDSVLFMEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTFIFICYLIIINMYIAIILENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSE----EFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKA 693          

HSP 2 Score: 83.9593 bits (206), Expect = 7.952e-16
Identity = 60/221 (27.15%), Postives = 106/221 (47.96%), Query Frame = 3
Query: 2388 ELFITLCIVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQYFQEHWNVFDFIIVILSLVEIPLD----------------------SSGMSLLRAFRLLRVFKLAKSWQTMNLLFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSFKGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQC 2984
            EL I + I +N V+M I+    +    + L   N  F+T F LEA +K+  L    YF+  WN+FDFIIV+LS++++ ++                       + + ++R FR+ RV +L K  + +  L   +  ++ A+ N+  +L +I+FI+++VGM +FG    N K         G +   NF  F  S +++FR+        + + M +    C
Sbjct:  287 ELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWNIFDFIIVLLSIIDLVINMFRSFSDSVLFMEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFG----NLKKTG------GLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYC 496          

HSP 3 Score: 66.2402 bits (160), Expect = 2.048e-10
Identity = 46/155 (29.68%), Postives = 83/155 (53.55%), Query Frame = 3
Query: 3675 LEILDKVFTIIFTAEMLLKWFAFGLN-KYFKDAWCWLDFIIVTIALVSLVLSYIGTGAGGM--------------GAFKAMRTLRALRPLRAVSRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFG-----GKFYKCVNNDTFER 4079
            L++++ +F+ IFT E ++K    GL   YF+  W   DFIIV ++++ LV++   + +  +                 + +R  R  R LR +   +G+R ++ AL+ ++P++FN+  + L+   I+SI+GM +FG     G     VN +TFER
Sbjct:  316 LDMINIMFSTIFTLEAIVK--ISGLRWHYFRYMWNIFDFIIVLLSIIDLVINMFRSFSDSVLFMEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFER 468          
The following BLAST results are available for this feature:
BLAST of scna-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCN9A6.462e-9147.75sodium voltage-gated channel alpha subunit 9 [Sour... [more]
SCN9A3.420e-9147.75sodium voltage-gated channel alpha subunit 9 [Sour... [more]
SCN9A3.420e-9147.75sodium voltage-gated channel alpha subunit 9 [Sour... [more]
SCN9A3.542e-9147.75sodium voltage-gated channel alpha subunit 9 [Sour... [more]
SCN9A7.293e-9147.75sodium voltage-gated channel alpha subunit 9 [Sour... [more]
back to top
BLAST of scna-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-191.452e-6430.71Voltage-dependent L-type calcium channel subunit a... [more]
egl-191.818e-6430.71Voltage-dependent L-type calcium channel subunit a... [more]
cca-14.462e-6033.05Voltage-dependent T-type calcium channel subunit a... [more]
cca-14.462e-6033.05Voltage-dependent T-type calcium channel subunit a... [more]
cca-14.462e-6033.05Voltage-dependent T-type calcium channel subunit a... [more]
back to top
BLAST of scna-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
para7.052e-9553.46gene:FBgn0285944 transcript:FBtr0303685[more]
para8.606e-9553.46gene:FBgn0285944 transcript:FBtr0303657[more]
para9.299e-9553.46gene:FBgn0285944 transcript:FBtr0303662[more]
para8.569e-9553.46gene:FBgn0285944 transcript:FBtr0303672[more]
para7.702e-9553.46gene:FBgn0285944 transcript:FBtr0303655[more]
back to top
BLAST of scna-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scn12aa0.000e+041.35sodium channel, voltage gated, type XII, alpha a [... [more]
scn4ab3.165e-9546.12sodium channel, voltage-gated, type IV, alpha, b [... [more]
scn4ab3.949e-9546.12sodium channel, voltage-gated, type IV, alpha, b [... [more]
scn4ab3.133e-9246.03sodium channel, voltage-gated, type IV, alpha, b [... [more]
scn8ab1.800e-8946.62sodium channel, voltage gated, type VIII, alpha su... [more]
back to top
BLAST of scna-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srl0.000e+042.64sarcalumenin [Source:Xenbase;Acc:XB-GENE-981745][more]
srl0.000e+042.44sarcalumenin [Source:Xenbase;Acc:XB-GENE-981745][more]
srl0.000e+042.72sarcalumenin [Source:Xenbase;Acc:XB-GENE-981745][more]
srl0.000e+042.51sarcalumenin [Source:Xenbase;Acc:XB-GENE-981745][more]
srl0.000e+041.74sarcalumenin [Source:Xenbase;Acc:XB-GENE-981745][more]
back to top
BLAST of scna-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scn2a1.859e-9247.76sodium channel, voltage-gated, type II, alpha [Sou... [more]
Scn2a1.412e-9247.76sodium channel, voltage-gated, type II, alpha [Sou... [more]
Scn2a1.859e-9247.76sodium channel, voltage-gated, type II, alpha [Sou... [more]
Scn8a3.755e-9545.37sodium channel, voltage-gated, type VIII, alpha [S... [more]
Scn8a5.303e-9545.92sodium channel, voltage-gated, type VIII, alpha [S... [more]
back to top
BLAST of scna-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15858|SCN9A_HUMAN1.643e-9047.75Sodium channel protein type 9 subunit alpha OS=Hom... [more]
sp|O08562|SCN9A_RAT1.812e-8946.95Sodium channel protein type 9 subunit alpha OS=Rat... [more]
sp|Q99250|SCN2A_HUMAN1.590e-9247.67Sodium channel protein type 2 subunit alpha OS=Hom... [more]
sp|B1AWN6|SCN2A_MOUSE1.300e-9147.76Sodium channel protein type 2 subunit alpha OS=Mus... [more]
sp|P04775|SCN2A_RAT6.054e-9146.83Sodium channel protein type 2 subunit alpha OS=Rat... [more]
back to top
BLAST of scna-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HM840.000e+054.15Sodium channel protein OS=Macrostomum lignano OX=2... [more]
A0A1I8HQ990.000e+052.88Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9K8360.000e+046.30Sodium channel protein OS=Biomphalaria glabrata OX... [more]
P906700.000e+046.34Sodium channel protein OS=Aplysia californica OX=6... [more]
A0A1I8G7J91.214e-12855.60Sodium channel protein OS=Macrostomum lignano OX=2... [more]
back to top
BLAST of scna-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scn1laa0.000e+041.19sodium channel, voltage-gated, type I-like, alpha ... [more]
ENSAMXT00000044886.11.017e-9346.75sodium channel protein type 4 subunit alpha B-like... [more]
scn12aa2.281e-9244.94sodium channel protein type 4 subunit alpha-like [... [more]
ENSAMXT00000006401.21.036e-9346.75sodium channel protein type 4 subunit alpha B-like... [more]
ENSAMXT00000006399.21.947e-9047.35sodium channel protein type 4 subunit alpha B-like... [more]
back to top
BLAST of scna-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007955.11.093e-14541.78pep scaffold:Pmarinus_7.0:GL476358:329878:417380:1... [more]
ENSPMAT00000008004.11.145e-14539.48pep scaffold:Pmarinus_7.0:GL477228:88466:118438:1 ... [more]
ENSPMAT00000002291.11.939e-14249.09pep scaffold:Pmarinus_7.0:GL476946:177790:226078:1... [more]
ENSPMAT00000002303.12.380e-14249.09pep scaffold:Pmarinus_7.0:GL476946:177796:226078:1... [more]
ENSPMAT00000000617.12.990e-7641.37pep scaffold:Pmarinus_7.0:GL477322:572:57208:-1 ge... [more]
back to top
BLAST of scna-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CCH14.776e-3423.75Voltage-gated high-affinity calcium channel; invol... [more]
back to top
BLAST of scna-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356611.366e-16243.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467972.558e-14542.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368441.490e-7135.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354971.843e-5732.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469912.306e-5329.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of scna-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044887.10.000e+040.02sodium channel protein type 4 subunit alpha B [Sou... [more]
scn12aa5.930e-6245.45sodium channel protein type 4 subunit alpha [Sourc... [more]
scn12aa5.313e-8546.99sodium channel protein type 4 subunit alpha [Sourc... [more]
ENSORLT00000035153.15.577e-8647.62sodium channel protein type 2 subunit alpha [Sourc... [more]
ENSORLT00000043679.16.892e-8145.59sodium channel protein type 2 subunit alpha [Sourc... [more]
back to top
BLAST of scna-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017743.10.000e+099.82SMESG000017743.1[more]
SMESG000077545.14.297e-1355.65SMESG000077545.1[more]
SMESG000077545.14.018e-1355.47SMESG000077545.1[more]
SMESG000077545.12.436e-1358.49SMESG000077545.1[more]
SMESG000075431.15.051e-15244.01SMESG000075431.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30004389
GenBankAIX99549.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004389 ID=SMED30004389|Name=scna-1|organism=Schmidtea mediterranea sexual|type=transcript|length=5748bp
CGATCTTGGGAGTTATACAAAAGACAGTTTTGCATTTCCGTTTTACAGAA
AAATTTACAAAATAAAACTTTATTTTTACGTAGAAATATCCTCTCGACGG
CCTTTTTTATTCGGTGGAATTTACCAACCCATCACGAGCTTGGTGTTTTT
GAAAGAGAATGACTCGCACTGGGACATTTTTCGATTGTGCTGCAGAAAAG
TTTCAAATATTAACAAAAGAGGTCCTGCAATATCATGACGCTTACACTGA
AATATCGAAGCCAGAAGTAATAATTTCAAACGAAAACATTGAAAGTGATC
TACATTCTCATTATACTCCTATAAAAAAGAAGCAAGACGACGTTCCAAAA
GAGCCGAACCCAAGATTAGAAGTTGGAAAATCTTTACCTCATTCACTTGG
AGATTATTTTCCACGGAAGAAATTGTCCGGAATACCATTAGTAGAACTAG
ATCCATTTTACTATAAAAAACAGACTTTTGTCGTGATTGCTTCAGATAAA
ACCATTTTTAGATTCAGTACTACGAAAGCTTTCTATTTACTTTCCCCTTT
AAATCCTATCAGAAAAACTGCTATACGATTGCTAACTCATCCAGTGTTCA
GTTTTCTTGTTTTAACTACAATTATTATTAATTGTGTTTTTATGGCAAAA
AATAGCAATTCTGATACTGTTGAATATGTTTTCACAACAATTTACACCCT
AGAATTCACGATCAAAGCAATCTCAAGGGGTCTGATAATAAACGAGTTTA
CGTATCTCCGTGACGCATGGAATTGGCTGGATTTTATAGTGATTGGATTA
GCATATCTGATGTTTTTCTTTCCGGTTTTGGGAAATCTTTCTGCTTTAAG
ATCTCTTCGAGTATTGAGAGCATTGAAAACCGTAACAACTGTACCAGGAA
TGAAAACTGTGGTTGGAGCTCTTTTAGAAGCCGTGAAACAGTTGCGTGAT
GCAATGGTATTAACTGTATTTTTACTATCCATTTTCGGTCTGATCGGCTT
ACAGCTCTACAGAGGAACCTTGCTGCGAAAGTGCGTAAAAAGTTTCAATC
ACACGTTGCTTTACTTTGAGCCCAATGAATTTGAAAACTTAACTGATGCT
GAGAAATGGACTGTAAAATATGAATTTTTTAACAACGAAACCAATTGGCT
TGACCCGCTTCGTCAATGTCAGAATTATACGTACAATGAATGGAATACAT
CTTGTCCCGAAGGATATGTTTGCATACAAACAAAAACTGGAAATCCCAAT
TATGGCTATACGAACTTTGACAATTTTATCGTTTCTCTTTTATGTGCCTT
TCGTTTAATGACCCAAGATTACTGGGAGAATCTGTATCAGTTGACTATTC
GTACAAACGGAGATATTCATATTCTTTATTTCATGATGGTCATATTTTTT
GGATCATTTTACCTGATAAATGTAATCTTGGCGATTGTGGCTATGTCTTA
TGATGATGTCCGACTGGCAATACAGGCAGAAGAAACGGGCGATGAAGCTG
AAAGAAAAGAACAAGAAGAAATGAGAGAAAAAATCATCGACAGAATTGAT
GAAGAATTGGGAGTGGAAAGTTCAGAAGATTTAAATTATCAAAACCCAGT
CAGGCCAAATTCAAAAGACGGCTGGAGTATTCAGTCATATGTTCGAAAAC
AGAGTTTAATTAAATCAGGATTAAATGACGAATTCAATTCAAAGAGTTAT
CAAGTCTCAAATGTTGACATAGAAAGCGAGCCTCGGTTTAGCATCTGCGA
CTATGATTCAACGGACAGAAATTTGGATTCAACTAGATTAGTTTGTCCTC
TTGAAAGCTATTTCAAGGGTAAAATAAAGTTCAATTACGCTGACAAATCA
GAATCTGAAGCTACAACTCCTATTCTACCGCGATCACCTAGATCAATTGC
AGTCGGCAAAAGAATTGTAGGATCTCTAAGTTCATTTTCCCCAATGCTGG
ATGAAAGAAGTTCAAAATCTTATTTGGATCCAAATTTACTCCACACTAGC
AACTCTCGAATGTTCGGAATGAAAAGGATTACAGAAATTGATGGCCAAGG
TGAAATCAAAAGGCAGTTATCACAAAACCTTCGAAGGCGCGTCTCAAAAA
ACTTATCATTTCGACACCGAATGGAAAACGAATCAATTAACAGTGACATT
TTTATCAAAATCAATCAAGATGATGACAATATGATCTCAGAAATCAACCA
GTACATAAAAAACCCAGAATTGCAATCTGCCCTAAGTGCTTTAAGTATTT
ATGATGCCGAAACGAAGGTTAGGAAGAAGGAGCTCATCAAGCAATGGCTG
TTAAAAACGTTCTGCAGTTGGACTTGTTGTCCTTGTTATTTTAAGTTCCA
AAGTCTTGTGGCACTAATAATTCTTGATCCATTTGTTGAACTGTTTATTA
CCCTGTGCATCGTCATGAATACCGTTTTAATGTCGATTGACACTCCAGAC
AACAGTCCAGAAATGAACCACTTTTTGAAATGTGCAAATTATTTTTTCAC
AACAACATTCGGACTGGAAGCTTTTCTGAAACTGATAGCTTTGGGACCCG
AGCAATATTTTCAAGAGCACTGGAATGTGTTTGACTTCATTATAGTAATA
CTGAGTTTGGTGGAAATTCCTCTTGATTCTTCGGGAATGTCATTGTTGAG
AGCCTTCCGTTTACTTCGAGTCTTCAAATTAGCCAAATCTTGGCAAACCA
TGAATCTGTTGTTTATGATCATTGGGACGACTGTTGGAGCTATTGGAAAC
TTATGCATCGTCCTAGGAATCATTATATTCATATTTGCTGTTGTTGGGAT
GCAATTGTTTGGGGATAAATATTCAAATTTCAAAAATGAAACACTGTTCC
CATCGTTTAAAGGAGCAGAACCAAGATGGAATTTTAATGATTTTACTCAT
TCTTTTATGATTGTCTTTCGAGTGCTCTGTGGAGAATGGATAGAATCTAT
GTGGGATTGTATGCTTGTCAATGGCTATCAATGTGTTCCATTCTTTTTAA
TGACAATGATATTGGGAAATTTGGTGCTATTAAACCTTTTCTTGGCTTTG
TTGCTCAGTTCATTTGGAAGTGAAAGTCTACAGAAGCGAGAAGACGATTC
GAATGAAACAAACAAGCTCCAGGAAGCTATTGATAGAATATATCGGGCTA
TTGTTTGGGTGAAAGTACAAATAAGATTTGCAATAAAGCTTTCGAAGGAG
ATATTTGGTCGCTGCATCGTGAAAAAGCGGAAGAAATTAATCAAAAGTCA
TCCAATGTGGAATGCGCACAATATCAAGTGTGAGAAGTCTTATTATGAAC
TTTCCGTCTCGAATGACGTAAAAATACCAGAAGAACAGCTAAGCAATCCA
GAGTTGTGGTTCAAGTACTCATTAAAAGAAACTGAAGTTCCAAAATTCGA
CGAAGATCCAGAAATCAATGAAGTGGAAATCATTTATTCAACCTCTCCAG
AGGATTGTTTACCGAACTTCATCAGTAAACTGCTTAGGAAATGTTATGAC
GTAGTTTTCGAAACCCCTCCAGGCCGGTTATGGTGGAATTCTCGTTGTAA
GGCATCAAAATTAGTCGAACACCAATTCTTTGAAACATTTATTATTTTAA
TGATTATCATTAGCTCTTTGACTTTGACATTGGAAGATAAAAATCTTCCA
TCAAGGCCGTGGTTAAAATTAGCCCTGGAAATTTTAGATAAAGTCTTTAC
TATCATCTTTACTGCAGAAATGCTTTTAAAATGGTTTGCTTTTGGATTAA
ATAAATATTTCAAAGATGCTTGGTGCTGGTTGGATTTCATAATTGTGACG
ATAGCTCTAGTGAGTTTAGTTCTATCTTACATTGGAACTGGAGCGGGAGG
AATGGGCGCATTTAAGGCAATGAGAACTTTACGAGCATTGCGTCCTTTGA
GAGCGGTTTCTAGATGGGAAGGAATGAGGATAGTTGTCAATGCTCTAATT
CAAGCTATCCCGTCAATATTTAACGTTTTACTCGTCTGCCTTGTGTTTTG
GTTGATATTCAGTATTATTGGTATGCAGTTATTTGGAGGAAAGTTTTACA
AATGTGTAAATAATGACACTTTTGAAAGAATATCAGCGGAGATTATACCG
AATAAAAATGCTTGCTTGATAATGAAAGCTATGTATGGAAATGTTTCATG
GGAAAACTCTCAACTGAATTTTGATAACGTCCTAAATGGCTATCTTTGTC
TTTTCCAAGTGGCAACTTTCAAAGGCTGGATTGAAATAATGGCAGATGCT
GTTGATTCTACCGGACTTGGAAACCAACCCAGTTACAACCATAGTACTAT
TTATTATGCATATTTTGTTTCATTTATAATCTTCGGGGCGTTTTTCACTT
TGAATTTATTCATTGGTGTCATTATTGATAATTTTAATGTTCAAAAAAAA
AGAGTAGGTGGATCACTTGAGATGTTTATGACGGAAGATCAAAAGAAATA
TTATAATGCCATGAAAAAGATGTCAAGCACCGCTCCACAGAAACCGATTC
CTCGACCAAAATTGAAAATTGCCAACATTATTTTTTCAATAACAATAAAT
CAAAAGTTCGACATCTTCATCATGTCAGTGATCATGCTCAACACGATTGT
CATGTGTATTGAGCATTGGGATCAACCGGAAAAACTGAAAACGGCTCTCG
ACCAAATAAATAAAGTTTTTATTGTGATTTTCACAGGAGAATTCTTGCTG
AAGCTCATTGCTCAAAGATGGTATTACTTCAAAGTTCCATGGAATATGTT
TGATTTTGTTATTGTCATTTTGTCTATAGTTTTTTGGGCAATTGAGAGTA
TGCTTAACAACATTCCAGTTTCACCGACATTTATTCGGGTGGTCAGAGTC
TTTCGAATAGGCCGTATTTTGAGATTAGTTAAATCTGCGAAAGGAATTAG
AACCTTACTTTTTTCTTTAATTGTTTCCCTGCCGGCCCTGCTCAACATTG
CTTTGCTCTTAATAATGATAATGTTTATATATGCAATAGTGGGAATGTCG
TTCTTTTCCAATGTTGCATATTCTCATAGCATTGATGAGGTGTTTAATTT
CGAGACTTTTGGAAAAGCTATGATAATTTTATTTCAAATTTCAACATCAG
GGGGCTGGAATGGAGTGCTTAATGGATTAATGAATGAAGACCCAAAGGTT
TGCAATAAAGAAAAAGGAACTTGTGGCAGTTATATAATTGCAGTAGTATA
TTTGATCTCTTATTTGATCATTAGTTTTCTTGTCATCATAAACATGTATA
TTGCGGTTATATTAGAAAACTTTAGTCAAGCTACTAAAGACGTCCAGGAA
GGACTGACTCAAGATGACTACGACTTGTTTTATGAATGCTGGGAAGAATA
TGACACTAAAGCCAGAGGATTTATTTCATTGAAATATCTACAAGACTTTG
TAGAGAAAATAGACAAACCTCTTGGGATACCCAAACCAAACTCAGTTCAA
TTGGCAATGCTCGAAATACCTATTTGCCAAAACGATACGGTCTATTGCGT
AGATTTGCTGGAAATTCTCACCCGACGATTTTTGGGACAAAAGCCTGAAG
CTGATACCGGTGAAAATAACTTAAATAAATTAAAGCCGGACTTGAAAATT
GGAAAAGTCGAAAAGATTATTGTGAGTAACACCCTAAAAAGACAGCGTGA
AAATTTTGCGGCAAAAGTTATTGTTAAATACATGAAAGCATATACTGAAC
GATTAAAACAAAACAGAAAATTGTGAAACATGTGAGATAACTAACAAC
back to top

protein sequence of SMED30004389-orf-1

>SMED30004389-orf-1 ID=SMED30004389-orf-1|Name=SMED30004389-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1856bp
MTRTGTFFDCAAEKFQILTKEVLQYHDAYTEISKPEVIISNENIESDLHS
HYTPIKKKQDDVPKEPNPRLEVGKSLPHSLGDYFPRKKLSGIPLVELDPF
YYKKQTFVVIASDKTIFRFSTTKAFYLLSPLNPIRKTAIRLLTHPVFSFL
VLTTIIINCVFMAKNSNSDTVEYVFTTIYTLEFTIKAISRGLIINEFTYL
RDAWNWLDFIVIGLAYLMFFFPVLGNLSALRSLRVLRALKTVTTVPGMKT
VVGALLEAVKQLRDAMVLTVFLLSIFGLIGLQLYRGTLLRKCVKSFNHTL
LYFEPNEFENLTDAEKWTVKYEFFNNETNWLDPLRQCQNYTYNEWNTSCP
EGYVCIQTKTGNPNYGYTNFDNFIVSLLCAFRLMTQDYWENLYQLTIRTN
GDIHILYFMMVIFFGSFYLINVILAIVAMSYDDVRLAIQAEETGDEAERK
EQEEMREKIIDRIDEELGVESSEDLNYQNPVRPNSKDGWSIQSYVRKQSL
IKSGLNDEFNSKSYQVSNVDIESEPRFSICDYDSTDRNLDSTRLVCPLES
YFKGKIKFNYADKSESEATTPILPRSPRSIAVGKRIVGSLSSFSPMLDER
SSKSYLDPNLLHTSNSRMFGMKRITEIDGQGEIKRQLSQNLRRRVSKNLS
FRHRMENESINSDIFIKINQDDDNMISEINQYIKNPELQSALSALSIYDA
ETKVRKKELIKQWLLKTFCSWTCCPCYFKFQSLVALIILDPFVELFITLC
IVMNTVLMSIDTPDNSPEMNHFLKCANYFFTTTFGLEAFLKLIALGPEQY
FQEHWNVFDFIIVILSLVEIPLDSSGMSLLRAFRLLRVFKLAKSWQTMNL
LFMIIGTTVGAIGNLCIVLGIIIFIFAVVGMQLFGDKYSNFKNETLFPSF
KGAEPRWNFNDFTHSFMIVFRVLCGEWIESMWDCMLVNGYQCVPFFLMTM
ILGNLVLLNLFLALLLSSFGSESLQKREDDSNETNKLQEAIDRIYRAIVW
VKVQIRFAIKLSKEIFGRCIVKKRKKLIKSHPMWNAHNIKCEKSYYELSV
SNDVKIPEEQLSNPELWFKYSLKETEVPKFDEDPEINEVEIIYSTSPEDC
LPNFISKLLRKCYDVVFETPPGRLWWNSRCKASKLVEHQFFETFIILMII
ISSLTLTLEDKNLPSRPWLKLALEILDKVFTIIFTAEMLLKWFAFGLNKY
FKDAWCWLDFIIVTIALVSLVLSYIGTGAGGMGAFKAMRTLRALRPLRAV
SRWEGMRIVVNALIQAIPSIFNVLLVCLVFWLIFSIIGMQLFGGKFYKCV
NNDTFERISAEIIPNKNACLIMKAMYGNVSWENSQLNFDNVLNGYLCLFQ
VATFKGWIEIMADAVDSTGLGNQPSYNHSTIYYAYFVSFIIFGAFFTLNL
FIGVIIDNFNVQKKRVGGSLEMFMTEDQKKYYNAMKKMSSTAPQKPIPRP
KLKIANIIFSITINQKFDIFIMSVIMLNTIVMCIEHWDQPEKLKTALDQI
NKVFIVIFTGEFLLKLIAQRWYYFKVPWNMFDFVIVILSIVFWAIESMLN
NIPVSPTFIRVVRVFRIGRILRLVKSAKGIRTLLFSLIVSLPALLNIALL
LIMIMFIYAIVGMSFFSNVAYSHSIDEVFNFETFGKAMIILFQISTSGGW
NGVLNGLMNEDPKVCNKEKGTCGSYIIAVVYLISYLIISFLVIINMYIAV
ILENFSQATKDVQEGLTQDDYDLFYECWEEYDTKARGFISLKYLQDFVEK
IDKPLGIPKPNSVQLAMLEIPICQNDTVYCVDLLEILTRRFLGQKPEADT
GENNLNKLKPDLKIGKVEKIIVSNTLKRQRENFAAKVIVKYMKAYTERLK
QNRKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005261cation channel activity
GO:0005248voltage-gated sodium channel activity
GO:0005216ion channel activity
GO:0005509calcium ion binding
GO:0005244voltage-gated ion channel activity
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0098655cation transmembrane transport
GO:0006516glycoprotein catabolic process
GO:0006814sodium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0001947heart looping
GO:0003007heart morphogenesis
GO:0006810transport
GO:0008016regulation of heart contraction
GO:0034220ion transmembrane transport
GO:0034765regulation of ion transmembrane transport
GO:0035725sodium ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043203VGCC_Ca_Na
IPR006588Peptide_N_glycanase_PAW_dom
IPR001696Na_channel_asu
IPR027359Volt_channel_dom_sf
IPR005821Ion_trans_dom
IPR002048EF_hand_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0001518voltage-gated sodium channel complex
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 437..457
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1707..1822
e-value: 2.9E-31
score: 109.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 847..973
e-value: 1.3E-16
score: 62.4
coord: 352..434
e-value: 7.0E-10
score: 40.7
coord: 1579..1706
e-value: 1.3E-20
score: 75.4
NoneNo IPR availablePANTHERPTHR10037:SF288SODIUM CHANNEL PROTEIN PARAcoord: 217..1853
NoneNo IPR availableCDDcd13433Na_channel_gatecoord: 1407..1459
e-value: 9.10851E-26
score: 99.5615
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 144..431
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 1465..1707
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 1138..1410
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 741..969
NoneNo IPR availableTMHMMTMhelixcoord: 1533..1555
NoneNo IPR availableTMHMMTMhelixcoord: 265..284
NoneNo IPR availableTMHMMTMhelixcoord: 732..754
NoneNo IPR availableTMHMMTMhelixcoord: 1384..1406
NoneNo IPR availableTMHMMTMhelixcoord: 1583..1617
NoneNo IPR availableTMHMMTMhelixcoord: 405..427
NoneNo IPR availableTMHMMTMhelixcoord: 850..881
NoneNo IPR availableTMHMMTMhelixcoord: 1672..1694
NoneNo IPR availableTMHMMTMhelixcoord: 1210..1232
NoneNo IPR availableTMHMMTMhelixcoord: 945..967
NoneNo IPR availableTMHMMTMhelixcoord: 1637..1659
NoneNo IPR availableTMHMMTMhelixcoord: 141..163
NoneNo IPR availableTMHMMTMhelixcoord: 1504..1523
NoneNo IPR availableTMHMMTMhelixcoord: 1140..1158
NoneNo IPR availableTMHMMTMhelixcoord: 203..225
NoneNo IPR availableTMHMMTMhelixcoord: 807..829
NoneNo IPR availableTMHMMTMhelixcoord: 775..797
NoneNo IPR availableTMHMMTMhelixcoord: 1270..1292
IPR001696Voltage gated sodium channel, alpha subunitPRINTSPR00170NACHANNELcoord: 1719..1732
score: 56.71
coord: 1684..1703
score: 77.14
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 1129..1253
e-value: 3.2E-32
score: 113.1
coord: 1455..1577
e-value: 4.5E-36
score: 125.5
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 732..844
e-value: 2.3E-32
score: 113.5
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 136..246
e-value: 7.1E-19
score: 70.1
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 144..434
e-value: 4.1E-62
score: 209.6
coord: 1138..1416
e-value: 3.4E-69
score: 232.8
coord: 741..972
e-value: 2.6E-50
score: 170.9
coord: 1465..1712
e-value: 4.2E-56
score: 189.9
IPR043203Voltage-gated cation channel calcium and sodiumPANTHERPTHR10037VOLTAGE-GATED CATION CHANNEL CALCIUM AND SODIUMcoord: 217..1853
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 1719..1754
score: 8.349