Ring finger protein 123

Overview
NameRing finger protein 123
Smed IDSMED30004384
Length (bp)5245
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ring finger protein 123 (SMED30004384) t-SNE clustered cells

Violin plots show distribution of expression levels for Ring finger protein 123 (SMED30004384) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ring finger protein 123 (SMED30004384) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ring finger protein 123 (SMED30004384) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004384

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30004384h1SMcG0022023 dd_Smed_v4_5649_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004384h1SMcG0022023 dd_Smed_v4_5649_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004384h1SMcG0022023 dd_Smed_v4_5649_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ring finger protein 123 vs. Ensembl Human
Match: RNF123 (ring finger protein 123 [Source:HGNC Symbol;Acc:HGNC:21148])

HSP 1 Score: 252.677 bits (644), Expect = 3.196e-67
Identity = 137/435 (31.49%), Postives = 252/435 (57.93%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPHQQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLV 5032
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  L +  L DA + S +KP PS + Q H+ +LL++   VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+++  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P   ++ +++ L+
Sbjct:  746 SLLEVLDGAVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADARIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPH--LLKTKLEDANLPSLQKPCPSTLLQQHMADLLQQGPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWTRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVQLLVRGPASEREQATSVLL 1176          
BLAST of Ring finger protein 123 vs. Ensembl Human
Match: RNF123 (ring finger protein 123 [Source:HGNC Symbol;Acc:HGNC:21148])

HSP 1 Score: 192.586 bits (488), Expect = 2.311e-52
Identity = 96/285 (33.68%), Postives = 174/285 (61.05%), Query Frame = 2
Query: 4199 VLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPHQQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLV 5032
             L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  L +  L DA + S +KP PS + Q H+ +LL++   VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+++  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P   ++ +++ L+
Sbjct:    8 TLTRLAAILAKHFADARIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPH--LLKTKLEDANLPSLQKPCPSTLLQQHMADLLQQGPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWTRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVQLLVRGPASEREQATSVLL 288          
BLAST of Ring finger protein 123 vs. Ensembl Human
Match: RNF123 (ring finger protein 123 [Source:HGNC Symbol;Acc:HGNC:21148])

HSP 1 Score: 68.1662 bits (165), Expect = 1.451e-10
Identity = 41/145 (28.28%), Postives = 78/145 (53.79%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGL 4183
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L
Sbjct:  600 SLLEVLDGAVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEEL 744          
BLAST of Ring finger protein 123 vs. Ensembl Fly
Match: CG6752 (gene:FBgn0038296 transcript:FBtr0306246)

HSP 1 Score: 135.576 bits (340), Expect = 2.158e-31
Identity = 109/486 (22.43%), Postives = 233/486 (47.94%), Query Frame = 2
Query: 3749 TSCLQLVEAADVFYYIGANEHLNKIVSLRNQ--AHNFIVAVC-----DIDDRIKRCPEEEN--------YIKGLLENSLIN----FETKLTNLSRHLAFISATTFSEEKRXXXX-XXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSL--QLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELP----------HQQLPEFHLRD----AVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQK-FKQISSTRLVEIMIKESNFMQLSLE 5077
             S  +L++   +FYY   ++++ KI ++R++  A N ++        DI+ ++    +  N        ++ G L +        F T+   L+R   ++     +  +R  ++  L     +    +    L+ F+P  ++     +   +    H  L  Q E      +V +    + +H+  D RI  ++ ++ +++ +  +      ++ LE R +     + +++LL       W  +  +L +FW G+G+A++    P          HQ L     R+     ++ +    NPS+ FQ  +   L E+   AT+F++ +L+++NW+FSE +  +QE+      + + L + + ++ CS+CF++TVSL+R LEM+++  PE+  D S+ +S++ L+R+   ISQ+ +R  +  G F  V++     L+ + ++PI  AALG+++AL+ +  +   +    TR+    + + +F   +LE
Sbjct:  683 ASLCELLDLCIIFYYSAGHKYIVKIATVRDEIAALNEVLKETKFYREDIERKLGALEQHANVCMNENHQHVMGELRSKFSQRQNVFATRSIALARKQVWLRGVALNNHRRSLLIWLLERMLRTLTTASNTGSLFSFVPEVYVNTLPILLDAVMDFSHHDLKAQFEASDAECSVNAAAEFLGIHS-ADPRIVLASCKDSLLQALGTLTCHKSGVRALE-RTSKRSQASLVRALLRPYENRAWGQSNWLLLRFWMGEGYAYKDSRQPSVWQGGSLPLHQGLCRSRSRNETHTGLLHNVAPANPSKHFQRLIGAKLLEDEPFATAFLNSVLSQLNWAFSEFILLLQEIQNTAQRQENTLFEPKQLKICSMCFELTVSLMRCLEMVITTAPEIVTDESRPNSDLLLNRICQLISQVLSRVTVPPGCFQFVVDMCSADLNAVTHYPIVTAALGILLALMQEEMESDLRPQIVTRVSRAFLTDPSFQFATLE 1166          
BLAST of Ring finger protein 123 vs. Ensembl Fly
Match: CG6752 (gene:FBgn0038296 transcript:FBtr0083029)

HSP 1 Score: 135.576 bits (340), Expect = 2.158e-31
Identity = 109/486 (22.43%), Postives = 233/486 (47.94%), Query Frame = 2
Query: 3749 TSCLQLVEAADVFYYIGANEHLNKIVSLRNQ--AHNFIVAVC-----DIDDRIKRCPEEEN--------YIKGLLENSLIN----FETKLTNLSRHLAFISATTFSEEKRXXXX-XXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSL--QLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELP----------HQQLPEFHLRD----AVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQK-FKQISSTRLVEIMIKESNFMQLSLE 5077
             S  +L++   +FYY   ++++ KI ++R++  A N ++        DI+ ++    +  N        ++ G L +        F T+   L+R   ++     +  +R  ++  L     +    +    L+ F+P  ++     +   +    H  L  Q E      +V +    + +H+  D RI  ++ ++ +++ +  +      ++ LE R +     + +++LL       W  +  +L +FW G+G+A++    P          HQ L     R+     ++ +    NPS+ FQ  +   L E+   AT+F++ +L+++NW+FSE +  +QE+      + + L + + ++ CS+CF++TVSL+R LEM+++  PE+  D S+ +S++ L+R+   ISQ+ +R  +  G F  V++     L+ + ++PI  AALG+++AL+ +  +   +    TR+    + + +F   +LE
Sbjct:  683 ASLCELLDLCIIFYYSAGHKYIVKIATVRDEIAALNEVLKETKFYREDIERKLGALEQHANVCMNENHQHVMGELRSKFSQRQNVFATRSIALARKQVWLRGVALNNHRRSLLIWLLERMLRTLTTASNTGSLFSFVPEVYVNTLPILLDAVMDFSHHDLKAQFEASDAECSVNAAAEFLGIHS-ADPRIVLASCKDSLLQALGTLTCHKSGVRALE-RTSKRSQASLVRALLRPYENRAWGQSNWLLLRFWMGEGYAYKDSRQPSVWQGGSLPLHQGLCRSRSRNETHTGLLHNVAPANPSKHFQRLIGAKLLEDEPFATAFLNSVLSQLNWAFSEFILLLQEIQNTAQRQENTLFEPKQLKICSMCFELTVSLMRCLEMVITTAPEIVTDESRPNSDLLLNRICQLISQVLSRVTVPPGCFQFVVDMCSADLNAVTHYPIVTAALGILLALMQEEMESDLRPQIVTRVSRAFLTDPSFQFATLE 1166          
BLAST of Ring finger protein 123 vs. Ensembl Zebrafish
Match: rnf123 (ring finger protein 123 [Source:ZFIN;Acc:ZDB-GENE-050208-529])

HSP 1 Score: 238.039 bits (606), Expect = 1.374e-65
Identity = 135/453 (29.80%), Postives = 251/453 (55.41%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIV 5086
            S L++++   + Y +  ++ L K+V + +  H + VA+ D +++I RCP     I   L+ S   F  KL +LSR LA+I+AT +S++  D    L     +    +    L+ F+P +++   +N +  +   F PS  +E L    + L Q   ++  ++ D RI  +++++ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+  LL ++  +A SF++ +L ++NW+FSE +  +QE+ Q          D R ++ CS CFD++VSLLR+LEM ++LVPE+F+D+++  +E+ L RL   ++Q+ NR    + LF  V+N ++ GL+ + ++PI +A  G++V +++DS ++      +R   +++ +  F   S++ ++
Sbjct:  125 SLLEILDGVVMIYNLSVHQQLGKMVVVSDDVHEYAVALKDTEEKIARCPSRRPDILEELQKSQKVFAEKLNHLSRRLAWINATIYSKKMLDVYWLLRVCIQTIEHSDGTGSLFAFMPEFYLNVAMNSYSALKNYFSPSNCMEELPGYEDTLIQLAAILAKHFADPRIVGTDIKDSLMQALASYVCYPQSLRAVE-RIPEEQRMAMMKNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSLLLQRHMAELLIQDRDMAASFLNSVLNQLNWAFSEFIGMIQEIQQAAERPERNFVDTRQLKVCSTCFDLSVSLLRVLEMTITLVPEIFLDWTRPSAELLLRRLAQLLNQVLNRVTAERNLFDRVVNLRLPGLESVDHYPILVAVTGILVRILVDSNKQ----GVSRAASVLLSDPCFQLRSIQYLL 568          
BLAST of Ring finger protein 123 vs. Ensembl Zebrafish
Match: rnf123 (ring finger protein 123 [Source:ZFIN;Acc:ZDB-GENE-050208-529])

HSP 1 Score: 237.654 bits (605), Expect = 9.928e-63
Identity = 138/454 (30.40%), Postives = 254/454 (55.95%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIV 5086
            S L++++   + Y +  ++ L K+V + +  H + VA+ D +++I RCP     I   L+ S   F  KL +LSR LA+I+AT +S+EK  D+ WL      +    +    L+ F+P +++   +N +  +   F PS  +E L    + L Q   ++  ++ D RI  +++++ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+  LL ++  +A SF++ +L ++NW+FSE +  +QE+ Q          D R ++ CS CFD++VSLLR+LEM ++LVPE+F+D+++  +E+ L RL   ++Q+ NR    + LF  V+N ++ GL+ + ++PI +A  G++V +++DS ++      +R   +++ +  F   S++ ++
Sbjct:  743 SLLEILDGVVMIYNLSVHQQLGKMVVVSDDVHEYAVALKDTEEKIARCPSRRPDILEELQKSQKVFAEKLNHLSRRLAWINATIYSKEKMLDVYWLLRVCIQTIEHSDGTGSLFAFMPEFYLNVAMNSYSALKNYFSPSNCMEELPGYEDTLIQLAAILAKHFADPRIVGTDIKDSLMQALASYVCYPQSLRAVE-RIPEEQRMAMMKNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSLLLQRHMAELLIQDRDMAASFLNSVLNQLNWAFSEFIGMIQEIQQAAERPERNFVDTRQLKVCSTCFDLSVSLLRVLEMTITLVPEIFLDWTRPSAELLLRRLAQLLNQVLNRVTAERNLFDRVVNLRLPGLESVDHYPILVAVTGILVRILVDSNKQ----GVSRAASVLLSDPCFQLRSIQYLL 1187          
BLAST of Ring finger protein 123 vs. Ensembl Zebrafish
Match: BX897656.1 (pep chromosome:GRCz11:CHR_ALT_CTG22_1_27:34350355:34527980:-1 gene:ENSDARG00000112768.1 transcript:ENSDART00000192856.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX897656.1)

HSP 1 Score: 174.866 bits (442), Expect = 6.856e-47
Identity = 91/270 (33.70%), Postives = 159/270 (58.89%), Query Frame = 2
Query: 4196 NVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVAL 4981
            + L Q   ++  ++ D RI  +++++ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+  LL ++  +A SF++ +L ++NW+FSE +  +QE+ Q          D R ++ CS CFD++VSLLR+LEM ++LVPE+F+D+++  +E+ L RL   ++Q+ NR    + LF  V+N ++ GL+ + ++PI +A  G++V L
Sbjct:    7 DTLIQLAAILAKHFADPRIVGTDIKDSLMQALASYVCYPQSLRAVE-RIPEEQRMAMMKNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSLLLQRHMAELLIQDRDMAASFLNSVLNQLNWAFSEFIGMIQEIQQAAERPERNFVDTRQLKVCSTCFDLSVSLLRVLEMTITLVPEIFLDWTRPSAELLLRRLAQLLNQVLNRVTAERNLFDRVVNLRLPGLESVDHYPILVAVTGILVHL 271          
BLAST of Ring finger protein 123 vs. Ensembl Xenopus
Match: tsc22d2 (TSC22 domain family member 2 [Source:Xenbase;Acc:XB-GENE-978247])

HSP 1 Score: 245.743 bits (626), Expect = 3.876e-65
Identity = 146/477 (30.61%), Postives = 272/477 (57.02%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEK-RXXXXXXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIVTRKPDNTLSEQSSLDNHQKQSD 5152
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +++IKRCP+    I   L  S   F  KL +LSR LA+I+ T +S++K +D    L     S    ++   L+ F+P +++   +N +  +   F P   +E L+     L++   ++  ++ D RI  +++++ +M+ +   +  P +++ +E RI+     + +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + QNH+  LL+ +  +A+SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM V+LVP++F+D+S+S SE+ L RL   ++Q+ NR    + LF  V+N ++ GL+ + ++PI +A  G++V L++DS  +  Q    R   +++ +  F   S++ ++ +      +EQS L      +D
Sbjct:  745 SLLEILDGAVMMYNLSVHQQLGKMVGVSDDVNEYALALKDTEEKIKRCPKRRADIMDELVKSQRVFSEKLNHLSRRLAWINVTIYSKDKMQDIYWLLQVCLRSIEHADRTGSLFAFMPEFYLNVAMNSYNALKNYFSPVSSMEELQGYEETLTRLATILAKHFADPRIVGTDIKDSLMQALASYVCYPHSLRAVE-RISEEQQISMMKNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQNHMAELLRGDPELASSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTVTLVPDIFLDWSRSSSELLLRRLAQLLNQVLNRVTAERNLFDRVVNLRLPGLESVDHYPILVAVTGILVRLLVDSSSQGIQ----RATAVLLADPCFQLRSIQYLLGQ------AEQSVLGAGPPSAD 1205          
BLAST of Ring finger protein 123 vs. Ensembl Xenopus
Match: tsc22d2 (TSC22 domain family member 2 [Source:Xenbase;Acc:XB-GENE-978247])

HSP 1 Score: 243.047 bits (619), Expect = 9.826e-65
Identity = 146/477 (30.61%), Postives = 273/477 (57.23%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEK-RXXXXXXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIVTRKPDNTLSEQSSLDNHQKQSD 5152
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +++IKRCP+    I   L  S   F  KL +LSR LA+I+ T +S++K +D    L     S    ++   L+ F+P +++   +N +  +   F P   +E L+     L++   ++  ++ D RI  +++++ +M+ +   +  P +++ +E RI+  +  + +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + QNH+  LL+ +  +A+SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM V+LVP++F+D+S+S SE+ L RL   ++Q+ NR    + LF  V+N ++ GL+ + ++PI +A  G++V L++DS  +  Q    R   +++ +  F   S++ ++ +      +EQS L      +D
Sbjct:  546 SLLEILDGAVMMYNLSVHQQLGKMVGVSDDVNEYALALKDTEEKIKRCPKRRADIMDELVKSQRVFSEKLNHLSRRLAWINVTIYSKDKMQDIYWLLQVCLRSIEHADRTGSLFAFMPEFYLNVAMNSYNALKNYFSPVSSMEELQGYEETLTRLATILAKHFADPRIVGTDIKDSLMQALASYVCYPHSLRAVE-RISE-EQISMMKNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQNHMAELLRGDPELASSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTVTLVPDIFLDWSRSSSELLLRRLAQLLNQVLNRVTAERNLFDRVVNLRLPGLESVDHYPILVAVTGILVRLLVDSSSQGIQ----RATAVLLADPCFQLRSIQYLLGQ------AEQSVLGAGPPSAD 1005          
BLAST of Ring finger protein 123 vs. Ensembl Xenopus
Match: tsc22d2 (TSC22 domain family member 2 [Source:Xenbase;Acc:XB-GENE-978247])

HSP 1 Score: 243.047 bits (619), Expect = 1.750e-64
Identity = 146/477 (30.61%), Postives = 273/477 (57.23%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEK-RXXXXXXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIVTRKPDNTLSEQSSLDNHQKQSD 5152
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +++IKRCP+    I   L  S   F  KL +LSR LA+I+ T +S++K +D    L     S    ++   L+ F+P +++   +N +  +   F P   +E L+     L++   ++  ++ D RI  +++++ +M+ +   +  P +++ +E RI+  +  + +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + QNH+  LL+ +  +A+SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM V+LVP++F+D+S+S SE+ L RL   ++Q+ NR    + LF  V+N ++ GL+ + ++PI +A  G++V L++DS  +  Q    R   +++ +  F   S++ ++ +      +EQS L      +D
Sbjct:  626 SLLEILDGAVMMYNLSVHQQLGKMVGVSDDVNEYALALKDTEEKIKRCPKRRADIMDELVKSQRVFSEKLNHLSRRLAWINVTIYSKDKMQDIYWLLQVCLRSIEHADRTGSLFAFMPEFYLNVAMNSYNALKNYFSPVSSMEELQGYEETLTRLATILAKHFADPRIVGTDIKDSLMQALASYVCYPHSLRAVE-RISE-EQISMMKNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQNHMAELLRGDPELASSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTVTLVPDIFLDWSRSSSELLLRRLAQLLNQVLNRVTAERNLFDRVVNLRLPGLESVDHYPILVAVTGILVRLLVDSSSQGIQ----RATAVLLADPCFQLRSIQYLLGQ------AEQSVLGAGPPSAD 1085          
BLAST of Ring finger protein 123 vs. Ensembl Xenopus
Match: tsc22d2 (TSC22 domain family member 2 [Source:Xenbase;Acc:XB-GENE-978247])

HSP 1 Score: 241.121 bits (614), Expect = 6.150e-64
Identity = 137/424 (32.31%), Postives = 252/424 (59.43%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEK-RXXXXXXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDS 4993
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +++IKRCP+    I   L  S   F  KL +LSR LA+I+ T +S++K +D    L     S    ++   L+ F+P +++   +N +  +   F P   +E L+     L++   ++  ++ D RI  +++++ +M+ +   +  P +++ +E RI+  +  + +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + QNH+  LL+ +  +A+SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM V+LVP++F+D+S+S SE+ L RL   ++Q+ NR    + LF  V+N ++ GL+ + ++PI +A  G++V L++DS
Sbjct:  595 SLLEILDGAVMMYNLSVHQQLGKMVGVSDDVNEYALALKDTEEKIKRCPKRRADIMDELVKSQRVFSEKLNHLSRRLAWINVTIYSKDKMQDIYWLLQVCLRSIEHADRTGSLFAFMPEFYLNVAMNSYNALKNYFSPVSSMEELQGYEETLTRLATILAKHFADPRIVGTDIKDSLMQALASYVCYPHSLRAVE-RISE-EQISMMKNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQNHMAELLRGDPELASSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTVTLVPDIFLDWSRSSSELLLRRLAQLLNQVLNRVTAERNLFDRVVNLRLPGLESVDHYPILVAVTGILVRLLVDS 1011          
BLAST of Ring finger protein 123 vs. Ensembl Xenopus
Match: tsc22d2 (TSC22 domain family member 2 [Source:Xenbase;Acc:XB-GENE-978247])

HSP 1 Score: 239.195 bits (609), Expect = 2.598e-63
Identity = 136/425 (32.00%), Postives = 251/425 (59.06%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEK-RXXXXXXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSP 4996
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +++IKRCP+    I   L  S   F  KL +LSR LA+I+ T +S++K +D    L     S    ++   L+ F+P +++   +N +  +   F P   +E L+     L++   ++  ++ D RI  +++++ +M+ +   +  P +++ +E RI+  +  + +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + QNH+  LL+ +  +A+SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM V+LVP++F+D+S+S SE+ L RL   ++Q+ NR    + LF  V+N ++ GL+ + ++PI +A  G++V L+ + P
Sbjct:  597 SLLEILDGAVMMYNLSVHQQLGKMVGVSDDVNEYALALKDTEEKIKRCPKRRADIMDELVKSQRVFSEKLNHLSRRLAWINVTIYSKDKMQDIYWLLQVCLRSIEHADRTGSLFAFMPEFYLNVAMNSYNALKNYFSPVSSMEELQGYEETLTRLATILAKHFADPRIVGTDIKDSLMQALASYVCYPHSLRAVE-RISE-EQISMMKNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQNHMAELLRGDPELASSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTVTLVPDIFLDWSRSSSELLLRRLAQLLNQVLNRVTAERNLFDRVVNLRLPGLESVDHYPILVAVTGILVRLLGNGP 1014          
BLAST of Ring finger protein 123 vs. Ensembl Mouse
Match: Rnf123 (ring finger protein 123 [Source:MGI Symbol;Acc:MGI:2148796])

HSP 1 Score: 249.595 bits (636), Expect = 1.233e-66
Identity = 136/425 (32.00%), Postives = 245/425 (57.65%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSP 4996
            S L++++   + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+ +LL++ + VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+S+  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P
Sbjct:  746 SLLEVLDGTVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWSRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGP 1164          
BLAST of Ring finger protein 123 vs. Ensembl Mouse
Match: Rnf123 (ring finger protein 123 [Source:MGI Symbol;Acc:MGI:2148796])

HSP 1 Score: 249.21 bits (635), Expect = 2.778e-66
Identity = 136/425 (32.00%), Postives = 245/425 (57.65%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSP 4996
            S L++++   + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+ +LL++ + VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+S+  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P
Sbjct:  746 SLLEVLDGTVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWSRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGP 1164          
BLAST of Ring finger protein 123 vs. Ensembl Mouse
Match: Rnf123 (ring finger protein 123 [Source:MGI Symbol;Acc:MGI:2148796])

HSP 1 Score: 249.21 bits (635), Expect = 2.778e-66
Identity = 136/425 (32.00%), Postives = 245/425 (57.65%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSP 4996
            S L++++   + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+ +LL++ + VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+S+  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P
Sbjct:  746 SLLEVLDGTVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWSRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGP 1164          
BLAST of Ring finger protein 123 vs. Ensembl Mouse
Match: Rnf123 (ring finger protein 123 [Source:MGI Symbol;Acc:MGI:2148796])

HSP 1 Score: 249.21 bits (635), Expect = 2.968e-66
Identity = 136/425 (32.00%), Postives = 245/425 (57.65%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSP 4996
            S L++++   + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+ +LL++ + VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+S+  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P
Sbjct:  752 SLLEVLDGTVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWSRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGP 1170          
BLAST of Ring finger protein 123 vs. Ensembl Mouse
Match: Rnf123 (ring finger protein 123 [Source:MGI Symbol;Acc:MGI:2148796])

HSP 1 Score: 249.21 bits (635), Expect = 2.968e-66
Identity = 136/425 (32.00%), Postives = 245/425 (57.65%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSP 4996
            S L++++   + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+ +LL++ + VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+S+  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P
Sbjct:  752 SLLEVLDGTVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWSRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGP 1170          
BLAST of Ring finger protein 123 vs. UniProt/SwissProt
Match: sp|Q5XPI4|RN123_HUMAN (E3 ubiquitin-protein ligase RNF123 OS=Homo sapiens OX=9606 GN=RNF123 PE=1 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 1.535e-66
Identity = 137/435 (31.49%), Postives = 252/435 (57.93%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPHQQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLV 5032
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  L +  L DA + S +KP PS + Q H+ +LL++   VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+++  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P   ++ +++ L+
Sbjct:  746 SLLEVLDGAVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADARIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPH--LLKTKLEDANLPSLQKPCPSTLLQQHMADLLQQGPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWTRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVQLLVRGPASEREQATSVLL 1176          
BLAST of Ring finger protein 123 vs. UniProt/SwissProt
Match: sp|D3ZXK7|RN123_RAT (E3 ubiquitin-protein ligase RNF123 OS=Rattus norvegicus OX=10116 GN=Rnf123 PE=1 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.922e-65
Identity = 136/425 (32.00%), Postives = 244/425 (57.41%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSP 4996
            S L++++   + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+ +LL++ + VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+S+  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L+   P
Sbjct:  750 SLLEVLDGTVMMYSLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLQTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWSRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLAHGP 1168          
BLAST of Ring finger protein 123 vs. UniProt/SwissProt
Match: sp|Q5XPI3|RN123_MOUSE (E3 ubiquitin-protein ligase RNF123 OS=Mus musculus OX=10090 GN=Rnf123 PE=1 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.943e-65
Identity = 136/425 (32.00%), Postives = 245/425 (57.65%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSP 4996
            S L++++   + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+ +LL++ + VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+S+  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P
Sbjct:  746 SLLEVLDGTVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWSRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGP 1164          
BLAST of Ring finger protein 123 vs. UniProt/SwissProt
Match: sp|Q9SIZ8|RKP_ARATH (E3 ubiquitin-protein ligase RKP OS=Arabidopsis thaliana OX=3702 GN=RKP PE=2 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 4.232e-7
Identity = 65/320 (20.31%), Postives = 134/320 (41.88%), Query Frame = 2
Query: 3878 DRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEK-RXXXXXXXXXXXXXXXXNKADKLYGFLPTYHIE---NCLNIFRHITAIFHPSLQL--EGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLL------TDWADAMIILEKFWRGDGFAFRYQELPHQQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQ-YKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFV 4798
            D+IKR  E  N           N++  + +  RH A+   + FS  K R             L  +K D ++ ++P +++E   +C ++ R     F PS     +GL       S     V+ ++ D RI+ ++L++ +++ I  ++     ++  E   N   AT  + + L        W     I  +  +G GF+                    +K+ E    S VFQ  L++    +  + ++F++ L   ++W+ +E   +++E+ + Y+     +       R C + F+++ +L R+LE     +P+ F+
Sbjct:  793 DQIKRLKEARN-----------NYKEDVMDCVRHSAWFRISLFSRWKQRGMYALCMWVVQLLLVLSKMDSVFVYIPEFYLESLVDCFHVLRKSDPPFVPSTTFIKQGL-------SSFITFVVTHFNDSRISNTDLKDLLLQSISVLVQYKEYLEAFE---NNEAATRHMPAALLAAFDNRSWIPVTNIFLRLCKGSGFS-------------------SLKNGESSFSSTVFQALLRDACINDGELLSTFLNRLFNTLSWTITEFSVSVREMQEKYQVMEFQQ-------RKCCVIFELSSNLARVLEFCTYAMPQAFL 1065          
BLAST of Ring finger protein 123 vs. TrEMBL
Match: U6D9L4 (E3 ubiquitin-protein ligase RNF123 (Fragment) OS=Neovison vison OX=452646 GN=RN123 PE=2 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 4.174e-69
Identity = 138/425 (32.47%), Postives = 244/425 (57.41%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSP 4996
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK  DI WL      +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        ++SLL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+  LL+E   VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+++  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P
Sbjct:  103 SLLEVLDGAVMMYNLSVHQQLGKMVGVSDDVNEYAIALRDTEDKLRRCPKRRKDIIAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADTRIVGTDIRDSLMQALASYVCYPHSLRAVE-RIPEEQRVAMVRSLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQQHMAELLREGPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWARPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGP 521          
BLAST of Ring finger protein 123 vs. TrEMBL
Match: A0A2U4B1Z7 (E3 ubiquitin-protein ligase RNF123 isoform X2 OS=Tursiops truncatus OX=9739 GN=LOC101319274 PE=4 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.328e-67
Identity = 137/437 (31.35%), Postives = 250/437 (57.21%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEK-RXXXXXXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRC-LNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLV 5032
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK +D    L     +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI        ++SLL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+ +LL+E   VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+++  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P    + +++ L+
Sbjct:   91 SLLEVLDGAIMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMQDIYWLLRVCLRTIEHGDRTGPLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADTRIVGTDIRDSLMQALASYVCYPNSLRAVE-RIPEEQRIAMVRSLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQQHMADLLREGPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWAQPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGPASGTERATSVLL 521          
BLAST of Ring finger protein 123 vs. TrEMBL
Match: A0A0L8FPB6 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22013111mg PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 4.024e-66
Identity = 143/450 (31.78%), Postives = 259/450 (57.56%), Query Frame = 2
Query: 3734 VLGDLTSCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXXXXXXXXXNKADKL-YGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLT------DWADAMIILEKFWRGDGFAFRYQELPHQQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRCLNK-GLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNF 5059
            + GD T   +L++     Y+I  ++ L K+ +LR+  + FI ++ D ++++ +CP++   IK  LE +   FE K++ L R +A++ A  +S+ K+ D+ W++   L T++   A ++ + FLP ++++ C+N +  +   FHP+     + D F++  +  + +  ++ D RI  S+LR+ + + +      P +++ LE+    L++   +   LT       WA    IL + W+G GF +RY  LPH    +    +  + S +KP PS+VFQ+ L  +L+E+   A  F+D +L+++NWSFSE ++ MQ++ Q  S       D R ++ C+ CF IT+SLLR++EMIVS+ PE F D+SKS SE+ L RL   + QI NR   + G+F NVI+  + G++ + ++PI  A +G+++ L+L SP K  +   +R+  +++ E  F
Sbjct:  209 IPGDAT-LTELLDGVVTLYHIATHKQLGKMSALRDNMNEFINSLIDTEEKLAKCPDDAQEIKYELERAKSVFEEKISELGRQMAWVIAVIYSKAKQIDVAWIFRVVLKTIEKASAHEIPFQFLPEFYVDTCINSYNALKNYFHPTANFFDIPDNFDLSHKFALFLTRHFSDNRIVNSDLRDNITQALACFACFPYSLEVLEDL--PLESKKSMMHYLTAPYDNRSWAQTNWILVRIWKGCGFGYRYTHLPHLVPSKLQTTELGVASLQKPCPSKVFQDLLSEMLREDRERAIRFLDTMLSQLNWSFSEFIAIMQQIQQVVSKTEPWFIDTRQLKFCATCFQITISLLRVVEMIVSISPEFFTDYSKSSSELLLTRLIQLLCQILNRIATRNGMFENVISLPLPGMEVVTHYPIVAATVGILIRLIL-SP-KDPERRDSRVCSVLLSEPLF 653          
BLAST of Ring finger protein 123 vs. TrEMBL
Match: A0A2U4B2D3 (E3 ubiquitin-protein ligase RNF123 isoform X1 OS=Tursiops truncatus OX=9739 GN=LOC101319274 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 8.460e-66
Identity = 137/440 (31.14%), Postives = 251/440 (57.05%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEK-RXXXXXXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDA---TTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDR-LTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLV 5032
            S L++++ A + Y +  ++ L K+V + +  + + +A+ D +D+++RCP+    I   L  S   F  KL +LSR LA++ AT +S+EK +D    L     +    ++   L+ F+P +++   +N +  +   F P   +E L      L++   ++  ++ D RI  +++R+ +M+ +   +  P +++ +E RI    +      ++SLL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+ +LL+E   VA SF++ +L ++NW+FSE +  +QE+ Q  + R++R   D R ++ C+ CFD++VSLLR+LEM ++LVPE+F+D+++  SEM L RL   ++Q+ NR    + LF  V+  ++ GL+ + ++PI +A  G++V L++  P    + +++ L+
Sbjct:   91 SLLEVLDGAIMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMQDIYWLLRVCLRTIEHGDRTGPLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADTRIVGTDIRDSLMQALASYVCYPNSLRAVE-RIPEEHSHRRIAMVRSLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSTLLQQHMADLLREGPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQ-AAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWAQPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGPASGTERATSVLL 524          
BLAST of Ring finger protein 123 vs. TrEMBL
Match: A0A0L8FNH0 (RING-type domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22013111mg PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.372e-65
Identity = 143/450 (31.78%), Postives = 259/450 (57.56%), Query Frame = 2
Query: 3734 VLGDLTSCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXXXXXXXXXNKADKL-YGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLT------DWADAMIILEKFWRGDGFAFRYQELPHQQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRCLNK-GLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNF 5059
            + GD T   +L++     Y+I  ++ L K+ +LR+  + FI ++ D ++++ +CP++   IK  LE +   FE K++ L R +A++ A  +S+ K+ D+ W++   L T++   A ++ + FLP ++++ C+N +  +   FHP+     + D F++  +  + +  ++ D RI  S+LR+ + + +      P +++ LE+    L++   +   LT       WA    IL + W+G GF +RY  LPH    +    +  + S +KP PS+VFQ+ L  +L+E+   A  F+D +L+++NWSFSE ++ MQ++ Q  S       D R ++ C+ CF IT+SLLR++EMIVS+ PE F D+SKS SE+ L RL   + QI NR   + G+F NVI+  + G++ + ++PI  A +G+++ L+L SP K  +   +R+  +++ E  F
Sbjct:  209 IPGDAT-LTELLDGVVTLYHIATHKQLGKMSALRDNMNEFINSLIDTEEKLAKCPDDAQEIKYELERAKSVFEEKISELGRQMAWVIAVIYSKAKQIDVAWIFRVVLKTIEKASAHEIPFQFLPEFYVDTCINSYNALKNYFHPTANFFDIPDNFDLSHKFALFLTRHFSDNRIVNSDLRDNITQALACFACFPYSLEVLEDL--PLESKKSMMHYLTAPYDNRSWAQTNWILVRIWKGCGFGYRYTHLPHLVPSKLQTTELGVASLQKPCPSKVFQDLLSEMLREDRERAIRFLDTMLSQLNWSFSEFIAIMQQIQQVVSKTEPWFIDTRQLKFCATCFQITISLLRVVEMIVSISPEFFTDYSKSSSELLLTRLIQLLCQILNRIATRNGMFENVISLPLPGMEVVTHYPIVAATVGILIRLIL-SP-KDPERRDSRVCSVLLSEPLF 653          
BLAST of Ring finger protein 123 vs. Ensembl Cavefish
Match: rnf123 (ring finger protein 123 [Source:ZFIN;Acc:ZDB-GENE-050208-529])

HSP 1 Score: 222.631 bits (566), Expect = 2.271e-58
Identity = 135/454 (29.74%), Postives = 248/454 (54.63%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIV 5086
            S L++++   + Y +  ++ L K+V + +  H + VA+ D +++I RCP     I   L+ S   F  KL +LSR LA+I+AT +S+EK  D+ W+      +    +    L+ F P +++   +N +  +   F PS  +E L    ++  +H  ++     D  I     ++ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+  LL ++  +A SF++ +L ++NW+FSE +  +QE+ Q          D R ++ C+ CFD++VSLLR+LEM V+LVPE+F+D+++  +E+ L RL   ++Q+ NR    + LF  V+N ++ GL+ + ++PI +A  G++V +++DS ++       R   +++ +  F   S+++++
Sbjct:  625 SLLEILDGIVMMYNLSVHQQLGKMVVVSDDVHEYAVALKDTEEKIARCPGRRPDILEELQKSQKVFAEKLNHLSRRLAWINATIYSKEKMLDVYWVLRVCIRTIEHADNTGSLFAFNPEFYLNVAMNSYSALKNYFSPSNSMEELPGDHSINVRHAPLLQPLLADVHI-----KDSLMQALASYVCYPQSLRAVE-RIPEDQRVAMMRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSLLLQRHMAELLSQDKDMAASFLNSVLNQLNWAFSEFIGMIQEIQQAAERPERNFVDTRQLKVCATCFDLSVSLLRVLEMTVTLVPEIFLDWTRPSAELLLRRLAQLLNQVLNRVTAERNLFDRVVNLRLPGLESVDHYPILVAVTGILVRILVDSERQ----GIARAASVLLSDPCFQLHSIQHLL 1064          
BLAST of Ring finger protein 123 vs. Ensembl Nematostella
Match: EDO45063 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTP5])

HSP 1 Score: 209.92 bits (533), Expect = 6.948e-55
Identity = 131/458 (28.60%), Postives = 244/458 (53.28%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXXXX-XXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLT-----DWADAMIILEKFWRGDGFAFRY---QELPHQQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIVTRK 5095
            S +++++   + Y+I  ++ L+K+ ++R+     I A+ D   RI RC  E   +   L  S   F  + T+ +RH+A++S   F+++K++DI W+    L +     +   L+ F P ++++  +N F  +   FHP+++   L D    L +   ++ +++ D RI   +LR+Q+++ +   +  P +++ LE     L   T ++SL+       W     IL + W+G GFAFRY   Q++    LPE           + P PS+V Q  + ++   +  +   F++ +L ++NW+FSE +  +QE+ Q  +NR++   + R +RTC++CFD+TV LLR+LEM+ +L PE+F D+ +  +E+ + RL+  ++Q+ NR   +  LF NV    + GL+ +  FPI  A  G+++AL+     +    S  R    ++ E  F   S+E +V  K
Sbjct:  597 SLVRMLDDVIMLYHIAVHKQLSKVRAVRDSMQQNIKALEDTHARIARCGPERKDVLAELNRSKRVFTEETTHCARHMAWVSTLIFTKKKQEDIHWMLCCILNTITRAAERGPLFEFTPEFYLDVAINAFHGLRNYFHPTVKFTELPDTDKALCRMAALLSNHFADSRIINPDLRDQIIQALAAFVCYPDSLQALESMPTPLLEKT-VRSLMGAYEKRSWVQTTWILVRIWKGCGFAFRYTSSQDIFTIGLPE-----------QAPCPSKVIQELIASVCVSDVKLGDEFLNGVLNQLNWAFSEFIGMLQEIQQ-ATNRMEITLETRQLRTCAVCFDLTVGLLRVLEMVSTLAPEVFTDWKQQSTELHIARLFQLLTQVLNRITASSNLFENVTRLHLPGLETVDRFPILGAVAGILLALL----SRGSDESRERATSALLAEPGFTLESVEFLVGSK 1037          
BLAST of Ring finger protein 123 vs. Ensembl Medaka
Match: rnf123 (ring finger protein 123 [Source:NCBI gene;Acc:101163564])

HSP 1 Score: 240.35 bits (612), Expect = 9.188e-64
Identity = 139/470 (29.57%), Postives = 258/470 (54.89%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIVTRKPDNTLSEQSSLDN 5134
            S L++ +   + Y +  ++ L K+V + +  H + VA+ D +++I RCP     I   L+ S   F  KL +LSR LA+I+AT +S+EK  D+ WL      +    +    L+ F P +++   +N +  +   F P+  +E L      L+    ++  ++ D RI  +++++ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+  LL  +  +A SF++ +L ++NW+FSE +  +QE+ Q          D R ++ C+ CFD++VSLLR+LEM V+LVPE+F+D+S+  +E+ L RL   ++Q+ NR    K LF  V+N ++ GL+ + ++PI +A  G++V +++D  ++     ++R   +++ +  F   S+++++    D+   E+  +++
Sbjct:  713 SLLEITDGIVMMYNLSVHQQLGKMVVVADDVHEYAVALKDTEEKIARCPPRRADIMDELQKSQKVFAEKLNHLSRRLAWINATIYSKEKMLDVYWLLCVCIRTIEHADNTGSLFAFTPEFYLNVAMNAYSALKNYFSPANSMEELPGYEETLTHLAAILAKHFADPRIVGTDIKDSLMQALASYVCYPQSLRAVE-RIPEEQRVAMMRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSLLLQRHMAELLSLDKDMAASFLNSVLNQLNWAFSEFIGMIQEIQQAAERPERNFVDTRQLKVCATCFDLSVSLLRVLEMTVTLVPEIFLDWSRPSAELLLRRLAQLLNQVLNRVTAEKNLFDRVVNLRLPGLESVDHYPILVAVTGILVRILVDGNRQ----GTSRAASVLLADPCFQLHSIQHLLGEAGDSGEEERQKVEH 1173          
BLAST of Ring finger protein 123 vs. Ensembl Medaka
Match: rnf123 (ring finger protein 123 [Source:NCBI gene;Acc:101163564])

HSP 1 Score: 238.81 bits (608), Expect = 2.777e-63
Identity = 138/467 (29.55%), Postives = 256/467 (54.82%), Query Frame = 2
Query: 3752 SCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXX-XXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTD-----WADAMIILEKFWRGDGFAFRYQELPH--QQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNR-CLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIVTRKPDNTLSEQSS 5125
            S L++ +   + Y +  ++ L K+V + +  H + VA+ D +++I RCP     I   L+ S   F  KL +LSR LA+I+AT +S+EK  D+ WL      +    +    L+ F P +++   +N +  +   F P+  +E L      L+    ++  ++ D RI  +++++ +M+ +   +  P +++ +E RI        +++LL       WA    IL + WRG GF +RY  LPH  +  PE    DA + S +KP PS + Q H+  LL  +  +A SF++ +L ++NW+FSE +  +QE+ Q          D R ++ C+ CFD++VSLLR+LEM V+LVPE+F+D+S+  +E+ L RL   ++Q+ NR    K LF  V+N ++ GL+ + ++PI +A  G++V +++D  ++     ++R   +++ +  F   S+++++    +++ S   +
Sbjct:  691 SLLEITDGIVMMYNLSVHQQLGKMVVVADDVHEYAVALKDTEEKIARCPPRRADIMDELQKSQKVFAEKLNHLSRRLAWINATIYSKEKMLDVYWLLCVCIRTIEHADNTGSLFAFTPEFYLNVAMNAYSALKNYFSPANSMEELPGYEETLTHLAAILAKHFADPRIVGTDIKDSLMQALASYVCYPQSLRAVE-RIPEEQRVAMMRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPE----DANLPSLQKPCPSLLLQRHMAELLSLDKDMAASFLNSVLNQLNWAFSEFIGMIQEIQQAAERPERNFVDTRQLKVCATCFDLSVSLLRVLEMTVTLVPEIFLDWSRPSAELLLRRLAQLLNQVLNRVTAEKNLFDRVVNLRLPGLESVDHYPILVAVTGILVRILVDGNRQ----GTSRAASVLLADPCFQLHSIQHLLGEAGESSTSSTGA 1148          
BLAST of Ring finger protein 123 vs. Planmine SMEST
Match: SMESG000005008.1 (SMESG000005008.1)

HSP 1 Score: 1358.58 bits (3515), Expect = 0.000e+0
Identity = 740/744 (99.46%), Postives = 743/744 (99.87%), Query Frame = 2
Query: 2954 ELEDIQSEILIQLVKSCNPVDDETELTLRTLFIQQLYRYLRINISNVETVSDYSCSLIMSFFHRLISLIRHLWKETMTKFPDLPQFEDISIPISLYVMPSNNCIQLNSLRISGRLNQLTKTFKSELDSLLNKNFKKSEKRNFIGFKKNSDFPKFFLDGKSKKSKIPNKIHDIVLEERNVAISNSPLKSQSVSNCKIXXXXXXXXXXXXXXXXXXXXXXXXXXXHIRVEPLSLFTGLXXXXXXXXXXXXXXXXXXXCQLDFVLGDLTSCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRXXXXXXXXXXXXXXXXNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTDWADAMIILEKFWRGDGFAFRYQELPHQQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRCLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIVTRKPDNTLSEQSSLDNHQKQSDLIFDLNECSSY 5185
            ELEDIQSEILIQLVKSCNPVDDETELTLRTLFIQQLYRYLRINI+NVETVSDYSCSLIMSFFHRLISLIRHLWKETMTKFPDLPQFEDISIPISLYVMPSNNCIQLNSLRISGRLNQLTKTFKSELDSLLNKNFKKSEKRNFIGFKKNSDFPKFFLDGKSKKSKIPNKIHDIVLEERNVAISNSPLKSQSVSNCKISSSPSKEN+STSELSMTSTSFFSFFPSHIRVEPLSLFTGLNRSNNVSESSISSDDNIFSCQLDFVLGDLTSCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRDDILWLWTTTLSTLDDNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTDWADAMIILEKFWRGDGFAFRYQELPHQQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRCLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIVTRKPDNTLSEQSSLDNHQKQSDLIFDLNE S+Y
Sbjct:   67 ELEDIQSEILIQLVKSCNPVDDETELTLRTLFIQQLYRYLRININNVETVSDYSCSLIMSFFHRLISLIRHLWKETMTKFPDLPQFEDISIPISLYVMPSNNCIQLNSLRISGRLNQLTKTFKSELDSLLNKNFKKSEKRNFIGFKKNSDFPKFFLDGKSKKSKIPNKIHDIVLEERNVAISNSPLKSQSVSNCKISSSPSKENTSTSELSMTSTSFFSFFPSHIRVEPLSLFTGLNRSNNVSESSISSDDNIFSCQLDFVLGDLTSCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDIDDRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRDDILWLWTTTLSTLDDNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLEGLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKCLEERINVLDATTFLQSLLTDWADAMIILEKFWRGDGFAFRYQELPHQQLPEFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWSFSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVSLVPELFVDFSKSHSEMFLDRLYSSISQIFNRCLNKGLFHNVINFKINGLDQLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLENIVTRKPDNTLSEQSSLDNHQKQSDLIFDLNEYSAY 810          
BLAST of Ring finger protein 123 vs. Planmine SMEST
Match: SMESG000066109.1 (SMESG000066109.1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.787e-12
Identity = 71/296 (23.99%), Postives = 129/296 (43.58%), Query Frame = 1
Query:   43 NFLKKCMEAIEYRSVIKFLVFKKKTDKEIFKNLKDTFSKNVPLYSTIKNWVRESQGGQKSVFDEDKCGRPVDIPEKNYRKISRNTVRMQN*CKLIIQ*DQY**W*----------------------------SSHYYERFCDSKVVFQLYQCS*HLK*WGNVFNVAVTTHRFVVNIDAISCLALLLKMKPHWLFTSRSQRDHPVSGSYPPKTLMKKLCSGASIRKSMMLSVFWDNNVGFRI------------ILLPLIRNFTTKRRKSRKVPVWYLHDNGPINTAAASA--STM 804
            NF+K  M  +EYRSVIKFLV ++    EI   L  T+       +T+ +W+ + + G++SVFD+++ GRPV   E ++  I++        C++I++ ++   W                             +S Y+ RF   ++     +C        +         RF+ NI       + +   P  L+   S+++      +P K   +K+ +G   R+ +ML++FWD++   ++                LI      RRK R   +W+L DN P++ ++ S+  STM
Sbjct:  660 NFVKIAMNPVEYRSVIKFLVIRQTESSEISSQLSSTYGTTALSKTTVYHWIAQYRRGRQSVFDDERSGRPV---EIDHENIAKR-------CEIIVRDER---WITLKELQRRLNISDGKVREILKDLGTRKLASRYFPRFLSGEMCQVRLECCQQCLSLNDQHG-----SRFLDNI-------VTVDEIPFSLYLPESKKESS-EWRFPDKRAPRKMLAGTPHRRCLMLTIFWDSSGVIKVDFAEKDVTINSAYYADLIAETRRLRRKPRGFSLWWLQDNTPVHKSSVSSRPSTM 929          

HSP 2 Score: 45.8246 bits (107), Expect = 4.918e-8
Identity = 22/56 (39.29%), Postives = 32/56 (57.14%), Query Frame = 3
Query:  417 FLTSEMMGKRF*CRSNNSQICSEYRRNFLSSIVTKDETSLALYIPQSKRSSSEWKL 584
            FL+ EM   R  C      +  ++   FL +IVT DE   +LY+P+SK+ SSEW+ 
Sbjct:  787 FLSGEMCQVRLECCQQCLSLNDQHGSRFLDNIVTVDEIPFSLYLPESKKESSEWRF 842          

HSP 3 Score: 32.3426 bits (72), Expect = 4.918e-8
Identity = 16/31 (51.61%), Postives = 19/31 (61.29%), Query Frame = 2
Query:  311 INVNSLSNRINISDGKVHTIMKGFVIRKLCS 403
            I +  L  R+NISDGKV  I+K    RKL S
Sbjct:  751 ITLKELQRRLNISDGKVREILKDLGTRKLAS 781          
The following BLAST results are available for this feature:
BLAST of Ring finger protein 123 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RNF1233.196e-6731.49ring finger protein 123 [Source:HGNC Symbol;Acc:HG... [more]
RNF1232.311e-5233.68ring finger protein 123 [Source:HGNC Symbol;Acc:HG... [more]
RNF1231.451e-1028.28ring finger protein 123 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Ring finger protein 123 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ring finger protein 123 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG67522.158e-3122.43gene:FBgn0038296 transcript:FBtr0306246[more]
CG67522.158e-3122.43gene:FBgn0038296 transcript:FBtr0083029[more]
back to top
BLAST of Ring finger protein 123 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rnf1231.374e-6529.80ring finger protein 123 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1239.928e-6330.40ring finger protein 123 [Source:ZFIN;Acc:ZDB-GENE-... [more]
BX897656.16.856e-4733.70pep chromosome:GRCz11:CHR_ALT_CTG22_1_27:34350355:... [more]
back to top
BLAST of Ring finger protein 123 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tsc22d23.876e-6530.61TSC22 domain family member 2 [Source:Xenbase;Acc:X... [more]
tsc22d29.826e-6530.61TSC22 domain family member 2 [Source:Xenbase;Acc:X... [more]
tsc22d21.750e-6430.61TSC22 domain family member 2 [Source:Xenbase;Acc:X... [more]
tsc22d26.150e-6432.31TSC22 domain family member 2 [Source:Xenbase;Acc:X... [more]
tsc22d22.598e-6332.00TSC22 domain family member 2 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Ring finger protein 123 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf1231.233e-6632.00ring finger protein 123 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1232.778e-6632.00ring finger protein 123 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1232.778e-6632.00ring finger protein 123 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1232.968e-6632.00ring finger protein 123 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1232.968e-6632.00ring finger protein 123 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Ring finger protein 123 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q5XPI4|RN123_HUMAN1.535e-6631.49E3 ubiquitin-protein ligase RNF123 OS=Homo sapiens... [more]
sp|D3ZXK7|RN123_RAT1.922e-6532.00E3 ubiquitin-protein ligase RNF123 OS=Rattus norve... [more]
sp|Q5XPI3|RN123_MOUSE1.943e-6532.00E3 ubiquitin-protein ligase RNF123 OS=Mus musculus... [more]
sp|Q9SIZ8|RKP_ARATH4.232e-720.31E3 ubiquitin-protein ligase RKP OS=Arabidopsis tha... [more]
back to top
BLAST of Ring finger protein 123 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U6D9L44.174e-6932.47E3 ubiquitin-protein ligase RNF123 (Fragment) OS=N... [more]
A0A2U4B1Z71.328e-6731.35E3 ubiquitin-protein ligase RNF123 isoform X2 OS=T... [more]
A0A0L8FPB64.024e-6631.78Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A2U4B2D38.460e-6631.14E3 ubiquitin-protein ligase RNF123 isoform X1 OS=T... [more]
A0A0L8FNH01.372e-6531.78RING-type domain-containing protein OS=Octopus bim... [more]
back to top
BLAST of Ring finger protein 123 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnf1232.271e-5829.74ring finger protein 123 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Ring finger protein 123 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ring finger protein 123 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ring finger protein 123 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO450636.948e-5528.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ring finger protein 123 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rnf1239.188e-6429.57ring finger protein 123 [Source:NCBI gene;Acc:1011... [more]
rnf1232.777e-6329.55ring finger protein 123 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Ring finger protein 123 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000005008.10.000e+099.46SMESG000005008.1[more]
SMESG000066109.15.787e-1223.99SMESG000066109.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004384 ID=SMED30004384|Name=Ring finger protein 123|organism=Schmidtea mediterranea sexual|type=transcript|length=5245bp
CTTGTTTTCATATATTAATTAATTAATAATTATTTTTTCAGCAATTTTTT
GAAAAAATGTATGGAAGCTATTGAATACAGAAGTGTAATAAAATTTTTAG
TTTTTAAGAAGAAAACCGACAAAGAGATTTTCAAGAATTTAAAGGATACA
TTTAGTAAGAATGTCCCATTATATAGCACTATTAAAAATTGGGTGCGCGA
ATCGCAAGGTGGCCAAAAGTCAGTTTTTGACGAGGATAAGTGCGGTCGAC
CAGTTGATATTCCTGAAAAAAATTACAGAAAAATAAGTAGAAATACTGTA
AGAATGCAGAATTAATGTAAACTCATTATCCAATAGGATCAATATTAGTG
ATGGTAAAGTTCACACTATTATGAAAGGTTTTGTGATTCGAAAGTTGTGT
TCCAGTTGTATCAGTGTTCCTAACATCTGAAATGATGGGGAAACGTTTTT
AATGTCGCAGTAACAACTCACAGATTTGTAGTGAATATAGACGCAATTTC
CTGTCTAGCATTGTTACTAAAGATGAAACCTCATTGGCTCTTTACATCCC
GCAGTCAAAGAGATCATCCAGTGAGTGGAAGTTATCCACCGAAAACCCTA
ATGAAGAAACTCTGTAGTGGTGCTAGTATTCGAAAATCAATGATGCTGTC
AGTTTTTTGGGATAATAATGTAGGATTTCGCATAATATTACTGCCACTTA
TTAGAAATTTTACGACCAAAAGAAGAAAATCCAGAAAAGTTCCAGTATGG
TATCTTCACGATAATGGCCCTATTAACACTGCGGCTGCTTCTGCATCGAC
AATGGACAATGTTGAATTTAGTGTCCTTTCACATCTCCAACATACAGCCC
AGATCTGGCTCCAATTACCTTTTCCGCCATCTTAAGAAGCACTTAGCTGG
GAAAATATTTGAAAATAACGATGAACTGAAAGAGGCAGCGGAAGATTTCT
TCGACAATTGGAACCCAGATTTCTTCAAAAATGGATTTTCAGAACTTGTA
ATCCGCTGGGGAAAATGTGTCGGTAATCTCGGTGGATCTATCGAAAAATG
ATGCATATGATACATGAATTATATGTATTGTGAATGAAAATTTAGTGTTC
TCAATTATTTCTATCTCAGGCCGAGTACTTAATGAACCAACTACGTATGT
AACATCTAAAAAATAAATATTTCAAATTGAAAACACTTGAAAGTCAAATA
AAGTTTGAAAGGAAAATACCGATGCTAAATTGAAGTTTCTGTTATTGAAT
TGCTAACAAAGTAATGAAATTTAATCAAAAATAAAGTTCTAATGTATGTG
ACACGTGGACCCGTTATTTGTTTATATAAATTAAGGGAATGAAGTGCTTT
TTAAAATTAAAAAAAAGTTTGTCAAATCTAAACTAGCAAGAGTTTGGCCA
AATTCTATTAAAAATTTTCAAAAGCCATTTCTGAAGGAATTACTCGATTT
GGAAAAGAATTCCAAGTTGTGAAATTAATTCATGAGCAGAAAATGAATCC
TGGGATAATCCTATGTGAATTGTGTTTTTCTAGTTATCGTGCAAGCTATT
TTCAAAAGGCTCATTTATGGACCAATTTATGGACCAATCATCAAGGGACT
ATGCGCATAATAAATCATAGTGATGTGTAATACTTGAATTAATGTCAAAG
GTAATGTTGGAATCTAGTTTGCTTATTTTGTCTCAGCTTTTATTATTTCA
TGGAACACAATTAATAACTATTTTATAGTTTTTAATGGAAAATAATTCTT
CTATCAAATTTTATAATGATAATAAAGGAAAATTTTGTAATAGTTTGTAA
TGATTACATTTAGAGTTTTTACTGGGATTTTACTAGTGGCATTTATAGGT
CCTTTGGGAATAACACATGTTAATAGTATCAAACTTTGTAGTCCAACACC
ACTTCTTACTAATATGTAATAATATTGTAACAATATTTTCCATTCGTTTA
TTACCAGGCCTAAAGTTTTATAAGTTAGTATTTTTTTGACCAAAGATCTG
TAGCAATTGGCAGACAAATTTTGGTTATTCAGATTTCTGTATTTAATCGA
TATCGACAAATGGGACTTTTTAATAATGTTTAATGAATATAACCAACATT
TTGAAGGTTCTTATAACAGTGAACCAAAATCTTCTGAATCGCCATTGTAC
ATACATTAATACGTCAAGGATGCGTTGCGTTTTTCATAACGTTAAATTTT
AAAAAAACGTTAAACAAGGCTAGGTAGTGGCGGATTTAGCGGATAACGCG
GCCGCATTAGGCTTCGGAATACCTATGGGTTCCGAGGTTTTAAAATTTGT
AAAAAATTGTTGAAGAAGTACTTTGGAAGAAGAAAGAATAAAGAATATGT
TAACGAATTTTCAAGAAATAAAGCAAGACGAAAATTAATATGAATAATTT
AAATCTGATAAAAGTGTACACTCACAAATTGTACATTGTTTAATGTTTTG
AAATAATATTAAACAGTGTTTCGTTAAACGGGATATCACTGATTGCAAAA
TCATGCTTGAGTAAAAGATTCATTTACAGTGCCTGTGAAGAATTAATTAA
GTAAACATATAGTAGTAATTTTATGATTTGTACTTAAACTCATTGCAAAT
AATCCGTAAATGGACGTAAACATTTTATTGTCGAAATTAGCAACTCTTCC
ACCTATATTTGTCTCACAGAAATAAAATTTTCAACTTTTTTTATTAAATT
TTATTTAGTTAATTAAATTAGAAATTTTTAACAAACAATTAAAAAATTAT
CAAAAACTTGTGTAATATTGAAAACAAATTATTTATCTACAGTTTGAAAG
AAATAGAAAGTAGCTCATTGTAAATAAAAGCAGACCAAAGTGTAAAAATA
TGAAATTAATTAAATTCGAAGAACATTTAATATCTAAAATATAACAGAAA
TAATTTAATTCATTCATCATGAAAGGTATTTTGTCATAAATACTTTTTAT
TTAGAACTTGAAGATATTCAAAGTGAAATCTTAATTCAGTTGGTGAAAAG
CTGTAATCCAGTTGATGATGAAACAGAACTGACTTTGCGCACTTTATTTA
TTCAACAATTGTATCGGTATTTACGAATCAATATTAGCAATGTAGAAACA
GTTTCGGATTATAGTTGTTCTTTGATTATGTCATTTTTTCATCGATTAAT
TAGTTTAATACGACATCTCTGGAAAGAAACTATGACCAAATTTCCCGATC
TCCCTCAGTTTGAAGACATATCTATTCCAATTTCCCTTTATGTGATGCCG
TCTAATAATTGTATTCAGTTAAACTCTTTGCGCATTAGTGGACGACTGAA
CCAGTTAACTAAAACGTTCAAGAGTGAACTGGATTCACTGTTGAATAAAA
ACTTTAAAAAATCGGAAAAACGAAATTTTATTGGATTTAAAAAAAATTCC
GATTTTCCAAAATTTTTTCTAGATGGTAAAAGTAAAAAATCTAAAATTCC
AAATAAAATTCACGATATAGTTCTTGAAGAAAGAAATGTTGCGATATCAA
ATTCACCGTTGAAATCTCAGTCGGTCTCGAATTGTAAAATATCTTCTTCA
CCATCGAAAGAAAATTCCTCCACGTCAGAGCTTTCTATGACTTCAACTAG
TTTTTTCAGTTTTTTCCCCAGTCACATCCGTGTCGAACCCCTTTCTTTAT
TTACCGGCCTAAATCGATCCAACAACGTTTCGGAATCTAGTATTTCTAGT
GATGATAATATTTTCAGCTGCCAGTTAGATTTTGTATTGGGAGATTTAAC
GAGTTGCCTTCAATTAGTCGAAGCTGCTGACGTTTTCTATTACATCGGAG
CCAATGAACATCTTAATAAAATAGTTTCATTGAGAAACCAAGCACATAAC
TTCATTGTGGCAGTTTGCGATATTGATGATCGGATAAAGAGGTGTCCTGA
AGAAGAAAATTACATTAAAGGTCTATTGGAAAATTCATTAATAAATTTCG
AAACTAAGCTAACGAATCTCTCTAGACATTTAGCATTCATCAGTGCCACA
ACATTCTCAGAGGAAAAGCGAGATGATATTCTATGGCTATGGACAACGAC
ATTATCAACATTAGATGATAATAAAGCTGATAAACTGTACGGATTTTTAC
CGACATATCATATTGAAAATTGCCTCAATATATTTCGACATATAACTGCG
ATTTTCCATCCATCTTTGCAATTAGAAGGATTAAGAGATTGTTTTAATGT
CTTATCTCAACATGGAATGATGGTCATGCATAATTATCGTGATAAAAGAA
TCACCCAATCTAATTTACGTAATCAAATGATGAAAGGAATAGTAGATGTC
ATCAATTTACCAGTTGCAATAAAATGTCTCGAAGAAAGAATTAATGTTTT
AGATGCCACAACATTTCTACAATCTCTCCTTACAGATTGGGCAGATGCTA
TGATTATTCTTGAAAAATTCTGGCGGGGAGACGGATTTGCTTTTCGATAT
CAGGAACTACCTCATCAACAATTACCCGAGTTTCATTTACGAGACGCGGT
TATCAAATCTTATGAAAAACCAAATCCTTCTAGAGTATTTCAAAATCACC
TGAAAAACCTATTGAAAGAAAACAATTCTGTGGCCACCTCCTTCATTGAT
TTGTTACTGACAAAAATAAATTGGAGTTTTTCAGAAGTTGTTAGTAATAT
GCAAGAGCTTAATCAATACAAAAGCAATAGAATAGACCGGTTGACTGACA
TCCGATTCATTCGAACATGCTCATTATGTTTTGATATAACAGTTTCGTTG
CTAAGGATTCTTGAAATGATAGTTTCTCTGGTGCCTGAACTTTTTGTCGA
TTTCTCAAAATCACATTCAGAAATGTTTCTAGATCGATTATATTCATCCA
TCAGTCAGATTTTCAATAGATGTTTAAACAAAGGTTTATTTCACAATGTT
ATAAACTTTAAAATCAACGGTCTTGATCAATTGCATTATTTCCCTATAAC
TATAGCGGCTCTCGGAGTAATTGTCGCTTTAGTTTTAGATAGTCCTCAAA
AATTTAAACAAATCAGCTCGACAAGGTTAGTCGAAATAATGATCAAAGAA
TCAAATTTTATGCAGTTATCCCTTGAGAATATAGTAACTCGGAAACCTGA
TAATACTCTTTCAGAACAGTCTTCTCTTGATAATCATCAAAAGCAATCGG
ATTTAATATTTGATTTAAATGAATGTTCGTCTTATTCTAAATATATTATC
CTTGCATAGTTTCAATATTCCCCTCTAGACTCCGCTTATATCACC
back to top

protein sequence of SMED30004384-orf-1

>SMED30004384-orf-1 ID=SMED30004384-orf-1|Name=SMED30004384-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=694bp
MSFFHRLISLIRHLWKETMTKFPDLPQFEDISIPISLYVMPSNNCIQLNS
LRISGRLNQLTKTFKSELDSLLNKNFKKSEKRNFIGFKKNSDFPKFFLDG
KSKKSKIPNKIHDIVLEERNVAISNSPLKSQSVSNCKISSSPSKENSSTS
ELSMTSTSFFSFFPSHIRVEPLSLFTGLNRSNNVSESSISSDDNIFSCQL
DFVLGDLTSCLQLVEAADVFYYIGANEHLNKIVSLRNQAHNFIVAVCDID
DRIKRCPEEENYIKGLLENSLINFETKLTNLSRHLAFISATTFSEEKRDD
ILWLWTTTLSTLDDNKADKLYGFLPTYHIENCLNIFRHITAIFHPSLQLE
GLRDCFNVLSQHGMMVMHNYRDKRITQSNLRNQMMKGIVDVINLPVAIKC
LEERINVLDATTFLQSLLTDWADAMIILEKFWRGDGFAFRYQELPHQQLP
EFHLRDAVIKSYEKPNPSRVFQNHLKNLLKENNSVATSFIDLLLTKINWS
FSEVVSNMQELNQYKSNRIDRLTDIRFIRTCSLCFDITVSLLRILEMIVS
LVPELFVDFSKSHSEMFLDRLYSSISQIFNRCLNKGLFHNVINFKINGLD
QLHYFPITIAALGVIVALVLDSPQKFKQISSTRLVEIMIKESNFMQLSLE
NIVTRKPDNTLSEQSSLDNHQKQSDLIFDLNECSSYSKYIILA*
back to top

protein sequence of SMED30004384-orf-2

>SMED30004384-orf-2 ID=SMED30004384-orf-2|Name=SMED30004384-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
MKPHWLFTSRSQRDHPVSGSYPPKTLMKKLCSGASIRKSMMLSVFWDNNV
GFRIILLPLIRNFTTKRRKSRKVPVWYLHDNGPINTAAASASTMDNVEFS
VLSHLQHTAQIWLQLPFPPS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
GO:0016579protein deubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR13363RING FINGER AND SRY DOMAIN-CONTAININGcoord: 196..627
NoneNo IPR availablePANTHERPTHR13363:SF1E3 UBIQUITIN-PROTEIN LIGASE RNF123coord: 196..627
NoneNo IPR availableTMHMMTMhelixcoord: 602..620