Tyrosine-protein kinase receptor

Overview
NameTyrosine-protein kinase receptor
Smed IDSMED30004366
Length (bp)5654
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein kinase receptor (SMED30004366) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein kinase receptor (SMED30004366) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein kinase receptor (SMED30004366) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein kinase receptor (SMED30004366) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004366

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004366SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004366SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004366SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004366SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004366SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004366SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004366SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004366SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30004366SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: LTK (leukocyte receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6721])

HSP 1 Score: 222.631 bits (566), Expect = 3.730e-61
Identity = 112/280 (40.00%), Postives = 163/280 (58.21%), Query Frame = 1
Query: 4477 IGNGAFGMVFKG-TMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQY 5313
            +G+GAFG V++G  + +  D+   Q  +           E DF  EA+++ K+ H NIV  +G+S      + ++LE M  G+++ +L+H RP               + + S L  +DL+ +A DI +   +LEE +F+HRDIAARNCL+S    + R+ K+GDFG+ARDIY   YYR+     +P++WM PE   +GIF+ K+D WSFGVL WEI + G  PY G+TN EVL  V+ G ++  P  CP  VY +M QCW++ PE RP F  I    QY
Sbjct:  214 LGHGAFGEVYEGLVIGLPGDSSPLQVAIKTLPELCSPQDELDFLMEALIISKFRHQNIVRCVGLSLRA-TPRLILLELMSGGDMKSFLRHSRPH--------------LGQPSPLVMRDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCAGPS-RVAKIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIFTSKTDSWSFGVLLWEIFSLGYMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSFASILERLQY 477          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: ROS1 (ROS proto-oncogene 1, receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:10261])

HSP 1 Score: 231.491 bits (589), Expect = 4.039e-60
Identity = 137/356 (38.48%), Postives = 191/356 (53.65%), Query Frame = 1
Query: 4273 YIHHRKTKRNNKLIKSNIIV----DAQTFELMNVNQGIKYEINSLYGFEKLPLTN-FDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHN-KNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYF 5316
            ++ HR+ K N K  K  + V    D +  EL  +  G+    N+ Y    LP     + +P    E L    L+G+GAFG V++GT        + +  VA+K     S  +E  +F +EA L+ K+ HPNI+  LGV     + Q +ILE ME G+L  YL+  R       L                      +  DI +   +LE  +F+HRD+AARNCLVS+ +  + RI K+GDFGLARDIY ++YYRK  E  +P+RWMAPE++ DGIF+ +SDVWSFG+L WEI+T G  PY   +N +VL  V  G +L  P  CP D++ +M QCW   P+ RP F  I    Q F
Sbjct: 1874 FVWHRRLK-NQKSAKEGVTVLINEDKELAELRGLAAGVGLA-NACYAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCL-LNEPQYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLV--------------DLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLF 2212          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: ROS1 (ROS proto-oncogene 1, receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:10261])

HSP 1 Score: 231.491 bits (589), Expect = 4.187e-60
Identity = 137/356 (38.48%), Postives = 191/356 (53.65%), Query Frame = 1
Query: 4273 YIHHRKTKRNNKLIKSNIIV----DAQTFELMNVNQGIKYEINSLYGFEKLPLTN-FDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHN-KNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYF 5316
            ++ HR+ K N K  K  + V    D +  EL  +  G+    N+ Y    LP     + +P    E L    L+G+GAFG V++GT        + +  VA+K     S  +E  +F +EA L+ K+ HPNI+  LGV     + Q +ILE ME G+L  YL+  R       L                      +  DI +   +LE  +F+HRD+AARNCLVS+ +  + RI K+GDFGLARDIY ++YYRK  E  +P+RWMAPE++ DGIF+ +SDVWSFG+L WEI+T G  PY   +N +VL  V  G +L  P  CP D++ +M QCW   P+ RP F  I    Q F
Sbjct: 1880 FVWHRRLK-NQKSAKEGVTVLINEDKELAELRGLAAGVGLA-NACYAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCL-LNEPQYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLV--------------DLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLF 2218          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: LTK (leukocyte receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6721])

HSP 1 Score: 223.402 bits (568), Expect = 1.142e-59
Identity = 112/280 (40.00%), Postives = 163/280 (58.21%), Query Frame = 1
Query: 4477 IGNGAFGMVFKG-TMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQY 5313
            +G+GAFG V++G  + +  D+   Q  +           E DF  EA+++ K+ H NIV  +G+S      + ++LE M  G+++ +L+H RP               + + S L  +DL+ +A DI +   +LEE +F+HRDIAARNCL+S    + R+ K+GDFG+ARDIY   YYR+     +P++WM PE   +GIF+ K+D WSFGVL WEI + G  PY G+TN EVL  V+ G ++  P  CP  VY +M QCW++ PE RP F  I    QY
Sbjct:  455 LGHGAFGEVYEGLVIGLPGDSSPLQVAIKTLPELCSPQDELDFLMEALIISKFRHQNIVRCVGLSLRA-TPRLILLELMSGGDMKSFLRHSRPH--------------LGQPSPLVMRDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCAGPS-RVAKIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIFTSKTDSWSFGVLLWEIFSLGYMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSFASILERLQY 718          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: LTK (leukocyte receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6721])

HSP 1 Score: 223.402 bits (568), Expect = 2.850e-59
Identity = 112/280 (40.00%), Postives = 163/280 (58.21%), Query Frame = 1
Query: 4477 IGNGAFGMVFKG-TMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQY 5313
            +G+GAFG V++G  + +  D+   Q  +           E DF  EA+++ K+ H NIV  +G+S      + ++LE M  G+++ +L+H RP               + + S L  +DL+ +A DI +   +LEE +F+HRDIAARNCL+S    + R+ K+GDFG+ARDIY   YYR+     +P++WM PE   +GIF+ K+D WSFGVL WEI + G  PY G+TN EVL  V+ G ++  P  CP  VY +M QCW++ PE RP F  I    QY
Sbjct:  516 LGHGAFGEVYEGLVIGLPGDSSPLQVAIKTLPELCSPQDELDFLMEALIISKFRHQNIVRCVGLSLRA-TPRLILLELMSGGDMKSFLRHSRPH--------------LGQPSPLVMRDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCAGPS-RVAKIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIFTSKTDSWSFGVLLWEIFSLGYMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSFASILERLQY 779          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: scd-2 (ALK tyrosine kinase receptor homolog scd-2 [Source:UniProtKB/Swiss-Prot;Acc:O76411])

HSP 1 Score: 194.897 bits (494), Expect = 1.337e-49
Identity = 115/352 (32.67%), Postives = 183/352 (51.99%), Query Frame = 1
Query: 4426 FDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDI-YFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYF-DGPRDIEETSTLSRLVMRSYNSSHESEFGINSDPVTEKTSIAFSEKYPEIGSL 5475
             D +P I  + +    ++G G FG V+ G     S  K + K ++ +  +    S+ DF  EA+ +  +   N+V L+G+ F+      + LEYME G+L  +++  RP+ +            +N    L   DLI I  D+    K LE   +VHRDIAARN L++     +R+ K+ DFG+A++I Y  EYYR    T MPI+W  PE   DG+F+ KSD+WSFGVLCWE+ + G  PY  + N EV+  + +G +L  P   P  VY++M  CWK     RP+F+++  IFQ   D P  +     +   V  ++  S  +   + + P+T  T I+ +  + +  ++
Sbjct:  965 LDSLPSISRDSIERGRVLGRGNFGEVYYGEY---SGVKLAVKMIS-RTFSASQASQSDFCNEALCMGTFVDENVVRLIGIDFE-KVPYMIALEYMEGGDLLSFVKECRPNQVS-----------LNPFQ-LAMSDLIKICCDVAAGCKCLETFGYVHRDIAARNILLTTRGP-QRVAKIADFGMAKEITYGTEYYRINGRTMMPIKWTPPEAFIDGVFTTKSDIWSFGVLCWEVFSLGVVPYPNRRNEEVMLMLTEGARLEYPYGIPTRVYQLMRDCWKTAAADRPKFVDVVEIFQDIQDDPASVGMPFPIHPAVRATFAHSQSTPVSVET-PMTAMTEISLNSTFTDASTV 1297          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: F11E6.8 (pep chromosome:WBcel235:IV:17444156:17447429:-1 gene:WBGene00008711.1 transcript:F11E6.8b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F11E6.8)

HSP 1 Score: 181.03 bits (458), Expect = 3.056e-49
Identity = 100/288 (34.72%), Postives = 156/288 (54.17%), Query Frame = 1
Query: 4450 NECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISE----EDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSET---KMPIRWMAPETIKDG-IFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFL 5289
            +E +    ++G G FG V++G M    D      PVA+K   G+   +    E F RE V++    HP+++ LLG+S        ++L YME G+L+ Y+                     + N  L   +L+  A  + + + +L  ++FVHRD+AARNC++S      RI K+ DFGLA D+   E Y   SET   ++P++W+APE+++D  +FS  +DVWSFGVL WE++T  A PY   +N +V   +  G +L +P  CP  +Y++M  CW+  PE RP F+
Sbjct:   76 SEAVVLETIVGKGYFGNVYRGRM---RDPAGRLIPVAVKTLKGERARDIAHIEKFLREGVVMKHLDHPHVLSLLGISISPAGNPWVVLPYMEGGDLKTYIA--------------------DPNRALCVLELLDFAHQVAQGMSYLAAQHFVHRDLAARNCMIS----ADRIVKVADFGLAVDLLDKESYIDESETGPARLPLKWLAPESLRDRRVFSSATDVWSFGVLMWELLTRAASPYGEVSNTKVRHYLETGMRLPQPTHCPDIIYDLMQCCWRSTPEDRPDFV 336          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: F11E6.8 (pep chromosome:WBcel235:IV:17444125:17450543:-1 gene:WBGene00008711.1 transcript:F11E6.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F11E6.8)

HSP 1 Score: 182.185 bits (461), Expect = 4.375e-49
Identity = 100/288 (34.72%), Postives = 156/288 (54.17%), Query Frame = 1
Query: 4450 NECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISE----EDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSET---KMPIRWMAPETIKDG-IFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFL 5289
            +E +    ++G G FG V++G M    D      PVA+K   G+   +    E F RE V++    HP+++ LLG+S        ++L YME G+L+ Y+                     + N  L   +L+  A  + + + +L  ++FVHRD+AARNC++S      RI K+ DFGLA D+   E Y   SET   ++P++W+APE+++D  +FS  +DVWSFGVL WE++T  A PY   +N +V   +  G +L +P  CP  +Y++M  CW+  PE RP F+
Sbjct:  133 SEAVVLETIVGKGYFGNVYRGRM---RDPAGRLIPVAVKTLKGERARDIAHIEKFLREGVVMKHLDHPHVLSLLGISISPAGNPWVVLPYMEGGDLKTYIA--------------------DPNRALCVLELLDFAHQVAQGMSYLAAQHFVHRDLAARNCMIS----ADRIVKVADFGLAVDLLDKESYIDESETGPARLPLKWLAPESLRDRRVFSSATDVWSFGVLMWELLTRAASPYGEVSNTKVRHYLETGMRLPQPTHCPDIIYDLMQCCWRSTPEDRPDFV 393          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: R151.1 (pep chromosome:WBcel235:III:7218813:7221186:1 gene:WBGene00020106.1 transcript:R151.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.1)

HSP 1 Score: 180.644 bits (457), Expect = 3.241e-48
Identity = 104/277 (37.55%), Postives = 152/277 (54.87%), Query Frame = 1
Query: 4474 LIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYG-HPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +IG GAFG VFKG +   +       PVA+K     +I EE  +F RE  ++   G H NIV + G   D    QC+I+EY+  G+L+ YLQ+ R    ++K          + +S +D+K+ +S  + I   +  LE    +HRD+AARN LV       ++ K+ DFG++R       Y K S+  +P+RW++PE IKD  +S KSDVW+FGVL WEI T G  PY    + ++L  + +G +L +P  C  D+Y +M  CW    E RP FL I
Sbjct:  194 VIGEGAFGQVFKGILRGPNGQVI---PVAVKQLKANAIDEEREEFVREIQMMQTVGQHDNIVTMYGYCMD-EQLQCMIMEYVPYGDLKHYLQNMR----KEK----------DSDSAIDSKEFLSFTNQIACGMAHLESVGIIHRDLAARNILVG----TGKVLKISDFGMSRP----GVYIKMSKGVIPLRWLSPEAIKDNTYSNKSDVWAFGVLLWEIATLGGFPYNNVADKDILNQLTEGMRLEQPAKCSDDMYILMKSCWNLKAEDRPSFLAI 444          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: R151.1 (pep chromosome:WBcel235:III:7217839:7221186:1 gene:WBGene00020106.1 transcript:R151.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.1)

HSP 1 Score: 180.259 bits (456), Expect = 8.511e-47
Identity = 104/277 (37.55%), Postives = 152/277 (54.87%), Query Frame = 1
Query: 4474 LIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYG-HPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +IG GAFG VFKG +   +       PVA+K     +I EE  +F RE  ++   G H NIV + G   D    QC+I+EY+  G+L+ YLQ+ R    ++K          + +S +D+K+ +S  + I   +  LE    +HRD+AARN LV       ++ K+ DFG++R       Y K S+  +P+RW++PE IKD  +S KSDVW+FGVL WEI T G  PY    + ++L  + +G +L +P  C  D+Y +M  CW    E RP FL I
Sbjct:  357 VIGEGAFGQVFKGILRGPNGQVI---PVAVKQLKANAIDEEREEFVREIQMMQTVGQHDNIVTMYGYCMD-EQLQCMIMEYVPYGDLKHYLQNMR----KEK----------DSDSAIDSKEFLSFTNQIACGMAHLESVGIIHRDLAARNILVG----TGKVLKISDFGMSRP----GVYIKMSKGVIPLRWLSPEAIKDNTYSNKSDVWAFGVLLWEIATLGGFPYNNVADKDILNQLTEGMRLEQPAKCSDDMYILMKSCWNLKAEDRPSFLAI 607          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: Alk (gene:FBgn0040505 transcript:FBtr0087118)

HSP 1 Score: 234.958 bits (598), Expect = 1.229e-61
Identity = 126/347 (36.31%), Postives = 198/347 (57.06%), Query Frame = 1
Query: 4270 MYIHHRKTKRNNKLIKSNIIVDAQTFELMN-VNQGIKYEINSLYGFEKLPLTNFD--KIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKI--RNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +Y  +++ K++ K  K  +  D Q   L N ++       N  YG + +   + D   +P +  + L   + +G GAFG V+   +    D    +  VA+K    + K   EEDF +EA ++ K+ HPN+V L+GV FD      ++LE +  G+L+++L+ +R          N+ +R     S+L  KDL+  A D+ +  +++E K F+HRDIAARNCL+S      R+ K+ DFG++RDIY  +YYRK  +  +PI+WM PE   DGIF+ K+DVWSFG+L WE+ + G  PY GQ N +V++ V+ G +LG P  CP+ +Y++M  CW   PE RP F+ +
Sbjct: 1127 LYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDSNLNNFNPNYGCDGILNGHIDVNSLPQVARDSLQLVNALGKGAFGEVYM-ALYRHRDGDAVEMGVAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCFD-RQPYYIVLELLAGGDLQKFLRENR----------NTPER----PSLLTMKDLLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPG-RVVKIADFGMSRDIYRSDYYRKGGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPVSIYKVMADCWNPTPEDRPTFITL 1456          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: Alk (gene:FBgn0040505 transcript:FBtr0331926)

HSP 1 Score: 234.958 bits (598), Expect = 1.229e-61
Identity = 126/347 (36.31%), Postives = 198/347 (57.06%), Query Frame = 1
Query: 4270 MYIHHRKTKRNNKLIKSNIIVDAQTFELMN-VNQGIKYEINSLYGFEKLPLTNFD--KIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKI--RNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +Y  +++ K++ K  K  +  D Q   L N ++       N  YG + +   + D   +P +  + L   + +G GAFG V+   +    D    +  VA+K    + K   EEDF +EA ++ K+ HPN+V L+GV FD      ++LE +  G+L+++L+ +R          N+ +R     S+L  KDL+  A D+ +  +++E K F+HRDIAARNCL+S      R+ K+ DFG++RDIY  +YYRK  +  +PI+WM PE   DGIF+ K+DVWSFG+L WE+ + G  PY GQ N +V++ V+ G +LG P  CP+ +Y++M  CW   PE RP F+ +
Sbjct: 1127 LYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDSNLNNFNPNYGCDGILNGHIDVNSLPQVARDSLQLVNALGKGAFGEVYM-ALYRHRDGDAVEMGVAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCFD-RQPYYIVLELLAGGDLQKFLRENR----------NTPER----PSLLTMKDLLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPG-RVVKIADFGMSRDIYRSDYYRKGGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPVSIYKVMADCWNPTPEDRPTFITL 1456          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: sev (gene:FBgn0003366 transcript:FBtr0073393)

HSP 1 Score: 220.32 bits (560), Expect = 6.196e-57
Identity = 113/287 (39.37%), Postives = 168/287 (58.54%), Query Frame = 1
Query: 4435 IPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKN---KRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRF 5286
            +P I    L     +G+GAFG V++G +  E D++  Q+     +R G S   E   +EA L+  + H NIV L+G+ FD  +   LI+E+ME G+L  YL+  R    ++              + L   +L+++  D+     +LE+ +FVHRD+A RNCLV+    +   +R  K+GDFGLARDIY  +YYRK  E  +P+RWM+PE++ DG+F+ +SDVW+FGVLCWEI+T G  PY  + N EVL  V +G +L +P  C   +Y ++L CW+  P  RP F
Sbjct: 2201 LPQINWSQLKLLRFLGSGAFGEVYEGQLKTE-DSEEPQRVAIKSLRKGASEFAE-LLQEAQLMSNFKHENIVCLVGICFDT-ESISLIMEHMEAGDLLSYLRAARATSTQEP----------QPTAGLSLSELLAMCIDVANGCSYLEDMHFVHRDLACRNCLVTESTGSTDRRRTVKIGDFGLARDIYKSDYYRKEGEGLLPVRWMSPESLVDGLFTTQSDVWAFGVLCWEILTLGQQPYAARNNFEVLAHVKEGGRLQQPPMCTEKLYSLLLLCWRTDPWERPSF 2474          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: Ror (gene:FBgn0010407 transcript:FBtr0079978)

HSP 1 Score: 199.519 bits (506), Expect = 8.375e-53
Identity = 106/288 (36.81%), Postives = 159/288 (55.21%), Query Frame = 1
Query: 4432 KIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +I H   + + +   +G GAFG V+KG +   +    +    ALK  N    +++DFKRE  L+    H NIV +LGV  +  +  C++ EYM  G+L ++L  + P                 E   L   + + IA  I E +++L   ++VHRD+AARNCLV+       + K+ DFGL+RDIY  +YYR  S++ +P+RWM  E+I  G F+ +SDVWSFGV+ WEI ++G  PY G +N EV+  +   + L  PE CP  VY +M++CW      RP F +I
Sbjct:  401 RINHFTLQDVEFLEELGEGAFGKVYKGQLLQPNKTTITVAIKALK-ENASVKTQQDFKREIELISDLKHQNIVCILGVVLN-KEPYCMLFEYMANGDLHEFLISNSP----------------TEGKSLSQLEFLQIALQISEGMQYLSAHHYVHRDLAARNCLVN----EGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQLLSAPENCPTAVYSLMIECWHEQSVKRPTFTDI 666          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: InR (gene:FBgn0283499 transcript:FBtr0290232)

HSP 1 Score: 204.912 bits (520), Expect = 2.249e-52
Identity = 106/278 (38.13%), Postives = 169/278 (60.79%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQ--CLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLI-SIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G G+FGMV++G +     N   ++  A+K  N  +   E  +F  EA ++ ++   ++V LLGV   C   Q   +++E M+KG+L+ YL+ HRP+   + +     +  +  N    T   I  +A +I + + +L  K FVHRD+AARNC+V+    +    K+GDFG+ RDIY  +YYRK ++  +P+RWM PE+++DG++S  SDV+SFGV+ WE+ T  A PY G +N +VL+ VIDG  + RPE CP  ++++M +CW +    RP FL+I
Sbjct: 1377 LGQGSFGMVYEGILKSFPPNGVDRE-CAIKTVNENATDRERTNFLSEASVMKEFDTYHVVRLLGV---CSRGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVA----DDLTVKIGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPENCPDFLHKLMQRCWHHRSSARPSFLDI 1646          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: ros1 (c-ros oncogene 1 , receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-020506-1])

HSP 1 Score: 223.402 bits (568), Expect = 3.090e-58
Identity = 129/345 (37.39%), Postives = 190/345 (55.07%), Query Frame = 1
Query: 4270 MYIHHRKTKRNNKLIKSNIIVDAQTFELMNVNQGIKYEINSLYGFEKLP-LTNFDKIPHILNECLNYSHLIGNGAFGMVFKG-TMTVESDNKTSQKPVALKI--RNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSI--HNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRF 5286
            ++  H K K + K  + + +      EL  V   +  E N  +     P     + +P    +CL    L+G+GAFG V++G T+  + +    ++ VA+K   ++     + +F +EA L+ ++ HPNI+ LLGV     +   LILE ME G+LR YL+  RP        NN  + L   + +  + D  +          +LE  +FVHRDIAARNCLVS+  +   +R+ K+GDFGLARD+Y ++YYRK  E  +P+RWM+PE++ DGIF+  SDVW+FGVL WEI+T G  PY   TN EVL  +  G +L  P  CP  +Y +M+ CW   P  RP F
Sbjct:  875 IWQRHHKKKDHGKAKQPSSVQIHPDVELEYVRGLVGLE-NGCFAISNTPSRAEIESLPVFPRDCLKLQRLLGSGAFGEVYEGVTVGSQINGVEPERKVAIKTLQKDASDYEKTEFLKEAHLMSQFNHPNILRLLGVCL-LNEPHYLILELMEGGDLRSYLRGARP-------TNNHKELLSLSSLLDISLDAAT-------GCAYLERMHFVHRDIAARNCLVSVRTYTDPERVVKIGDFGLARDVYKNDYYRKKGEGLLPVRWMSPESLTDGIFNKYSDVWAFGVLLWEILTLGKLPYPTYTNHEVLSYISTGGRLSSPAGCPQRLYNLMMSCWSKQPADRPNF 1203          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: alk (ALK receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-031027-1])

HSP 1 Score: 214.927 bits (546), Expect = 4.316e-58
Identity = 117/309 (37.86%), Postives = 179/309 (57.93%), Query Frame = 1
Query: 4378 YEINSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEED---FKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            Y  N  +G +   + +  ++P      ++ +  +G+GAFG V++G + V    + S   VA+K    +  SE+D   F  EA+++ K+ H NIV  +GVS        ++LE M  G+L+ +L+  RP     +L++ S+  ++         DL++IA DI    ++LEE  F+HRDIAARNCL++      R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +GIF+ K+D WSFGVL WEI + G  PY  ++N EVL+ V +G ++  P+ CP  VY +M Q W++ PE RP F  I
Sbjct:   35 YNPNYCFGGKTASVNDLKEVPR---RNISLTRGLGHGAFGEVYEG-LAVGIPGEPSPMQVAVKTLP-EVCSEQDELDFLMEALIISKFSHQNIVRCIGVSLQA-LPHFILLELMAGGDLKSFLRETRP-----RLEHPSSLTMV---------DLLNIARDIARGCQYLEENQFIHRDIAARNCLLTCKGPG-RVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSRSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQSWQHQPEDRPNFSTI 322          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: alk (ALK receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-031027-1])

HSP 1 Score: 214.927 bits (546), Expect = 8.607e-56
Identity = 117/309 (37.86%), Postives = 179/309 (57.93%), Query Frame = 1
Query: 4378 YEINSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEED---FKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            Y  N  +G +   + +  ++P      ++ +  +G+GAFG V++G + V    + S   VA+K    +  SE+D   F  EA+++ K+ H NIV  +GVS        ++LE M  G+L+ +L+  RP     +L++ S+  ++         DL++IA DI    ++LEE  F+HRDIAARNCL++      R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +GIF+ K+D WSFGVL WEI + G  PY  ++N EVL+ V +G ++  P+ CP  VY +M Q W++ PE RP F  I
Sbjct:  565 YNPNYCFGGKTASVNDLKEVPR---RNISLTRGLGHGAFGEVYEG-LAVGIPGEPSPMQVAVKTLP-EVCSEQDELDFLMEALIISKFSHQNIVRCIGVSLQA-LPHFILLELMAGGDLKSFLRETRP-----RLEHPSSLTMV---------DLLNIARDIARGCQYLEENQFIHRDIAARNCLLTCKGPG-RVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSRSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQSWQHQPEDRPNFSTI 852          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: ltk (leukocyte receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-030616-115])

HSP 1 Score: 207.994 bits (528), Expect = 2.727e-53
Identity = 119/338 (35.21%), Postives = 186/338 (55.03%), Query Frame = 1
Query: 4294 KRNNKLIKSNIIVDAQTFELMNVNQG-IKYEINSLYGF--EKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKG-TMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            ++ N L    I + +  ++L  +    I  + N  YG+  +   L+   ++P    + +     +G+GAFG V++G  + +  +N   Q  +           E DF  EA+++ K+ H NIV  +GVS     +  ++LE M  G+++ +L+ +RP                N +S L   +L+ +A DI    ++LEE +F+HRDIAARNCL++    + R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +GIF+ K+D WSFGVL WEI + G  PY  +TN EVL+ V  G ++  P++CP  VY +M QCW++ PE RP F  I
Sbjct:  854 RKKNHLHAVRIRLQSPEYKLSKIRSSTIMTDYNPNYGYFGKAASLSELKEVP---RKNITLLRALGHGAFGEVYEGQVLGMNGENTAMQVAIKTLPEICSEQDEMDFLMEALIMSKFSHQNIVRCIGVSLQILPRF-ILLELMTGGDMKSFLRLNRPRT--------------NHSSSLSMLELLHMARDIALGCRYLEENHFIHRDIAARNCLLTCPGPD-RVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFLEGIFTCKTDTWSFGVLLWEIFSLGYMPYPCKTNQEVLEFVTGGGRMDPPKSCPGPVYRIMTQCWQHCPEHRPNFTTI 1172          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: ltk (leukocyte receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-030616-115])

HSP 1 Score: 207.994 bits (528), Expect = 2.783e-53
Identity = 119/338 (35.21%), Postives = 186/338 (55.03%), Query Frame = 1
Query: 4294 KRNNKLIKSNIIVDAQTFELMNVNQG-IKYEINSLYGF--EKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKG-TMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            ++ N L    I + +  ++L  +    I  + N  YG+  +   L+   ++P    + +     +G+GAFG V++G  + +  +N   Q  +           E DF  EA+++ K+ H NIV  +GVS     +  ++LE M  G+++ +L+ +RP                N +S L   +L+ +A DI    ++LEE +F+HRDIAARNCL++    + R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +GIF+ K+D WSFGVL WEI + G  PY  +TN EVL+ V  G ++  P++CP  VY +M QCW++ PE RP F  I
Sbjct:  880 RKKNHLHAVRIRLQSPEYKLSKIRSSTIMTDYNPNYGYFGKAASLSELKEVP---RKNITLLRALGHGAFGEVYEGQVLGMNGENTAMQVAIKTLPEICSEQDEMDFLMEALIMSKFSHQNIVRCIGVSLQILPRF-ILLELMTGGDMKSFLRLNRPRT--------------NHSSSLSMLELLHMARDIALGCRYLEENHFIHRDIAARNCLLTCPGPD-RVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFLEGIFTCKTDTWSFGVLLWEIFSLGYMPYPCKTNQEVLEFVTGGGRMDPPKSCPGPVYRIMTQCWQHCPEHRPNFTTI 1198          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: ncapd3 (non-SMC condensin II complex subunit D3 [Source:Xenbase;Acc:XB-GENE-990932])

HSP 1 Score: 244.202 bits (622), Expect = 3.963e-64
Identity = 156/455 (34.29%), Postives = 232/455 (50.99%), Query Frame = 1
Query: 3943 HNRIMWKP-GKTNGDNILDYKIKMNFQNHLQKFNSIKNTYFDIAKSNQTGTISVEARNIVGFSLPSYLSLKLTDTRKQISHYYLHSTMTFXXXXXXXXXXXXXXXXXXXXMYIHHRKTKRNNKLIKSNIIVDAQTFELMNVNQGIKYEINSLYGFEKLPLTNF-DKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKI--RNGKSISEEDFKREAVLLFKYGHPNIVILLGVS-FDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSI--HNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRF 5286
             N I W P  + NG NI+ Y ++ +  N  Q+F    N  F     N  GT    A    G  L  Y     ++T + I  + L   ++                    ++Y   ++  +  +     I+ D +  +L  ++  +    N  Y    LP     +K+P+   E L     +G+GAFG V++G        +T  K VA+K   R+     + +F +EA L+ ++ HPNI+ LLGV  F+ P  Q +ILE M+ G+L  YL+  R                  +N +L T DL+ I+ +I     +LE+ +FVHRD+AARNCLVS+  +N   RI K+GDFGLARDIY  +YYRK  E  +P+RWMAPE++ DGIF+ +SDVWSFG++ WE+ T G  PY G +N EVL  V  G+++  P  CP DV+ ++ +CW   P  RP F
Sbjct: 1476 QNIIQWMPVEEDNGSNIIYYILEYSSNNCNQEFAITCNESFTALWRN-FGTFEFRAAAANGIGLGEY-----SNTSESIIFFKLSVCIS-------------------TALYWMSKQKSQKKETTAVAILEDKELMKLRRLSDAVGLA-NGCYAVSILPTQKEKEKLPNFPREKLTLCVFLGSGAFGEVYEGAAIDILGPETGIKKVAVKTLKRDATDHEKTEFLKEAHLMSQFDHPNILKLLGVCLFNEP--QYIILELMDGGDLLTYLRGAR-----------------TQNPLLSTLDLLDISENISRGCAYLEKMHFVHRDLAARNCLVSVKEYNNPSRIVKIGDFGLARDIYKCDYYRKNGEGLLPVRWMAPESLIDGIFTCRSDVWSFGIVLWEVFTMGQQPYPGFSNLEVLHHVQSGQRMCSPTNCPDDVWSLIQKCWAQDPWKRPAF 1885          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: ENSXETT00000011701.1 (leukocyte receptor tyrosine kinase [Source:NCBI gene;Acc:100498306])

HSP 1 Score: 227.254 bits (578), Expect = 2.023e-63
Identity = 124/347 (35.73%), Postives = 194/347 (55.91%), Query Frame = 1
Query: 4276 IHHRKTKRNNKLIKSNIIVDAQTFELMNVNQGI---KYEINSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE----DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            ++HRK K   +L  + + + +  ++L  +   I    Y  N  +  +   L+   ++P    + +     +G+GAFG V++G +   S +     P+ + I+    I  E    DF  EA+++ K+ H NIV  +GVS     +  ++LE M  G+++ +L+ +RP               IN+ S L   DL+++A DI    K+LEE +F+HRDIAARNCL++ ++   R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +G+F+ K+D WSFGVL WEI + G  PY  +TN EVL+ V  G ++  P+ CP  VY +M QCW++ PE RP F  I
Sbjct:   10 VYHRKKK---QLEGARVRLQSTEYKLSKIRSSIIMTDYNPNYCFAGKGASLSELKEVPR---KNITLLRALGHGAFGEVYEGMVVGISGDP---NPLQVAIKTLPEICSEQDEMDFLMEALIISKFSHQNIVRCIGVSLQTLPR-FILLELMSGGDMKSFLRQNRP--------------WINQPSTLSMLDLLNMARDIACGCKYLEENHFIHRDIAARNCLLT-YSGTGRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFLEGVFTSKTDTWSFGVLLWEIFSLGYMPYPCKTNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHTPEHRPNFSTI 331          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: ENSXETT00000028153.1 (leukocyte receptor tyrosine kinase [Source:NCBI gene;Acc:100498306])

HSP 1 Score: 227.639 bits (579), Expect = 2.735e-63
Identity = 125/347 (36.02%), Postives = 194/347 (55.91%), Query Frame = 1
Query: 4276 IHHRKTKRNNKLIKSNIIVDAQTFELMNVNQGI---KYEINSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE----DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            I+HRK K   +L  + + + +  ++L  +   I    Y  N  +  +   L+   ++P    + +     +G+GAFG V++G +   S +     P+ + I+    I  E    DF  EA+++ K+ H NIV  +GVS     +  ++LE M  G+++ +L+ +RP               IN+ S L   DL+++A DI    K+LEE +F+HRDIAARNCL++ ++   R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +G+F+ K+D WSFGVL WEI + G  PY  +TN EVL+ V  G ++  P+ CP  VY +M QCW++ PE RP F  I
Sbjct:   27 IYHRKKK---QLEGARVRLQSTEYKLSKIRSSIIMTDYNPNYCFAGKGASLSELKEVPR---KNITLLRALGHGAFGEVYEGMVVGISGDP---NPLQVAIKTLPEICSEQDEMDFLMEALIISKFSHQNIVRCIGVSLQTLPR-FILLELMSGGDMKSFLRQNRP--------------WINQPSTLSMLDLLNMARDIACGCKYLEENHFIHRDIAARNCLLT-YSGTGRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFLEGVFTSKTDTWSFGVLLWEIFSLGYMPYPCKTNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHTPEHRPNFSTI 348          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: ncapd3 (non-SMC condensin II complex subunit D3 [Source:Xenbase;Acc:XB-GENE-990932])

HSP 1 Score: 239.965 bits (611), Expect = 8.646e-63
Identity = 134/345 (38.84%), Postives = 196/345 (56.81%), Query Frame = 1
Query: 4270 MYIHHRKTKRNNKLIKSNIIVDAQTFELMNVNQGIKYEINSLYGFEKLPLT-NFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKI--RNGKSISEEDFKREAVLLFKYGHPNIVILLGVS-FDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSI--HNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRF 5286
            +Y   ++  +  +     I+ D +  +L  ++  +    N  Y    LP     +K+P+   E L     +G+GAFG V++G        +T  K VA+K   R+     + +F +EA L+ ++ HPNI+ LLGV  F+ P  Q +ILE M+ G+L  YL+  R D   Q             N +L T DL+ I+ +I     +LE+ +FVHRD+AARNCLVS+  +N   RI K+GDFGLARDIY  +YYRK  E  +P+RWMAPE++ DGIF+ +SDVWSFG++ WE+ T G  PY G +N EVL  V  G+++  P  CP DV+ ++ +CW   P  RP F
Sbjct: 1604 LYWMSKQKSQKKETTAVAILEDKELMKLRRLSDAVGLA-NGCYAVSILPTQKEKEKLPNFPREKLTLCVFLGSGAFGEVYEGAAIDILGPETGIKKVAVKTLKRDATDHEKTEFLKEAHLMSQFDHPNILKLLGVCLFNEP--QYIILELMDGGDLLTYLRGARVDSFTQ-------------NPLLSTLDLLDISENISRGCAYLEKMHFVHRDLAARNCLVSVKEYNNPSRIVKIGDFGLARDIYKCDYYRKNGEGLLPVRWMAPESLIDGIFTCRSDVWSFGIVLWEVFTMGQQPYPGFSNLEVLHHVQSGQRMCSPTNCPDDVWSLIQKCWAQDPWKRPAF 1932          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: ENSXETT00000028190.1 (leukocyte receptor tyrosine kinase [Source:NCBI gene;Acc:100498306])

HSP 1 Score: 225.713 bits (574), Expect = 8.679e-63
Identity = 124/346 (35.84%), Postives = 193/346 (55.78%), Query Frame = 1
Query: 4279 HHRKTKRNNKLIKSNIIVDAQTFELMNVNQGI---KYEINSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE----DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +HRK K   +L  + + + +  ++L  +   I    Y  N  +  +   L+   ++P    + +     +G+GAFG V++G +   S +     P+ + I+    I  E    DF  EA+++ K+ H NIV  +GVS     +  ++LE M  G+++ +L+ +RP               IN+ S L   DL+++A DI    K+LEE +F+HRDIAARNCL++ ++   R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +G+F+ K+D WSFGVL WEI + G  PY  +TN EVL+ V  G ++  P+ CP  VY +M QCW++ PE RP F  I
Sbjct:   16 YHRKKK---QLEGARVRLQSTEYKLSKIRSSIIMTDYNPNYCFAGKGASLSELKEVPR---KNITLLRALGHGAFGEVYEGMVVGISGDP---NPLQVAIKTLPEICSEQDEMDFLMEALIISKFSHQNIVRCIGVSLQTLPR-FILLELMSGGDMKSFLRQNRP--------------WINQPSTLSMLDLLNMARDIACGCKYLEENHFIHRDIAARNCLLT-YSGTGRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFLEGVFTSKTDTWSFGVLLWEIFSLGYMPYPCKTNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHTPEHRPNFSTI 336          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Ltk (leukocyte tyrosine kinase [Source:MGI Symbol;Acc:MGI:96840])

HSP 1 Score: 225.328 bits (573), Expect = 3.061e-63
Identity = 116/281 (41.28%), Postives = 167/281 (59.43%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRN--GKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQY 5313
            +G+GAFG V++G +T    + +S  PVA+K          E DF  EA+++ K+ H NIV  +G+SF     + ++LE M  G+++ +L+H RP                 + + L  +DL+ +A DI +   +LEE +F+HRDIAARNCL+S    + R+ K+GDFG+ARDIY   YYRK   T +P++WM PE + +G+F+ K+D WSFGVL WEI + G  PY G TN EVL  +  G ++  P  CP  VY +M QCW++ PE RP F  I    QY
Sbjct:  100 LGHGAFGEVYEGLVTGLPGD-SSPLPVAIKTLPELCSHQDELDFLMEALIISKFSHQNIVRCVGLSFRS-APRLILLELMSGGDMKSFLRHSRPHP--------------GQLAPLTMQDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCSGAS-RVAKIGDFGMARDIYQASYYRKGGRTLLPVKWMPPEALLEGLFTSKTDSWSFGVLLWEIFSLGYMPYPGHTNQEVLDFIATGNRMDPPRNCPGPVYRIMTQCWQHQPELRPDFGSILERIQY 363          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Ltk (leukocyte tyrosine kinase [Source:MGI Symbol;Acc:MGI:96840])

HSP 1 Score: 224.942 bits (572), Expect = 5.694e-62
Identity = 116/281 (41.28%), Postives = 167/281 (59.43%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRN--GKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQY 5313
            +G+GAFG V++G +T    + +S  PVA+K          E DF  EA+++ K+ H NIV  +G+SF     + ++LE M  G+++ +L+H RP                 + + L  +DL+ +A DI +   +LEE +F+HRDIAARNCL+S    + R+ K+GDFG+ARDIY   YYRK   T +P++WM PE + +G+F+ K+D WSFGVL WEI + G  PY G TN EVL  +  G ++  P  CP  VY +M QCW++ PE RP F  I    QY
Sbjct:  200 LGHGAFGEVYEGLVTGLPGD-SSPLPVAIKTLPELCSHQDELDFLMEALIISKFSHQNIVRCVGLSFRS-APRLILLELMSGGDMKSFLRHSRPHP--------------GQLAPLTMQDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCSGAS-RVAKIGDFGMARDIYQASYYRKGGRTLLPVKWMPPEALLEGLFTSKTDSWSFGVLLWEIFSLGYMPYPGHTNQEVLDFIATGNRMDPPRNCPGPVYRIMTQCWQHQPELRPDFGSILERIQY 463          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Ltk (leukocyte tyrosine kinase [Source:MGI Symbol;Acc:MGI:96840])

HSP 1 Score: 225.328 bits (573), Expect = 2.537e-60
Identity = 116/281 (41.28%), Postives = 167/281 (59.43%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRN--GKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQY 5313
            +G+GAFG V++G +T    + +S  PVA+K          E DF  EA+++ K+ H NIV  +G+SF     + ++LE M  G+++ +L+H RP                 + + L  +DL+ +A DI +   +LEE +F+HRDIAARNCL+S    + R+ K+GDFG+ARDIY   YYRK   T +P++WM PE + +G+F+ K+D WSFGVL WEI + G  PY G TN EVL  +  G ++  P  CP  VY +M QCW++ PE RP F  I    QY
Sbjct:  451 LGHGAFGEVYEGLVTGLPGD-SSPLPVAIKTLPELCSHQDELDFLMEALIISKFSHQNIVRCVGLSFRS-APRLILLELMSGGDMKSFLRHSRPHP--------------GQLAPLTMQDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCSGAS-RVAKIGDFGMARDIYQASYYRKGGRTLLPVKWMPPEALLEGLFTSKTDSWSFGVLLWEIFSLGYMPYPGHTNQEVLDFIATGNRMDPPRNCPGPVYRIMTQCWQHQPELRPDFGSILERIQY 714          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Ltk (leukocyte tyrosine kinase [Source:MGI Symbol;Acc:MGI:96840])

HSP 1 Score: 225.328 bits (573), Expect = 5.252e-60
Identity = 116/281 (41.28%), Postives = 167/281 (59.43%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRN--GKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQY 5313
            +G+GAFG V++G +T    + +S  PVA+K          E DF  EA+++ K+ H NIV  +G+SF    +  ++LE M  G+++ +L+H RP                 + + L  +DL+ +A DI +   +LEE +F+HRDIAARNCL+S    + R+ K+GDFG+ARDIY   YYRK   T +P++WM PE + +G+F+ K+D WSFGVL WEI + G  PY G TN EVL  +  G ++  P  CP  VY +M QCW++ PE RP F  I    QY
Sbjct:  512 LGHGAFGEVYEGLVTGLPGD-SSPLPVAIKTLPELCSHQDELDFLMEALIISKFSHQNIVRCVGLSFRSAPR-LILLELMSGGDMKSFLRHSRPHP--------------GQLAPLTMQDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCSGAS-RVAKIGDFGMARDIYQASYYRKGGRTLLPVKWMPPEALLEGLFTSKTDSWSFGVLLWEIFSLGYMPYPGHTNQEVLDFIATGNRMDPPRNCPGPVYRIMTQCWQHQPELRPDFGSILERIQY 775          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Ros1 (Ros1 proto-oncogene [Source:MGI Symbol;Acc:MGI:97999])

HSP 1 Score: 226.098 bits (575), Expect = 1.206e-58
Identity = 163/526 (30.99%), Postives = 251/526 (47.72%), Query Frame = 1
Query: 3787 INDLHPGIFYQFIFTFNFTMSKLQGIVTCQCFSKDDVPDSPVNVSILRQNFTHNRIMWKPGKTNGDNILDYKIKM------NFQNHLQK----FNSIKNTYFDIAKSNQTGTISVEA--RNIVGFSLPSYLSLKLTDTRKQISHYYLHSTMTFXXXXXXXXXXXXXXXXXXXXMYIHHRKTKRNNKLIKSNIIVDAQTFELMNVNQGIKYEINSLYGFEKLPLTN-FDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHN-KNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYF 5316
            I DL P   Y       +T  +    +     +K  VP  P    +L    + N I W+  + NG  ++ Y +++      + QN   +    FN   ++       N  GT    A   N +G    S +S  +T     +  +   ++   +  + + +V       +       H+ +K    ++  N   D +  EL  +  G+    N+ Y    +P     + +P    E L+   L+G+GAFG V++GT        + +  VA+K     S  +E  +F +EA L+ K+ HPNI+  LGV     + Q +ILE ME G+L  YL+  R                      L   DL+ +  DI +   +LE+ +F+HRD+AARNCLVS+ +  + R+ K+GDFGLAR+IY ++YYRK  E  +P+RWMAPE + DGIF+ +SDVWSFG+L WEI+T G  PY   +N +VL  V  G +L  P  CP D++ +M QCW   P+ RP F  I    Q F
Sbjct: 1709 ITDLQPYTSYNIRVVVVYTTGENSSSIPESFKTKAGVPSKPGIPKLLEG--SKNSIQWEKAEDNGSRLMYYTLEVRKGISNDSQNQSSRWKVVFNGSCSSICTWRSKNLKGTFQFRAVAANEIGLGEYSEISEDITLVEDGV--WITETSFILTIIVGIFLVATVPLTFVWHRSLKSHKASKEGLSVLNDN---DKELAELRGLAAGVGLA-NACYAVHTVPTQEEIENLPAFPREKLSLRLLLGSGAFGEVYEGTAIDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCL-LGEPQYIILELMEGGDLLSYLRKARGTTFH--------------GPSLTLLDLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSPRVVKIGDFGLAREIYKNDYYRKRGEGLLPVRWMAPENLMDGIFTSQSDVWSFGILVWEILTLGHQPYPAHSNLDVLNYVQAGGRLEPPRNCPDDLWNLMSQCWAQEPDQRPTFHNIQNQLQLF 2211          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|P00529|ROS_AVISU (Tyrosine-protein kinase transforming protein ros OS=UR2 sarcoma virus OX=354090 GN=V-ROS PE=3 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.461e-64
Identity = 136/371 (36.66%), Postives = 202/371 (54.45%), Query Frame = 1
Query: 4273 YIHHRKTKRNNKLIKSNIIVDAQTFELMNVNQGIKYEI---NSLYGFEKLP-LTNFDKIPHILNECLNYSHLIGNGAFGMVFKGT-MTVESDNKTSQKPVALKIRNGKSISEE-DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVS--IHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEID----------LIFQYFDGPRD 5331
            ++ H++ K         I++  +  EL  + +G+   +   N+ Y    LP     + +P    + LN   L+G+GAFG V++GT + + +D     +     ++ G +  E+ +F +EA L+ K+ HP+I+ LLGV     + Q LILE ME G+L  YL+  R    +QK ++                DL+ I  DI +   +LE+  F+HRD+AARNCLVS   +    R+ K+GDFGLARDIY ++YYRK  E  +P+RWMAPE++ DG+F+  SDVW+FGVL WE +T G  PY G +N EVL  V  G +L  P  CP D+ ++M +CW   P  RP F  I           L F YF G ++
Sbjct:   33 FVWHQRWKSRKPASTGQIVLVKEDKELAQL-RGMAETVGLANACYAVSTLPSQAEIESLPAFPRDKLNLHKLLGSGAFGEVYEGTALDILADGSGESRVAVKTLKRGATDQEKSEFLKEAHLMSKFDHPHILKLLGVCL-LNEPQYLILELMEGGDLLSYLRGAR----KQKFQSPLLT----------LTDLLDICLDICKGCVYLEKMRFIHRDLAARNCLVSEKQYGSCSRVVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLIDGVFTNHSDVWAFGVLVWETLTLGQQPYPGLSNIEVLHHVRSGGRLESPNNCPDDIRDLMTRCWAQDPHNRPTFFYIQHKLQEIRHSPLCFSYFLGDKE 387          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|Q63132|ROS1_RAT (Proto-oncogene tyrosine-protein kinase ROS OS=Rattus norvegicus OX=10116 GN=Ros1 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 7.446e-60
Identity = 137/356 (38.48%), Postives = 196/356 (55.06%), Query Frame = 1
Query: 4273 YIHHRKTKRNNKLIKSNIIV----DAQTFELMNVNQGIKYEINSLYGFEKLPLTN-FDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHN-KNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYF 5316
            ++ HR  K N+K  K  + V    D +  EL  +  G+    N+ Y    LP     + +P    E L+   L+G+GAFG V++GT        + +  VA+K     S  +E  +F +EA L+ K+ HPNI+  LGV     + Q +ILE ME G+L  YL+  R   +   L              L   DL+ +  DI +   +LE+ +F+HRD+AARNCLVS+ +  + R+ K+GDFGLAR+IY  +YYRK  E  +P+RWMAPE + DGIF+ +SDVWSFG+L WEI+T G  PY   +N +VL  V  G +L  P  CP D++ +M +CW   P+ RP F  I    Q F
Sbjct: 1872 FVWHRSLK-NHKATKEGLSVLNDNDQELAELRGLAAGVGLA-NACYAVHTLPTQEEIESLPAFPREKLSLRLLLGSGAFGEVYEGTAVDILGRGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCL-LSEPQYIILELMEGGDLLSYLRKARGTTLSGPL--------------LTLADLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSPRVVKIGDFGLAREIYKHDYYRKRGEGLLPVRWMAPENLMDGIFTSQSDVWSFGILVWEILTLGHQPYPAHSNLDVLNYVQAGGRLEPPRNCPDDLWNLMFRCWAQEPDQRPTFYNIQDQLQLF 2210          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|P08922|ROS1_HUMAN (Proto-oncogene tyrosine-protein kinase ROS OS=Homo sapiens OX=9606 GN=ROS1 PE=1 SV=3)

HSP 1 Score: 231.491 bits (589), Expect = 2.010e-59
Identity = 137/356 (38.48%), Postives = 191/356 (53.65%), Query Frame = 1
Query: 4273 YIHHRKTKRNNKLIKSNIIV----DAQTFELMNVNQGIKYEINSLYGFEKLPLTN-FDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHN-KNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYF 5316
            ++ HR+ K N K  K  + V    D +  EL  +  G+    N+ Y    LP     + +P    E L    L+G+GAFG V++GT        + +  VA+K     S  +E  +F +EA L+ K+ HPNI+  LGV     + Q +ILE ME G+L  YL+  R       L                      +  DI +   +LE  +F+HRD+AARNCLVS+ +  + RI K+GDFGLARDIY ++YYRK  E  +P+RWMAPE++ DGIF+ +SDVWSFG+L WEI+T G  PY   +N +VL  V  G +L  P  CP D++ +M QCW   P+ RP F  I    Q F
Sbjct: 1880 FVWHRRLK-NQKSAKEGVTVLINEDKELAELRGLAAGVGLA-NACYAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCL-LNEPQYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLV--------------DLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLF 2218          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|P08923|LTK_MOUSE (Leukocyte tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Ltk PE=1 SV=3)

HSP 1 Score: 225.328 bits (573), Expect = 3.673e-59
Identity = 116/281 (41.28%), Postives = 167/281 (59.43%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRN--GKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQY 5313
            +G+GAFG V++G +T    + +S  PVA+K          E DF  EA+++ K+ H NIV  +G+SF    +  ++LE M  G+++ +L+H RP                 + + L  +DL+ +A DI +   +LEE +F+HRDIAARNCL+S    + R+ K+GDFG+ARDIY   YYRK   T +P++WM PE + +G+F+ K+D WSFGVL WEI + G  PY G TN EVL  +  G ++  P  CP  VY +M QCW++ PE RP F  I    QY
Sbjct:  512 LGHGAFGEVYEGLVTGLPGD-SSPLPVAIKTLPELCSHQDELDFLMEALIISKFSHQNIVRCVGLSFRSAPR-LILLELMSGGDMKSFLRHSRPHP--------------GQLAPLTMQDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCSGAS-RVAKIGDFGMARDIYQASYYRKGGRTLLPVKWMPPEALLEGLFTSKTDSWSFGVLLWEIFSLGYMPYPGHTNQEVLDFIATGNRMDPPRNCPGPVYRIMTQCWQHQPELRPDFGSILERIQY 775          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|P20806|7LESS_DROVI (Protein sevenless OS=Drosophila virilis OX=7244 GN=sev PE=3 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 7.514e-59
Identity = 123/286 (43.01%), Postives = 169/286 (59.09%), Query Frame = 1
Query: 4435 IPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNK--NKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRF 5286
            +P I    L     +G+GAFG V++G +  E D    Q+     +R G S   E   +EA L+  + H NIV L+G+  D  D   LI+E+ME G+L  YL+  RP         +S + L    S L   +L+S+  D+     ++E+ +FVHRD+A RNCLVS       +RI K+GDFGLARDIY  +YYRK  E  +P+RWMA E++ DG+FS +SDVW+FGVLCWEI T G  PY  + N EVL  V +G +L +PE CP  +Y ++LQCW+  P  RP F
Sbjct: 2216 LPQINWNRLTLLRFLGSGAFGEVYEGQLQAE-DEAQPQRVAIKSLRKGASEFAE-LLQEAQLMSNFKHENIVCLIGICCDT-DSISLIMEHMEAGDLLSYLRAARP---------SSQEAL----SKLQLPELLSMCLDVANGCSYMEDMHFVHRDLACRNCLVSDGAAIGGRRIVKIGDFGLARDIYKSDYYRKEGEGLLPVRWMALESLVDGLFSTQSDVWAFGVLCWEIFTLGQQPYAARNNFEVLAHVKEGGRLQQPERCPEKLYALLLQCWRSEPWERPSF 2485          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A4S2MCM5 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001009 PE=3 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 3.573e-85
Identity = 160/377 (42.44%), Postives = 219/377 (58.09%), Query Frame = 1
Query: 4309 LIKSNIIVDAQTFELMNVNQGIKYEINSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVI------------RQKLKNNSTKRLINENS---------------------------------ILDTKDLISIAS---DILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            L  S I +D  T E M  NQ    E+NSLYG  K  L +F+++  I    + +   +G GAFG V++G + V + +    + VALK+RN KS+SE +FKREA L+ +Y H NIV   GVSFD P +QCL+LE M++GNLR YL   RP +                  +N+T       S                                 ++   DL ++ S   DI +  ++LEE++FVHRDIAARNCLVS ++ + RI KL DFGLARDIY ++ YRK +E K+P+RWM+PE I+DG+F+ KSDVW+F V CWE+MT GADP+ G+ N +V+  VI G  LGRPE CP ++Y  MLQCW  + E RP F ++
Sbjct:   18 LTTSGIPLDLSTLEPM-WNQ----EVNSLYGIGKSDLLSFEQVTQISAAHIRFERYVGCGAFGKVWEGWLHVNASDGDRFEKVALKVRNSKSLSEAEFKREATLMHRYQHANIVRFFGVSFDSPGQQCLVLEMMDQGNLRDYLHRARPRIAPHVAANMFAAAAICAAGSNATDLPTAAGSEGSSMNTSTTSTAAAGGGNAGGGAFSTNSNVITLIAQLDLAALVSIMRDIAQGCRYLEEQHFVHRDIAARNCLVSHNHPSGRIVKLCDFGLARDIYKNDCYRKRNEPKLPVRWMSPEAIRDGLFTTKSDVWAFAVTCWEVMTLGADPFYGRANVDVMNLVIGGHVLGRPENCPEELYNQMLQCWSRFTEMRPSFADL 389          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A158QCK7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 PE=3 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 1.513e-79
Identity = 150/354 (42.37%), Postives = 216/354 (61.02%), Query Frame = 1
Query: 4351 LMNVNQGIKYEINSLYGF-------EKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKP----VALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNS-------TKRLINE---------------------NSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            L ++      E+NSLYG            L N + IP      L Y   IG GAFG V++G   + S   ++ +     VALK+RN KS+SE +FKREA+L+ +Y H NIV   G+S D P+ QCL+LE M++GNLR+YL   RP +   + ++ S       + RL  +                     +++L   DL+ I  DI +  ++LEE++FVHRDIAARNCLVS ++++ RI KL DFGLARDIY ++YYRK +E K+P+RWM+PE I +G+F+ KSD+W++ V CWE+M+ GADP+ GQ N EV+  +++G  L +P+ CP  +Y+ MLQCW  +PE RP F E+
Sbjct:  247 LSSMEPAWSQEVNSLYGAGVAISGDADEGLFNLNVIPASQLRFLRY---IGCGAFGKVWEGRYLISSSGCSNPEDRFERVALKVRNVKSLSESEFKREAILMQRYQHENIVRFYGISMDSPNHQCLVLEMMDQGNLREYLHRARPRLTPSQAEHFSRQEHTARSDRLSRQTETTEATTGESFCSGAGAVELHALLTIPDLLKIMWDIAKGCQYLEEQHFVHRDIAARNCLVSHNHESGRIVKLCDFGLARDIYKNDYYRKRNEPKLPVRWMSPEAILEGVFTSKSDIWAYAVTCWEVMSLGADPFYGQVNLEVINLILNGNVLSKPDNCPTALYDHMLQCWSRFPEIRPTFAEV 597          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A3P6WQ09 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1632 PE=3 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 1.555e-79
Identity = 150/354 (42.37%), Postives = 216/354 (61.02%), Query Frame = 1
Query: 4351 LMNVNQGIKYEINSLYGF-------EKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKP----VALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNS-------TKRLINE---------------------NSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            L ++      E+NSLYG            L N + IP      L Y   IG GAFG V++G   + S   ++ +     VALK+RN KS+SE +FKREA+L+ +Y H NIV   G+S D P+ QCL+LE M++GNLR+YL   RP +   + ++ S       + RL  +                     +++L   DL+ I  DI +  ++LEE++FVHRDIAARNCLVS ++++ RI KL DFGLARDIY ++YYRK +E K+P+RWM+PE I +G+F+ KSD+W++ V CWE+M+ GADP+ GQ N EV+  +++G  L +P+ CP  +Y+ MLQCW  +PE RP F E+
Sbjct:  247 LSSMEPAWSQEVNSLYGAGVAISGDADEGLFNLNVIPASQLRFLRY---IGCGAFGKVWEGRYLISSSGCSNPEDRFERVALKVRNVKSLSESEFKREAILMQRYQHENIVRFYGISMDSPNHQCLVLEMMDQGNLREYLHRARPRLTPSQAEHFSRQEHTARSDRLSRQTETTEATTGESFCSGAGAVELHALLTIPDLLKIMWDIAKGCQYLEEQHFVHRDIAARNCLVSHNHESGRIVKLCDFGLARDIYKNDYYRKRNEPKLPVRWMSPEAILEGVFTSKSDIWAYAVTCWEVMSLGADPFYGQVNLEVINLILNGNVLSKPDNCPTALYDHMLQCWSRFPEIRPTFAEV 597          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A068WLW2 (Tyrosine protein kinase OS=Echinococcus granulosus OX=6210 GN=EgrG_000641500 PE=3 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 1.066e-78
Identity = 150/344 (43.60%), Postives = 210/344 (61.05%), Query Frame = 1
Query: 4381 EINSLYGF-------EKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKP----VALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVI--------RQKLKNNSTKR--------------------LINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            E+NSLYG            L N + IP      L Y   +G GAFG V++G + V +    + +     VALK+RN KS+SE +F+REA+L+ +Y H NIV   G+S D P+ QCLILE ME+GNLR+YL   RP +         RQ+    S +                      +  +++L   DLI I  DI    ++LEE++FVHRDIAARNCLVS ++++ RI KL DFGLARDIY ++YYRK +E K+P+RWM+PE I +G+F+ KSD+W++ V CWE+M+ GADP+ GQ N EV+  V++G  L +P+ CP  +Y+ MLQCW  +PE RP F ++
Sbjct:  357 EVNSLYGAGVAISGETNEALLNLNLIPASQLRFLRY---VGCGAFGKVWEGRLLVATSGCPNSEGKFERVALKVRNVKSLSEAEFRREALLMQRYQHENIVRFYGISMDSPNHQCLILEMMEQGNLREYLHRSRPRLTPSQAEHLSRQEHTARSDRSSRQTETTEATTGESMCSGLGAVELHAMLTIPDLIRIMRDIARGCRYLEEQHFVHRDIAARNCLVSHNHESGRIVKLCDFGLARDIYKNDYYRKRNEPKLPVRWMSPEAILEGLFTSKSDIWAYAVTCWEVMSLGADPFYGQVNLEVINLVLNGNVLSKPDNCPATLYDHMLQCWSRFPEIRPTFSDV 697          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A068Y2N7 (Tyrosine protein kinase OS=Echinococcus multilocularis OX=6211 PE=3 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 3.409e-77
Identity = 145/341 (42.52%), Postives = 206/341 (60.41%), Query Frame = 1
Query: 4381 EINSLYG----FEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKP----VALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINEN----------------------------SILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            E+NSLYG               +  I    L +   +G GAFG V++G + V +    + +     VALK+RN KS+SE +F+REA+L+ +Y H NIV   G+S D P+ QCLILE ME+GNLR+YL   RP +   + ++ S +     +                            ++L   DLI I  DI    ++LEE++FVHRDIAARNCLVS ++++ RI KL DFGLARDIY ++YYRK +E K+P+RWM+PE I +G+F+ KSD+W++ V CWEIM+ GADP+ GQ N EV+  V++G  L +P+ CP  +Y+ MLQCW  +PE RP F ++
Sbjct:  357 EVNSLYGAGVTISGENNEALLNLNLIPASQLRFLRYVGCGAFGKVWEGRLLVAASGCPNSEDRFERVALKVRNVKSLSEVEFRREALLMQRYQHENIVRFYGISMDSPNHQCLILEMMEQGNLREYLHRSRPRLTPSQAEHLSRQEHTARSDRSSRQTETTEATTGESVCSGLGAFELHAMLTIPDLIRIMRDIARGCRYLEEQHFVHRDIAARNCLVSHNHQSGRIVKLCDFGLARDIYKNDYYRKRNEPKLPVRWMSPEAILEGLFTSKSDIWAYAVTCWEIMSLGADPFYGQVNLEVINLVLNGNVLSKPDNCPAALYDHMLQCWSRFPEIRPTFSDV 697          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: alk (ALK receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-031027-1])

HSP 1 Score: 213.772 bits (543), Expect = 6.679e-59
Identity = 113/276 (40.94%), Postives = 167/276 (60.51%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEED---FKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G+GAFG V++G + V    + S   VA+K    +  SE+D   F  EA+++ K+ H NIV  +GVS      + ++LE M  G+L+ +L+  RP     +L++ S+  ++         DL++IA DI    ++LEE  F+HRDIAARNCL++      R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +GIF+ K+D WSFGVL WEI + G  PY  ++N EVL+ V +G ++  P+ CP  VY +M Q W++ PE RP F  I
Sbjct:   54 LGHGAFGEVYEG-LAVGIPGEPSPMQVAVKTLP-EVCSEQDELDFLMEALIISKFSHQNIVRCIGVSLQA-LPRFILLELMAGGDLKSFLRETRP-----RLEHPSSLTMV---------DLLNIAKDIARGCQYLEENQFIHRDIAARNCLLTCKGPG-RVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSRSNQEVLEFVTNGGRMDPPQNCPGPVYRIMTQSWQHQPEDRPNFSTI 311          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: ENSAMXT00000021554.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:40807788:40819525:1 gene:ENSAMXG00000020937.2 transcript:ENSAMXT00000021554.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.297 bits (521), Expect = 3.078e-57
Identity = 122/305 (40.00%), Postives = 174/305 (57.05%), Query Frame = 1
Query: 4339 QTFELMNVNQGIKYEINSLYGFEKLPL-TNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTV-ESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSI--HNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVY 5235
            Q  EL N+ +G+    N+ Y    LP+    + +P    E L    L+G+GAFG V++G     +S + T  + VA+K     +  +E  +F +EA L+ ++ H NI+ LLGV     +   +ILE ME G+LR YL   RP                N   +LD   L+ I+ D+ +   +LE+ +F+HRD+AARNCLVS+  +   +R+ K+GDFGLARD+Y  +YYRK  E  +P+RWM PE++ DGIF+  SDVW+FGVL WEIMT G  PY   +N EVL  V  G +L  P  CP  +Y
Sbjct:   46 QDKELENI-RGLVGLGNACYAVSALPVHKEVESLPLFRREGLKLLKLLGSGAFGEVYEGVAARGQSGDATPDQRVAVKTLRKHAAEQEKIEFLKEAHLMSQFNHSNILRLLGVCV-LNEPHYIILELMEGGDLRSYLIGARPSN--------------NRGQLLDLTGLLDISLDVAKGCAYLEKLHFIHRDLAARNCLVSVRGYADPERVVKIGDFGLARDVYKSDYYRKRGEGLLPVRWMPPESLTDGIFNKHSDVWAFGVLLWEIMTLGKQPYPAFSNQEVLHHVNVGGRLPAPAECPQSLY 334          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: MUSK (muscle associated receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:7525])

HSP 1 Score: 198.364 bits (503), Expect = 2.537e-52
Identity = 106/291 (36.43%), Postives = 160/291 (54.98%), Query Frame = 1
Query: 4459 LNYSHLIGNGAFGMVFKGTMTVESDNKTSQKP---VALKIRNGKSIS--EEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENS---ILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIF 5307
            + Y   IG GAFG VF+      +      +P   VA+K+   ++ +  + DF+REA L+ ++ HPNIV LLGV        CL+ EYM  G+L ++L+   P   R   + + T +     S    L   + +S++  +   + +L E+ FVHRD+A RNCLV        + K+ DFGL+R+IY  +YY+ +    +PIRWM PE+I    ++ +SDVW++GV+ WEI + G  PY G  + EV+  V DG  L  PE CP+++Y +M  CW  +P  RP F  I  I 
Sbjct:  390 IEYVRDIGEGAFGRVFQA----RAPGLLPHEPFTMVAVKMLKEEASADMQNDFQREAALMAEFDHPNIVRLLGVC-AVGKPMCLMFEYMAHGDLNEFLRRRSPAQQRSLSQGSLTDQSFASESDPTPLSCLEKLSMSKQVAAGMAYLSERKFVHRDLATRNCLVG----EDLVVKIADFGLSRNIYAADYYKASENDAIPIRWMPPESIFYNRYTSESDVWAYGVVLWEIFSHGMQPYYGMAHEEVIYYVRDGHVLACPENCPLELYNLMRLCWSRHPNDRPSFASIHRIL 671          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: ntrk3b (neurotrophic receptor tyrosine kinase 3 [Source:NCBI gene;Acc:103046759])

HSP 1 Score: 199.904 bits (507), Expect = 2.559e-52
Identity = 109/282 (38.65%), Postives = 156/282 (55.32%), Query Frame = 1
Query: 4462 NYSHL----------IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECR 5277
            NYSH+          +G GAFG VF       S  K         +++    + +DF+REA LL    H +IV   GV  D  D   ++ EYM+ G+L ++L+ H PD     L +      +  N  L    ++ +A+ I   + +L  ++FVHRD+A RNCLV     N  + K+GDFG++RDIY  +YYR    T +PIRWM PE+I    FS +SDVWSFGV+ WEI T+G  P+   +N EV++ V  G+ L RP  CP +VY++ML CW+  P+ R
Sbjct:  483 NYSHMNRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKTLKDPTLAARKDFQREAELLTNLQHDHIVKFYGVCVD-SDPLIMVFEYMKHGDLNKFLRAHGPD--GTILVDGHP---MQSNGELGLSQMLHVATQIAAGMVYLSSQHFVHRDLATRNCLVG----NGLLVKIGDFGMSRDIYSMDYYRVGGHTMLPIRWMPPESIMYRKFSTESDVWSFGVILWEIFTYGKQPWFQLSNNEVIEYVTQGRVLDRPRLCPKEVYDLMLGCWQSEPQQR 754          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: igf1ra (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:103037538])

HSP 1 Score: 203.371 bits (516), Expect = 4.700e-52
Identity = 106/275 (38.55%), Postives = 166/275 (60.36%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G G+FGMV++G       ++   K VA+K  N  +   E  +F  EA ++ ++   ++V LLGV         +I+E M +G+L+ YL+      +R K + + ++ L +       K +I +A +I + + +L    FVHRD+AARNC+V+         K+GDFG+ RDIY  +YYRK  +  +P+RWM+PE++KDG+F+  SDVWSFGV+ WEI T    PY G +N +VL+ V++G  L +P+ CP  ++E+M  CW+Y P+ RP FLEI
Sbjct:  998 LGQGSFGMVYEGIAKGVVKDEPETK-VAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQ-GQPTLVIMELMTRGDLKSYLRS-----LRSKQQGSCSQPLPS------LKKMIQMAGEISDGMAYLNANKFVHRDLAARNCMVA----EDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEI 1255          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.83 bits (512), Expect = 7.774e-58
Identity = 109/281 (38.79%), Postives = 165/281 (58.72%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTM--TVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSIL----DTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G G FGMV++G     V+ +++T    VA+K  N  +   E  +F  EA ++  +   ++V LLGV         +I+E M +G+L+ YL+  RPD        + T+ ++ E           +++ +A +I + + +L  K FVHRD+AARNC+V+         K+GDFG+ RDIY  +YYRK  +  +P+RWM+PE++KDG+F+  SDVWSFGV+ WEI T    PY G +N +VLK V+DG  L  P  CP  + E++ +CW+Y P  RP FLEI
Sbjct:   19 LGQGTFGMVYEGLARGIVKGEDETR---VAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVVSQA-QPILVIMELMTRGDLKSYLRSLRPDA------EDFTETIVLEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVA----EDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLSNEQVLKFVMDGGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEI 285          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009481.1 (pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.527 bits (519), Expect = 9.454e-57
Identity = 108/277 (38.99%), Postives = 164/277 (59.21%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTM--TVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G G FGMV++G     V+ +++T    VA+K  N  +   E  +F  EA ++  +   ++V LLGV         +I+E M +G+L+ YL+  RPD  ++  +  S+             +++ +A +I + + +L  K FVHRD+AARNC+V+         K+GDFG+ RDIY  +YYRK  +  +P+RWM+PE++KDG+F+  SDVWSFGV+ WEI T    PY G +N +VLK V+DG  L  P  CP  + E++ +CW+Y P  RP FLEI
Sbjct:   67 LGQGTFGMVYEGLARGIVKGEDETR---VAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVVSQA-QPILVIMELMTRGDLKSYLRSLRPDAEKKPTRPPSS-----------LPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVA----EDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLSNEQVLKFVMDGGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEI 324          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ltk (leukocyte receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-030616-115])

HSP 1 Score: 207.223 bits (526), Expect = 2.539e-55
Identity = 116/327 (35.47%), Postives = 177/327 (54.13%), Query Frame = 1
Query: 4378 YEINSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE----DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYF-DEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYFDGPRDIEET 5343
            Y  N  +      L++  ++P      +N    +G+GAFG V++G +T          P+ + ++    I  E    DF  EA+++ K+ H NIV  +GVS     +  ++LE M  G+++ YL+  RP             R +         DL+++A DI    ++LE+ +F+HRDIAARNCL++    + RI K+GDFG+ARDIY    YYRK     +P++WM PE   +GIF+ K+D WSFGVL WEI + G  PY  ++N EV++ V  G ++  P+ CP+ VY +M QCW++ PE RP F  I     Y     D+ +T
Sbjct:  429 YNPNYCFAGSPAALSDLKEVPR---RNINLLRALGHGAFGEVYEGRVT-----GIEPSPLKVAVKTLPEICSEQDELDFLMEALIISKFNHHNIVRCVGVSLQTLPR-FILLELMAGGDMKTYLREERP-------------RAVCAGPRKSMLDLLTMAKDIACG-QYLEDNHFIHRDIAARNCLLTSKGSD-RIAKIGDFGMARDIYSRASYYRKGGRAMLPVKWMPPEAFLEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVMEFVTSGGRMDPPKNCPVPVYRIMTQCWQHRPEDRPNFSTILERITYCTQDPDVVQT 731          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: NTRK2 (neurotrophic receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:8032])

HSP 1 Score: 193.741 bits (491), Expect = 1.909e-54
Identity = 103/272 (37.87%), Postives = 156/272 (57.35%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISE---EDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLIL--EYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECR 5277
            +G GAFG V+   +   S     Q+P+ +  +  K +S+   +DF REA LL    H +IV   GV   C + + LI+  EYM+ G+L ++L+   PD +       +  RL+++  +L+      + S I   + +L  ++FVHRD+A RNCLV        + K+GDFG++RD+Y  +YYR    T +PIRWM PE+I    F+  SDVWS GV+ WEI T+G  P+   +N EV+  +  G+ L RP +CP++VYE+ML CW   P+ R
Sbjct:   82 LGEGAFGKVY---LAECSSLDVGQEPMLVAAKTLKDLSDGARKDFYREAELLTNLQHEHIVRFYGV---CVEGEPLIMVFEYMKNGDLNKFLRLRGPDAVFMGDAPQAEPRLLSQAQMLN------MGSQIAAGMAYLASQHFVHRDLATRNCLVG----AGLVVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTADSDVWSLGVVLWEIFTYGKQPWYQLSNTEVIDCICQGRVLERPRSCPMEVYELMLGCWHREPQHR 337          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001705.1 (pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 gene:ENSPMAG00000001543.1 transcript:ENSPMAT00000001705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.726 bits (465), Expect = 2.655e-52
Identity = 90/243 (37.04%), Postives = 138/243 (56.79%), Query Frame = 1
Query: 4591 EEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQ--CLILEYMEKGNLRQYLQHHRPD--VIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIF 5307
            + +F REA L+ ++ HPNIV LLGV   C   +  CL+ E+M  G+L +YL+    +  +        +     +E   L   D + +A+ +   + +L E+ FVHRD+A RNCLV     N+ + K+ DFGL++ IY  +YY+      +PIRWM PE+I    ++ +SDVW+FGV+ WEI + G  PY G ++ EV+  V DG  L  P+ CP+D+Y +M  CW + P  RP F  +  + 
Sbjct:    5 QANFHREAALMAEFTHPNIVKLLGV---CAVGKPFCLLFEFMPHGDLNEYLRRCSSEAGLAASSPPARAPTSSGSEPVSLCCADKLFVATQVAAGMAYLAERKFVHRDLATRNCLVG----NRLVVKISDFGLSQSIYAADYYKANENDAIPIRWMPPESIFYNRYTSESDVWAFGVVLWEIFSHGLQPYFGMSHEEVIYFVRDGNVLACPDGCPLDLYNLMRLCWAHAPADRPSFASVQHVL 240          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: ATG1 (Protein serine/threonine kinase; required for vesicle formation in autophagy and the cytoplasm-to-vacuole targeting (Cvt) pathway; structurally required for phagophore assembly site formation; during autophagy forms a complex with Atg13p and Atg17p; essential for cell cycle progression from G2/M to G1 under nitrogen starvation [Source:SGD;Acc:S000003148])

HSP 1 Score: 87.0409 bits (214), Expect = 2.042e-17
Identity = 83/304 (27.30%), Postives = 137/304 (45.07%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVA-LKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQC---LILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINE--------NSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSI-----HNK------------NKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQ-LGRPETCPI--DVYEMMLQCWKYYPECRPRFLE 5292
            IG G+F  V++G +T +     + K V+  K++N K +  E+ + E  +L K  HP+IV L+    DC        LI+EY   G+L   L+  +     + ++N+   R + E        ++ L    ++S    +  ALKFL  KN VHRDI  +N L+S      H+             N  I K+ DFG AR  +        +    P+ +MAPE +    ++ K+D+WS G + +E M  G  P+    + E+ K +      +  P  C I  ++ E++     + P  R  F E
Sbjct:   30 IGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLL--ENLEIEIAILKKIKHPHIVGLI----DCERTSTDFYLIMEYCALGDLTFLLKRRK-----ELMENHPLLRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYNLPILKIADFGFAR--FLPNTSLAETLCGSPL-YMAPEILNYQKYNAKADLWSVGTVVFE-MCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPAQRIGFEE 318          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 82.4185 bits (202), Expect = 4.777e-16
Identity = 89/306 (29.08%), Postives = 131/306 (42.81%), Query Frame = 1
Query: 4468 SHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGH-PNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGI-FSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLG-RPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYFDGPRDIEETSTLSRLVMR 5370
            + +IG G FG+V+KG       N  + +  A+K+ N  S S+E  D +RE   L       NI    G S+       +I+E+   G+LR  L   RP  I                   D K +  I  ++L ALK + + N +HRDI A N L++    N+   KL DFG+A  +      R+T     P  WMAPE I +G+ +  K D+WS G+  +EI T G  PY        ++ +I  K       +    + E +  C    P  + R    DL+   F        TS L  L+ R
Sbjct:   26 TEVIGRGKFGVVYKGY------NVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYG-SYLKDTSLWIIMEHCAGGSLRSLL---RPGKI-------------------DEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLIT----NEGNVKLCDFGVAAQVNQTSLRRQT-MAGTPY-WMAPEVIMEGVYYDTKVDIWSLGITTYEIAT-GNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDP--KERLSADDLLKSKFIRAHKATPTSILKELISR 293          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 80.4925 bits (197), Expect = 1.720e-15
Identity = 72/284 (25.35%), Postives = 122/284 (42.96%), Query Frame = 1
Query: 4450 NECLNYSHLIGNGAFGMVFKGTMT--------VESDNKTSQKP-----VALK-IRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDG--KQLGRPETCPIDVYEMMLQC 5253
            ++C       G GA G V+    T        +E  N    +P     VA+K +   K   +E    E +++    H NIV  L       D   +++E+ME G+L         D+I     N+      N +S L    +  I  +  + LKFL +K+ +HRDI + N L+    +     K+ DFG    +  D+  ++ +    P  WMAPE +K   +  K DVWS G++  E++  G  PY+ +   + L  +      +L  PE+  +++   +  C
Sbjct:  543 SQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLT--------DIIENSPTND------NSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRAR----VKITDFGFCARL-TDKRSKRATMVGTPY-WMAPEVVKQREYDEKIDVWSLGIMTIEMLE-GEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVC 805          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 76.2554 bits (186), Expect = 8.118e-15
Identity = 64/237 (27.00%), Postives = 108/237 (45.57%), Query Frame = 1
Query: 4591 EEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDL 5301
            ++ F+RE  +     HPN+    G  F    +  L++EY+  G + + L+ H P                  N IL +  +  IA+    AL ++ +KN +HRDI   N L+  +N    + KL DFG +  I   E  RKT      I +++PE ++   +    D W+ GVL +E++T GA P+  +      K  I    +  P     D  +++L+  KY P+ R R  ++ +
Sbjct:  146 QKQFRREVEIQTSLNHPNLTKSYGY-FHDEKRVYLLMEYLVNGEMYKLLRLHGP-----------------FNDILASDYIYQIAN----ALDYMHKKNIIHRDIKPENILIGFNN----VIKLTDFGWS-IINPPENRRKTVCGT--IDYLSPEMVESREYDHTIDAWALGVLAFELLT-GAPPFEEEMKDTTYKR-IAALDIKMPSNISQDAQDLILKLLKYDPKDRMRLGDVKM 351          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 78.1814 bits (191), Expect = 8.330e-15
Identity = 77/282 (27.30%), Postives = 119/282 (42.20%), Query Frame = 1
Query: 4465 YSHL--IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYG-HPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDG--KQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            Y++L  IG GA G V+      E     S   VA+K  N +   +++     +L+ K   HPNIV  +  S+       +I+EYME G+L   + H                       IL    + ++  + L  L+FL  K  +HRDI + N L+S+        KL DFG    I  +   ++T+    P  WMAPE +    +  K D+WS G++  E M  G  PY+ +T    L  +      +L  PE     + + +  C    PE R    E+
Sbjct:  620 YANLVKIGQGASGGVYTA---YEIGTNVS---VAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFID-SYVLKGDLWVIMEYMEGGSLTDVVTH----------------------CILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGD----IKLTDFGFCAQIN-ELNLKRTTMVGTPY-WMAPEVVSRKEYGPKVDIWSLGIMIIE-MIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATEL 865          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO47652 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7RLS3])

HSP 1 Score: 218.779 bits (556), Expect = 1.530e-63
Identity = 107/274 (39.05%), Postives = 169/274 (61.68%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEE-DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +GNG+FGMV++G  T    NK   K     +    SI +  +F +EA ++  +   ++V LLGV  D      +++E M+ G+L+ +L+ HRP+V  +  +   T            + ++ +A +I + + +L  + FVHRD+AARNC+V   N N  + K+GDFG+ RDIY  +YYRK  +  +P+RWMAPE++KDG+F+  SDVWSFGV+ WE+ T  + PY G++N EVLK V+DG  + +P+ CP  ++++M  CW++ P+ RP FL I
Sbjct:   24 LGNGSFGMVYEGEATDIVPNKPKCKVAVKTVSENASIRDRIEFLQEASIMKAFQCNHVVRLLGVVSDG-QPTLVVMELMDNGDLKNFLRSHRPEVTMESDEPPPT-----------LQQMLQMAGEIADGMAYLAARKFVHRDLAARNCMV---NANLTV-KIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTSPSDVWSFGVVMWEMATLASQPYPGKSNEEVLKYVVDGGVMPKPDDCPDRLFDLMTLCWQFSPKARPTFLSI 281          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO35408 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ9])

HSP 1 Score: 191.045 bits (484), Expect = 3.126e-54
Identity = 109/295 (36.95%), Postives = 166/295 (56.27%), Query Frame = 1
Query: 4441 HILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISE----EDFKREAVLLFKYG-HPNIVILLGV-SFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIF 5307
             I  +C+     IG G FG+VF GT+ +  D       +   I+  K + +    +D K E  ++ + G HPN+V L+G  + + P    +I EY+  GNL         D +RQ  + +S  + +N NS L ++DL+ IA D+   ++ +  K FVHRD+AARN L++    +    K+ DFGLARDIY +  Y KT   ++PI+WMAPE I+D +++ ++DVWSFGVL WEI+T G  PY G   A +L+ ++ G ++  P  C  +VY +M  CW+  P  RP F E+  I 
Sbjct:    5 EIPRDCVTLGDRIGEGQFGIVFAGTVKIGEDT------IKAAIKCIKDVDDRYDMKDLKLEMEMMKEIGYHPNVVSLIGTCTIETP--LYIITEYVSGGNLL--------DQLRQSRRTDS--KYVNVNSTLTSRDLLRIALDVSRGMRHIAMKKFVHRDLAARNVLMT----DTLTAKVADFGLARDIYCEGKYVKTGGGRLPIKWMAPEAIRDQVYTTQTDVWSFGVLLWEIVTLGRSPYPGVPIAMLLEKLLYGYKMPCPSHCSEEVYSVMESCWQLEPSARPGFGELSKIL 277          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO49126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGW8])

HSP 1 Score: 186.422 bits (472), Expect = 6.757e-52
Identity = 106/285 (37.19%), Postives = 161/285 (56.49%), Query Frame = 1
Query: 4459 LNYSHLIGNGAFGMVFKGTMT-VESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYG-HPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDV-IRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIY-FDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            + +  ++G+GAFG V K T+  +    +  +  VA+K  N  +  E+  +F  E  ++ + G H NIV +LG       + CLI EY   G+LR YL+  R  V  R  L   +  R + +N      DL+S A  I   +++L +K FVHRD+AARN L+   N    + K+ DFGL RD+Y   EY++  +  K+P++WMAPE I   + + KSDVW+FGV+ WEI+T G  PY GQ+  E  K + +G ++ +P+ C  ++Y MM  CW   PE RP F ++
Sbjct:   18 IAFGEVVGSGAFGKVTKATIVGLPGGPENKETVVAVKKLNAMATMEDRRNFLSEIEMMKQLGKHLNIVSILGCVTHA-GQLCLITEYCPYGDLRNYLRAIRDKVSTRDSLAGRAPGRELTQN------DLLSFARQIAVGMEYLSQKMFVHRDLAARNILICEDN----LVKISDFGLTRDVYESSEYHKMHNTGKLPLKWMAPEAIFQNVHTTKSDVWAFGVVLWEIVTLGGSPYPGQSGKEFYKKLKNGYRMEKPDMCSPELYAMMRSCWASSPEDRPTFTKL 291          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO47097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN91])

HSP 1 Score: 181.03 bits (458), Expect = 1.630e-50
Identity = 103/279 (36.92%), Postives = 154/279 (55.20%), Query Frame = 1
Query: 4474 LIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISE-EDFKREAVLLFKYG-HPNIVILLGVSFDCPDKQC---LILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            ++G GAFG VF     V   NK   +     ++   + SE  D   E  +L   G H NIV LLG       ++C   +I+EY   GNL  +L+  R DV        + K     +      DL+  +  +  A++FL  +  VHRD+AARN LV        + K+ DFGLARDIY +E+Y KT+   +P++WMA E + D +++  SDVWSFGVL WEI T G  PY G    EV + +++G+++ +PE CP ++Y++ML+CW++ P  RP F ++
Sbjct:   21 IVGTGAFGQVFLAE-AVGISNKQVTRVACKGLKENATDSEYRDLLSELKILMHIGEHKNIVNLLGAC--TKGRECDLLVIIEYCPHGNLLNFLRKRR-DVFEATWSPPTEK----PDETFTLTDLVITSFQVSRAMQFLASRRCVHRDLAARNVLVG----ENYVMKIADFGLARDIYKEEHYVKTTAGLLPVKWMAIEALVDQVYTHSSDVWSFGVLLWEIFTLGGSPYPGLPANEVYQYLMEGQRMAQPEDCPQEMYDLMLRCWQHDPAQRPTFTQL 287          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO39761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S933])

HSP 1 Score: 176.792 bits (447), Expect = 6.279e-50
Identity = 91/217 (41.94%), Postives = 127/217 (58.53%), Query Frame = 1
Query: 4636 HPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRF 5286
            HPN+V LL VS +  +   +I E+M +G+L  YL+  +P         +S  +  +     D KDL+ IA  +   ++++    FVHRD+A RNCLV        + K+ DFG++RD+Y  +YY+ + ET +PIRW+APE    G F+ KSDV+S+GVL WEI TFG  PY G TN EV + +  G  LGRP+ CP  VY +M  CW   PE R  F
Sbjct:   20 HPNVVKLLAVSTE-EEPYGMIFEFMGEGDLNHYLRSAKP-------AESSAYKGPD-----DAKDLVGIAEQVAAGMEYVASLRFVHRDLATRNCLVG----TDMVVKIADFGMSRDVYGSDYYKMSRETMLPIRWLAPEAFLYGKFTVKSDVYSYGVLLWEIFTFGLQPYYGYTNKEVTEFIKKGIHLGRPDDCPQFVYLIMKDCWSREPEERVDF 219          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: ltk (ALK tyrosine kinase receptor [Source:NCBI gene;Acc:101156784])

HSP 1 Score: 214.542 bits (545), Expect = 1.920e-55
Identity = 108/274 (39.42%), Postives = 160/274 (58.39%), Query Frame = 1
Query: 4477 IGNGAFGMVFKG-TMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G+GAFG V++G  + +  D    Q  V           E DF  EA+++ K+ H NIV  +GVS +   +  ++LE M  G+++ +L+ +RP                 + S L  ++L+ +A DI    ++LEE  F+HRDIAARNCL++     +R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +GIF+ K+D+WSFGVL WEI++ G  PY  +TN EVL+ V  G ++  P+ CP  VY +M QCW++ P  RP F  I
Sbjct:  908 LGHGAFGEVYEGQVLGMNPDGSPMQVAVKTLPEICSEQDEMDFLMEALIMSKFSHENIVRCIGVSLNILPRF-ILLELMIGGDMKTFLRQNRPRT--------------GQASSLTMRELLQMARDIANGCRYLEENQFIHRDIAARNCLLTCTGP-ERVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFVEGIFTCKTDIWSFGVLLWEILSLGYMPYPCKTNQEVLEFVTSGGRMDPPKGCPGPVYRLMTQCWQHCPNQRPNFSTI 1165          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: ltk (ALK tyrosine kinase receptor [Source:NCBI gene;Acc:101156784])

HSP 1 Score: 214.542 bits (545), Expect = 2.184e-55
Identity = 108/274 (39.42%), Postives = 160/274 (58.39%), Query Frame = 1
Query: 4477 IGNGAFGMVFKG-TMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G+GAFG V++G  + +  D    Q  V           E DF  EA+++ K+ H NIV  +GVS +   +  ++LE M  G+++ +L+ +RP                 + S L  ++L+ +A DI    ++LEE  F+HRDIAARNCL++     +R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +GIF+ K+D+WSFGVL WEI++ G  PY  +TN EVL+ V  G ++  P+ CP  VY +M QCW++ P  RP F  I
Sbjct:  876 LGHGAFGEVYEGQVLGMNPDGSPMQVAVKTLPEICSEQDEMDFLMEALIMSKFSHENIVRCIGVSLNILPRF-ILLELMIGGDMKTFLRQNRPRT--------------GQASSLTMRELLQMARDIANGCRYLEENQFIHRDIAARNCLLTCTGP-ERVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFVEGIFTCKTDIWSFGVLLWEILSLGYMPYPCKTNQEVLEFVTSGGRMDPPKGCPGPVYRLMTQCWQHCPNQRPNFSTI 1133          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: alk (ALK receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-031027-1])

HSP 1 Score: 204.912 bits (520), Expect = 3.189e-55
Identity = 109/275 (39.64%), Postives = 159/275 (57.82%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDF--KREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G+GAFG V++G + V    + S   VA+KI     +S+  F  K    +  K+ H NIV  +GV       + ++LE M  G+L+ +L+  RP               + + S L   DL+++A DI +  ++LEE  F+HRDIAARNCL++      R+ K+GDFG+ARDIY   YYRK     +P++WM PE   +GIF+ K+D WSFGVL WEI + G  PY  ++N EVL+ V +G ++  P+ CP  VY +M Q W++ PE RP F  I
Sbjct:  104 LGHGAFGEVYEG-LAVGIPGEQSPLQVAVKI-----LSKVYFFMKLRVFICSKFSHQNIVHCIGVCLQA-MPRFILLELMAGGDLKTFLRETRPR--------------LEQPSSLTMVDLLNVARDIAKGCQYLEENQFIHRDIAARNCLLTCKGPG-RVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSRSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQSWQHQPEDRPNFSTI 356          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: ENSORLT00000039357.1 (insulin receptor [Source:NCBI gene;Acc:101168764])

HSP 1 Score: 209.534 bits (532), Expect = 5.302e-54
Identity = 112/277 (40.43%), Postives = 164/277 (59.21%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTM--TVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G G+FGMV++G     V+ D +T    VA+K  N  +   E  +F  EA ++  +   ++V LLGV         +++E M  G+L+ YL+  RPD      +NN +            KD++ +A++I + + +L  K FVHRD+AARNC+V          K+GDFG+ RDIY  +YYRK  +  +P+RWMAPE++KDG+F+  SD WSFGV+ WEI T    PY G +N +VLK V+DG  L RP+ CP  ++ +M  CW+Y P+ RP FLEI
Sbjct:  965 LGQGSFGMVYQGIAKDIVKGDPETR---VAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLGVVSK-GQPTLVVMELMTHGDLKSYLRSLRPDS-----ENNPSGA-----PPPSLKDMLQMAAEIADGMAYLNAKKFVHRDLAARNCMVG----EDYTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMDGGFLDRPDNCPERMHSLMQMCWQYNPKMRPTFLEI 1223          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: ENSORLT00000023220.2 (insulin receptor [Source:NCBI gene;Acc:101168764])

HSP 1 Score: 209.149 bits (531), Expect = 7.273e-54
Identity = 112/277 (40.43%), Postives = 164/277 (59.21%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTM--TVESDNKTSQKPVALKIRNGKSISEE--DFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G G+FGMV++G     V+ D +T    VA+K  N  +   E  +F  EA ++  +   ++V LLGV         +++E M  G+L+ YL+  RPD      +NN +            KD++ +A++I + + +L  K FVHRD+AARNC+V          K+GDFG+ RDIY  +YYRK  +  +P+RWMAPE++KDG+F+  SD WSFGV+ WEI T    PY G +N +VLK V+DG  L RP+ CP  ++ +M  CW+Y P+ RP FLEI
Sbjct: 1021 LGQGSFGMVYQGIAKDIVKGDPETR---VAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLGVVSK-GQPTLVVMELMTHGDLKSYLRSLRPDS-----ENNPSGA-----PPPSLKDMLQMAAEIADGMAYLNAKKFVHRDLAARNCMVG----EDYTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMDGGFLDRPDNCPERMHSLMQMCWQYNPKMRPTFLEI 1279          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000063632.1 (SMESG000063632.1)

HSP 1 Score: 2758.79 bits (7150), Expect = 0.000e+0
Identity = 1378/1446 (95.30%), Postives = 1383/1446 (95.64%), Query Frame = 1
Query: 1267 VSWNQPIAKWQSKFRWKLFSYKLQLRSNQTRVSTINVNNKAHFRFYGLRPNSKYEVIVSTKHFLQSITGVTLNSKVNIAFHIFIIKNGTIKSMNFSLRTFKPKKYDSILSTLTLVKDIHMFQNCGFVLHQNGFITRLVNHSITHKLSLQNAIKMEVDFSTGNVFFIDGSNHWIYRYRIKDMLIYAIDVITPHWTDDFTLFPTLDVLFFGNVTGTYYTDLNGLSVRHSGILEIKNERLFCGDHFVEIIILRNQHRILSRFKNGSRFHCRSSALGIVMTSDSGISLRNWQGNSSLNLMRNHSGVSALSIKDSSICQDIYVKPIQAEFISISRSNSDDIVLSWIPENKDSHRSYLVFIINHNRKRHWTFSTHATTINLKNFSRCSDSIEFSIKILYKTTFSDTVTKNFHVPCTTKLPRITDLFITKKSIIGNIHRSLIEVQSEFQIYANTKKIDFQYSCVFVILFRKKFQMISEVKKSSEISCLDQKFSTSFEVDQNYQFELDEICGSISFHDISIEKCIGNEIMKTNAKEIILSRRQKYVLTYLNESINRIFIDPSGTSVSMTIDGSQFSRKILISETPVDKLEIDWIKNVLFWSERGPVEMKLFSVNLNGIKVNLREDRLLWINQDGIGFIWSIDTIERKLRITTNQNESIINLDYGPEWHVDHGYLVNCDKLINHRNILKCTNENISKNSVSAISSYFYPFKNLIIYENLNKLVCKIVTVKRNYVIPNVVSSCAVKQFSNVKNIDSSVLSLNEKTLIDGIGNVYSLSMSNNAQCNMSSIQFINLLLVKCYRNHAEVSISSSSRKHIFKLGIHYVNMESHENHSVDILDNPFNDPIQHDISINDLHPGIFYQFIFTFNFTMSKLQGIVTCQCFSKDDVPDSPVNVSILRQNFTHNRIMWKPGKTNGDNILDYKIKMNFQNHLQKFNSIKNTYFDIAKSNQTGTISVEARNIVGFSLPSYLSLKLTDTRKQISHYYLHSTMTFXXXXXXXXXXXXXXXXXXXXMYIHHRKTKRNNKLIKSNIIVDAQTFELMNVNQGIKYEINSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYFDGPRDIEETSTLSRLVMRSYNSSHESEFGINSDPVTEKTSIAFSEKYPEIGSLPPPTVENVTVRKNYDNLGYEVPLSPAIITKQESVFLHYSNDAN 5604
            +S N    +W  KFRWKLFSYKLQLRSNQTRVSTINVNNKAHFRFYGL PNSKYEVIVSTKHF QSITGVTLNSKVNI FHIFIIKNGTIKSMNFSLRTFKP+KYDSILSTLTLVKDIHMFQNCGFVLHQNGFITRLVNHSITHKLSLQNAIKMEVDFSTGNVFFIDGSNHWIYRYRIKDMLIYAIDVITPHWTDDFTLFPTLDVLFFGNVTGTYYTDLNGLSVRHSGILEIKNERLFCGDHFVEIIILRNQHR+LSRF NGSRFHCRSSALGIVMTSDSGISLRNWQGNSSLNLMRNHSGVSALSIKDSSICQDIYVKPIQAEFISISRSNSDDIVLSWIPENKDSHRSYLVFIINHNRKRHWTFSTHATTINLKNFSRCSDSIEFSIKILYKTTFSDTVTKNFHVPCTTKLPRITDLFITKKSIIGNIHRSLIEVQSEFQIYANTKKIDFQYSCVFVILFRKKFQMISEVKKSSEISCLDQKFSTSFEVDQNYQFELDEICGSISFHDISIEKCIGNEIMKTNAKEIILSRRQKYVLTYLNESINRIFIDPSG SVSMTIDGSQFSRKILISETPVDKLEIDWIKNVLFWSERGPVEMKLFSVNLNGIKVNLREDRLLWINQDGIGFIWSIDTIERKLRITTNQNESIINLDYGPEWHVDHGYLVNCDKLINHRNILKCTNENISKNSVSAISSYFYPFKNLIIYENLNKLVCKIVTVKRNYVIPNVVSSCAVKQFSNVKNIDSSVLSLNEKTLIDGIGNVYSLSMSNNAQCNMSSIQFINLLLVKCYRNHAEVSISSSSRKHIFKLGIHYVNMESHENHSVDILDNPFNDPIQHDISINDLHPGIFYQFIFTFNFTMSKLQGIVTCQCFSKDDVPDSPVNVSILRQNFTHNRIMWKPGKTNGDNILDYKIKMNFQNHLQKFNSIKNTYFDIAKSNQTGTISVEARNIVGFSLPSYLSLKLTDTRKQISHYYLHSTMTFSTSLFLIIVLVSVSLILIISMYIHHRKTKRNNKLIKSNIIVDAQTFELMNVNQGIKYEINSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCL +                                                  GKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYFDGPRDIEETSTLSRLVMRSYNSSHESEFGINSDPVTEKTSIAFSEKYPEIGSLPPPTVENVTVRKNYDNLGYEVPLSPAIITKQESVFLHYSNDAN
Sbjct:  110 LSNNDDKRQWVGKFRWKLFSYKLQLRSNQTRVSTINVNNKAHFRFYGLWPNSKYEVIVSTKHFSQSITGVTLNSKVNIDFHIFIIKNGTIKSMNFSLRTFKPEKYDSILSTLTLVKDIHMFQNCGFVLHQNGFITRLVNHSITHKLSLQNAIKMEVDFSTGNVFFIDGSNHWIYRYRIKDMLIYAIDVITPHWTDDFTLFPTLDVLFFGNVTGTYYTDLNGLSVRHSGILEIKNERLFCGDHFVEIIILRNQHRMLSRFNNGSRFHCRSSALGIVMTSDSGISLRNWQGNSSLNLMRNHSGVSALSIKDSSICQDIYVKPIQAEFISISRSNSDDIVLSWIPENKDSHRSYLVFIINHNRKRHWTFSTHATTINLKNFSRCSDSIEFSIKILYKTTFSDTVTKNFHVPCTTKLPRITDLFITKKSIIGNIHRSLIEVQSEFQIYANTKKIDFQYSCVFVILFRKKFQMISEVKKSSEISCLDQKFSTSFEVDQNYQFELDEICGSISFHDISIEKCIGNEIMKTNAKEIILSRRQKYVLTYLNESINRIFIDPSGRSVSMTIDGSQFSRKILISETPVDKLEIDWIKNVLFWSERGPVEMKLFSVNLNGIKVNLREDRLLWINQDGIGFIWSIDTIERKLRITTNQNESIINLDYGPEWHVDHGYLVNCDKLINHRNILKCTNENISKNSVSAISSYFYPFKNLIIYENLNKLVCKIVTVKRNYVIPNVVSSCAVKQFSNVKNIDSSVLSLNEKTLIDGIGNVYSLSMSNNAQCNMSSIQFINLLLVKCYRNHAEVSISSSSRKHIFKLGIHYVNMESHENHSVDILDNPFNDPIQHDISINDLHPGIFYQFIFTFNFTMSKLQGIVTCQCFSKDDVPDSPVNVSILRQNFTHNRIMWKPGKTNGDNILDYKIKMNFQNHLQKFNSIKNTYFDIAKSNQTGTISVEARNIVGFSLPSYLSLKLTDTRKQISHYYLHSTMTFSTSLFLIIVLVSVSLILIISMYIHHRKTKRNNKLIKSNIIVDAQTFELMNVNQGIKYEINSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLEN-------------------------------------------------HGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYFDGPRDIEETSTLSRLVMRSYNSSHESEFGINSDPVTEKTSIAFSEKYPEIGSLPPPTVENVTVRKNYDNLGYEVPLSPAIITKQESVFLHYSNDAN 1506          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000063625.1 (SMESG000063625.1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 383/388 (98.71%), Postives = 385/388 (99.23%), Query Frame = 1
Query:  142 VWPLSGIIIADNQRSFSVISIESINIKTVRIEWKIEEKLIKQLHMFNLVACINTSAERNYNYLPTMRSLVMYNVSIECNRNELYAVFTDLSTLGCIFYLHHLNAIYTVDNQFFGCFKDDCDFXXXXXXXXXXXXXYGKSLYDFYIYTRSALEWHDFRSTKFTILALRISDPIIKMDFDWLNELVLILTPSKIYQINIKNKSITHARITTNFSSIDAVADPINGLIHMLMQHNSSRFYTTLHSTILENISFSNLKSTTLEIPDSCSLILASDGTSIKILQSNSLLTFQLKKMVLVKDFDLRNANFQPPVKLQLKQDTYVVWKXXXXXXXXXXXXXXXXXXSRMDHYASAKSINRNSPTPLISFVILNSFYGDNFLFVSWNQPIAKWQSK 1305
            VWPLSGIIIADNQRSFSVISIESINIKTVRIEWKIEEKLIKQLHMFNLVACINTSAERNYNYLPTMRSLVMYNVSIECNRNELYAVFTDLSTLGCIFYLHH NAIYTVDNQFFGCFKDDCDFLLLNASSSILAISYGKSLYDFYIYTRSALEWHDFRSTKFTILALRISDPIIKMDFDWLNELVLILTPSKIYQINIKNKSITHARITTNF+SIDAVADPINGLIH+LMQHNSSRFYTTLHSTILENIS SNLKSTTLEIPDSCSLILASDGTSIKILQSNSL TFQLKKMVLVKDFDLRNANFQPPVKLQLKQDTYVVWKTNVNFEFNENNTNVHTFHSRMDHYASAKSINRNSPTPLISFVILNSFYGDNFLFVSWNQPIAKWQSK
Sbjct:   14 VWPLSGIIIADNQRSFSVISIESINIKTVRIEWKIEEKLIKQLHMFNLVACINTSAERNYNYLPTMRSLVMYNVSIECNRNELYAVFTDLSTLGCIFYLHHFNAIYTVDNQFFGCFKDDCDFLLLNASSSILAISYGKSLYDFYIYTRSALEWHDFRSTKFTILALRISDPIIKMDFDWLNELVLILTPSKIYQINIKNKSITHARITTNFTSIDAVADPINGLIHILMQHNSSRFYTTLHSTILENISISNLKSTTLEIPDSCSLILASDGTSIKILQSNSLSTFQLKKMVLVKDFDLRNANFQPPVKLQLKQDTYVVWKTNVNFEFNENNTNVHTFHSRMDHYASAKSINRNSPTPLISFVILNSFYGDNFLFVSWNQPIAKWQSK 401          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000041792.1 (SMESG000041792.1)

HSP 1 Score: 186.037 bits (471), Expect = 1.311e-47
Identity = 109/309 (35.28%), Postives = 170/309 (55.02%), Query Frame = 1
Query: 4387 NSLYGFEKLPLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNK----TSQKPVALKIRNGKSIS-EEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKM-PIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +SL    K+ +T+ D   + L++ + +   IG G FG V+K  +   ++N      S   +   +  G S+  + +FK+EA ++ +  H N++ L+GVS       CLI ++MEKG+L + L  +    +R      +       +  L   D I IA+ I   +++L  ++FVHRD+AARN L+        + K+ D GL +D Y  +YYR T  T M PIRWM+PE I  G F+ +SDVW++GVL WEI + G  P+ G +NAEV++ V   + L  P+ CP  VY++ML+CW   P  RP+F  I
Sbjct:  458 SSLVQLNKIKITSTD---YPLSQ-IRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIR-QIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIG----ENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNI 757          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000042606.1 (SMESG000042606.1)

HSP 1 Score: 181.8 bits (460), Expect = 5.034e-46
Identity = 103/273 (37.73%), Postives = 146/273 (53.48%), Query Frame = 1
Query: 4477 IGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPETCPIDVYEMMLQCWKYYPECRPRFLEI 5295
            +G+G +G+V++         K     VA+K         +DF  EA L+    HPN+V LLGV    P    +I E+ME GNL +YL        R + K +           L    L+ +A  I   +++LE+ NF+HRD+AARNCLV   N    I K+ DFGLAR +  D+ Y      K PI+W APE +    FS KSDVW+FGVL WE+ T+G  PY G    +V   +  G  + RP  CP ++Y++M QCW+++PE RP F ++
Sbjct:  261 LGSGQYGIVYEAFW------KKYSITVAVKTVKTDITVADDFLEEARLMKSLQHPNLVRLLGVCTQEP-PNYIIAEFMENGNLLEYL--------RTRSKED-----------LPPPVLLYMAIQIAAGMEYLEQHNFIHRDLAARNCLVGQDN----IVKVADFGLARCMERDDTYTAHVGAKFPIKWTAPEGLAYNQFSTKSDVWAFGVLLWELATYGMTPYPGIELQDVYVYLEKGNIMNRPAGCPDNIYDIMKQCWQWFPESRPSFKDL 503          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000045588.1 (SMESG000045588.1)

HSP 1 Score: 175.252 bits (443), Expect = 6.178e-46
Identity = 112/307 (36.48%), Postives = 157/307 (51.14%), Query Frame = 1
Query: 4414 PLTNFDKIPHILNECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDFKREAVLLFKYGHPNIVILLGVSFDCPDKQCLIL-EYMEKGNLRQYLQHHRPDVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRDIAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAPETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQLGRPE----TCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYFD 5319
            P   F  I  +  +C+    ++GNG+FG V+ G      +       VA+K     S+    F  EA L+ K  HP IV +LGV    P++   I+ E M  G L  YL+   P+   QKL+ N               +++ + S I E + +LE +NFVHRD+ A N LV          K+ DFGLAR    D+ Y   + TK PI+W APE      FS KSDVWSFGVL +EI+T+G  PY G  N +VL +V  G +L  P      CP ++Y + L+CW  YPE RP F  +  IF++++
Sbjct:  235 PPIQFKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVE-------VAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLR--SPE--GQKLRLN---------------EMLDMMSQIAEGMAYLESRNFVHRDLRAANILVD----EDLSVKVADFGLAR--VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWE 508          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LTK3.730e-6140.00leukocyte receptor tyrosine kinase [Source:HGNC Sy... [more]
ROS14.039e-6038.48ROS proto-oncogene 1, receptor tyrosine kinase [So... [more]
ROS14.187e-6038.48ROS proto-oncogene 1, receptor tyrosine kinase [So... [more]
LTK1.142e-5940.00leukocyte receptor tyrosine kinase [Source:HGNC Sy... [more]
LTK2.850e-5940.00leukocyte receptor tyrosine kinase [Source:HGNC Sy... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scd-21.337e-4932.67ALK tyrosine kinase receptor homolog scd-2 [Sourc... [more]
F11E6.83.056e-4934.72pep chromosome:WBcel235:IV:17444156:17447429:-1 ge... [more]
F11E6.84.375e-4934.72pep chromosome:WBcel235:IV:17444125:17450543:-1 ge... [more]
R151.13.241e-4837.55pep chromosome:WBcel235:III:7218813:7221186:1 gene... [more]
R151.18.511e-4737.55pep chromosome:WBcel235:III:7217839:7221186:1 gene... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Alk1.229e-6136.31gene:FBgn0040505 transcript:FBtr0087118[more]
Alk1.229e-6136.31gene:FBgn0040505 transcript:FBtr0331926[more]
sev6.196e-5739.37gene:FBgn0003366 transcript:FBtr0073393[more]
Ror8.375e-5336.81gene:FBgn0010407 transcript:FBtr0079978[more]
InR2.249e-5238.13gene:FBgn0283499 transcript:FBtr0290232[more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ros13.090e-5837.39c-ros oncogene 1 , receptor tyrosine kinase [Sourc... [more]
alk4.316e-5837.86ALK receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-... [more]
alk8.607e-5637.86ALK receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-... [more]
ltk2.727e-5335.21leukocyte receptor tyrosine kinase [Source:ZFIN;Ac... [more]
ltk2.783e-5335.21leukocyte receptor tyrosine kinase [Source:ZFIN;Ac... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncapd33.963e-6434.29non-SMC condensin II complex subunit D3 [Source:Xe... [more]
ENSXETT00000011701.12.023e-6335.73leukocyte receptor tyrosine kinase [Source:NCBI ge... [more]
ENSXETT00000028153.12.735e-6336.02leukocyte receptor tyrosine kinase [Source:NCBI ge... [more]
ncapd38.646e-6338.84non-SMC condensin II complex subunit D3 [Source:Xe... [more]
ENSXETT00000028190.18.679e-6335.84leukocyte receptor tyrosine kinase [Source:NCBI ge... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ltk3.061e-6341.28leukocyte tyrosine kinase [Source:MGI Symbol;Acc:M... [more]
Ltk5.694e-6241.28leukocyte tyrosine kinase [Source:MGI Symbol;Acc:M... [more]
Ltk2.537e-6041.28leukocyte tyrosine kinase [Source:MGI Symbol;Acc:M... [more]
Ltk5.252e-6041.28leukocyte tyrosine kinase [Source:MGI Symbol;Acc:M... [more]
Ros11.206e-5830.99Ros1 proto-oncogene [Source:MGI Symbol;Acc:MGI:979... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00529|ROS_AVISU1.461e-6436.66Tyrosine-protein kinase transforming protein ros O... [more]
sp|Q63132|ROS1_RAT7.446e-6038.48Proto-oncogene tyrosine-protein kinase ROS OS=Ratt... [more]
sp|P08922|ROS1_HUMAN2.010e-5938.48Proto-oncogene tyrosine-protein kinase ROS OS=Homo... [more]
sp|P08923|LTK_MOUSE3.673e-5941.28Leukocyte tyrosine kinase receptor OS=Mus musculus... [more]
sp|P20806|7LESS_DROVI7.514e-5943.01Protein sevenless OS=Drosophila virilis OX=7244 GN... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MCM53.573e-8542.44Protein kinase domain-containing protein OS=Opisth... [more]
A0A158QCK71.513e-7942.37Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A3P6WQ091.555e-7942.37Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068WLW21.066e-7843.60Tyrosine protein kinase OS=Echinococcus granulosus... [more]
A0A068Y2N73.409e-7742.52Tyrosine protein kinase OS=Echinococcus multilocul... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alk6.679e-5940.94ALK receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-... [more]
ENSAMXT00000021554.23.078e-5740.00pep primary_assembly:Astyanax_mexicanus-2.0:9:4080... [more]
MUSK2.537e-5236.43muscle associated receptor tyrosine kinase [Source... [more]
ntrk3b2.559e-5238.65neurotrophic receptor tyrosine kinase 3 [Source:NC... [more]
igf1ra4.700e-5238.55insulin-like growth factor 1 receptor [Source:NCBI... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009485.17.774e-5838.79pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
ENSPMAT00000009481.19.454e-5738.99pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene... [more]
ltk2.539e-5535.47leukocyte receptor tyrosine kinase [Source:ZFIN;Ac... [more]
NTRK21.909e-5437.87neurotrophic receptor tyrosine kinase 2 [Source:HG... [more]
ENSPMAT00000001705.12.655e-5237.04pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 ge... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ATG12.042e-1727.30Protein serine/threonine kinase; required for vesi... [more]
KIC14.777e-1629.08Protein kinase of the PAK/Ste20 family, required f... [more]
CLA41.720e-1525.35Cdc42p-activated signal transducing kinase; member... [more]
IPL18.118e-1527.00Aurora kinase of chromosomal passenger complex; me... [more]
STE208.330e-1527.30Cdc42p-activated signal transducing kinase; involv... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476521.530e-6339.05Tyrosine-protein kinase receptor [Source:UniProtK... [more]
EDO354083.126e-5436.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491266.757e-5237.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470971.630e-5036.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397616.279e-5041.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ltk1.920e-5539.42ALK tyrosine kinase receptor [Source:NCBI gene;Acc... [more]
ltk2.184e-5539.42ALK tyrosine kinase receptor [Source:NCBI gene;Acc... [more]
alk3.189e-5539.64ALK receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-... [more]
ENSORLT00000039357.15.302e-5440.43insulin receptor [Source:NCBI gene;Acc:101168764][more]
ENSORLT00000023220.27.273e-5440.43insulin receptor [Source:NCBI gene;Acc:101168764][more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063632.10.000e+095.30SMESG000063632.1[more]
SMESG000063625.10.000e+098.71SMESG000063625.1[more]
SMESG000041792.11.311e-4735.28SMESG000041792.1[more]
SMESG000042606.15.034e-4637.73SMESG000042606.1[more]
SMESG000045588.16.178e-4636.48SMESG000045588.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004366 ID=SMED30004366|Name=Tyrosine-protein kinase receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=5654bp
TATATAAATCTTATATGATAACTGCACATAATCAGTGTTCACAGGAAGCA
TTTATCACTAGATTTATAGTTGACTTTCACATTCTTTTCAGTTCTTTTCA
TCATGTTATTGTTAGCATCATTTTGCTTTCTCGCAGCTTCAGTTTGGCCA
TTGTCAGGAATAATAATTGCAGATAATCAGAGATCGTTTAGTGTGATAAG
TATAGAAAGTATTAATATTAAGACAGTTAGAATCGAATGGAAAATTGAAG
AGAAGCTCATCAAGCAGTTACATATGTTTAACCTGGTTGCCTGTATCAAT
ACCAGTGCTGAAAGGAATTATAACTATCTTCCGACAATGCGCTCTTTAGT
TATGTACAATGTTTCGATCGAATGCAATAGAAATGAGCTATACGCTGTGT
TCACAGATTTATCCACATTAGGATGCATCTTTTATCTTCACCATCTCAAT
GCGATTTACACTGTAGATAATCAATTTTTCGGCTGTTTTAAAGATGATTG
CGATTTTCTATTATTAAATGCATCTTCTTCGATTCTTGCAATAAGTTATG
GGAAGAGCTTGTACGATTTTTACATTTATACGAGATCTGCTTTGGAATGG
CATGATTTTCGATCGACTAAATTTACTATTTTAGCTCTTAGAATTTCGGA
TCCAATCATTAAAATGGATTTCGATTGGCTCAATGAACTAGTTTTGATTC
TAACTCCCTCAAAGATCTATCAAATAAACATTAAAAATAAATCAATTACT
CACGCGAGGATTACGACAAATTTTTCAAGCATCGATGCAGTTGCAGATCC
TATAAATGGATTGATTCATATGTTGATGCAACACAACAGCAGTCGATTTT
ACACCACCCTTCATTCTACAATCTTAGAAAATATTTCTTTCTCTAATCTC
AAATCAACGACATTAGAGATTCCGGATTCGTGTTCTCTAATTTTAGCCAG
TGATGGAACATCTATTAAAATACTCCAGTCAAATAGTTTGTTGACATTTC
AGTTGAAAAAAATGGTTTTAGTAAAAGATTTCGATTTGAGAAATGCAAAT
TTTCAGCCCCCTGTAAAACTTCAGTTGAAACAAGACACTTACGTAGTTTG
GAAAACTAATGTCAACTTCGAATTTAATGAAAACAACACGAATGTTCATA
CTTTTCATAGTCGAATGGATCACTACGCTTCTGCCAAATCAATCAACCGA
AACTCACCAACTCCTTTGATATCATTCGTAATCTTAAATTCATTTTATGG
GGATAATTTTTTATTTGTCTCGTGGAACCAGCCAATCGCAAAATGGCAAA
GTAAATTTCGCTGGAAGCTATTTTCGTATAAATTGCAATTGAGATCGAAT
CAGACAAGAGTGAGCACAATTAATGTAAATAATAAGGCACATTTCAGGTT
CTACGGTTTACGGCCAAATTCGAAATATGAAGTCATTGTTTCAACAAAGC
ATTTTTTACAATCCATTACAGGTGTTACCCTAAATTCCAAAGTCAACATT
GCTTTCCATATCTTTATTATTAAAAATGGCACTATTAAATCCATGAACTT
CAGTTTAAGAACCTTCAAACCAAAGAAATATGATTCTATTCTTAGCACTC
TTACATTAGTGAAAGATATACATATGTTTCAAAATTGTGGTTTCGTTTTA
CACCAGAATGGGTTTATTACTAGATTAGTTAATCACAGCATCACTCATAA
ATTATCTCTACAAAATGCTATTAAAATGGAAGTAGATTTCAGTACAGGAA
ACGTTTTCTTTATCGATGGCTCCAATCATTGGATTTATCGCTACCGGATC
AAAGATATGTTAATTTACGCAATTGATGTTATTACTCCTCATTGGACTGA
TGATTTCACATTATTTCCCACATTGGATGTTCTATTTTTCGGCAATGTAA
CAGGAACCTATTACACGGATCTGAATGGGCTTTCAGTTCGTCACTCCGGA
ATTTTAGAAATAAAAAATGAGCGATTATTTTGTGGTGATCATTTTGTGGA
AATCATCATATTACGTAACCAACACAGAATTTTATCCCGGTTTAAAAATG
GTTCAAGATTCCATTGCAGATCGAGTGCATTGGGCATTGTCATGACGTCC
GATTCAGGAATTTCTCTACGAAATTGGCAAGGAAACAGTTCGTTGAATTT
GATGCGCAACCACTCTGGTGTTTCTGCATTGTCAATAAAGGATTCCAGCA
TTTGCCAAGACATTTACGTGAAACCCATTCAAGCCGAGTTCATAAGCATA
TCGCGATCTAATTCTGACGACATCGTTTTGTCATGGATACCAGAAAATAA
AGATTCCCACCGTTCATATCTCGTATTTATCATCAATCACAATCGAAAAC
GACATTGGACTTTTTCAACTCATGCAACGACAATTAATTTGAAGAACTTT
TCTAGATGCTCCGATTCAATTGAATTTAGCATTAAAATACTTTATAAAAC
AACTTTTTCAGATACAGTTACAAAAAACTTTCATGTTCCGTGCACAACAA
AATTGCCAAGAATCACAGATTTATTCATAACCAAGAAGTCTATCATTGGG
AATATCCACAGATCATTGATAGAAGTGCAATCAGAATTTCAGATTTATGC
CAACACAAAAAAAATCGACTTCCAATATTCGTGTGTTTTTGTGATTTTGT
TTAGAAAGAAATTCCAGATGATATCGGAAGTTAAGAAATCGAGTGAGATT
TCATGTTTGGATCAAAAATTCTCCACAAGCTTTGAGGTGGACCAAAATTA
TCAATTTGAACTGGATGAGATTTGCGGATCAATCAGCTTCCATGATATAT
CAATAGAAAAGTGTATCGGGAATGAAATTATGAAAACCAACGCAAAGGAA
ATAATTTTATCACGCCGCCAAAAATACGTATTAACCTATTTAAACGAATC
AATAAATAGAATATTTATTGACCCAAGTGGGACATCGGTTTCCATGACTA
TTGATGGCAGTCAATTCTCTAGGAAAATATTGATTTCTGAAACACCCGTA
GATAAGTTGGAAATTGATTGGATTAAAAATGTCTTGTTTTGGAGTGAAAG
AGGTCCTGTGGAAATGAAATTGTTCAGTGTGAATTTAAACGGGATTAAAG
TTAATCTTAGAGAGGATAGATTATTGTGGATAAATCAGGATGGAATTGGA
TTTATTTGGTCAATTGACACTATTGAAAGAAAACTTCGAATCACCACCAA
TCAAAATGAATCCATTATAAACTTGGACTATGGACCAGAATGGCATGTCG
ATCATGGATACCTTGTCAACTGTGATAAATTAATCAACCATCGGAATATT
CTCAAATGCACCAATGAAAATATAAGCAAAAATTCGGTATCAGCTATTTC
TAGTTATTTTTACCCATTCAAAAATTTGATTATTTACGAAAATCTAAATA
AATTGGTCTGCAAGATTGTGACAGTTAAAAGGAACTATGTCATACCAAAC
GTGGTTTCCAGTTGTGCTGTAAAGCAGTTTTCCAATGTGAAAAACATCGA
CAGCTCAGTCTTGTCGTTGAATGAAAAAACATTAATTGATGGAATTGGGA
ACGTATATTCTTTAAGCATGTCCAACAACGCACAGTGTAACATGTCTTCT
ATCCAATTTATTAATTTATTGCTTGTCAAATGTTATCGAAATCACGCAGA
AGTTTCAATATCTTCCTCTTCCAGGAAACATATTTTCAAATTAGGAATAC
ACTATGTCAATATGGAGTCTCATGAGAATCATTCAGTGGATATCTTGGAT
AATCCGTTCAATGATCCAATTCAGCATGACATTTCCATTAATGATCTCCA
CCCGGGAATTTTCTATCAGTTTATTTTCACTTTCAATTTTACCATGTCAA
AACTTCAGGGTATTGTCACTTGTCAATGTTTTTCCAAGGATGATGTTCCG
GATTCGCCTGTAAATGTGTCTATCTTAAGACAAAATTTTACCCATAACCG
AATAATGTGGAAGCCTGGCAAAACTAATGGAGATAATATTTTAGACTATA
AAATTAAAATGAATTTCCAAAATCATCTGCAAAAGTTTAATTCGATTAAG
AACACTTATTTCGACATCGCTAAGAGCAATCAGACTGGGACAATATCAGT
TGAAGCTAGAAATATAGTCGGGTTCAGTTTGCCGAGTTATCTCTCCTTGA
AACTTACGGATACAAGGAAACAAATCAGTCACTATTACCTTCATTCTACA
ATGACTTTCTCTACTTCACTCTTTCTTATCATAGTTTTGGTATCGGTTTC
ATTGATACTCATAATTTCCATGTACATTCATCATAGGAAAACAAAACGCA
ATAATAAATTAATAAAGTCCAATATCATTGTAGATGCTCAAACGTTTGAG
CTGATGAATGTCAATCAAGGAATAAAATATGAAATTAATAGTCTATATGG
TTTCGAAAAACTTCCTCTGACAAACTTTGACAAGATTCCTCACATCCTCA
ACGAGTGTCTAAATTACTCCCATCTTATCGGAAATGGTGCCTTTGGAATG
GTGTTCAAAGGAACTATGACTGTCGAATCAGATAACAAAACCTCTCAAAA
GCCAGTCGCTTTGAAAATTCGAAATGGGAAATCAATTAGCGAAGAGGATT
TTAAACGAGAGGCGGTTTTGCTATTTAAATACGGTCATCCAAACATTGTT
ATATTGTTGGGAGTGAGTTTCGATTGTCCCGACAAGCAATGCCTTATTCT
GGAGTACATGGAGAAGGGCAACCTCCGTCAATATCTGCAGCACCACCGAC
CCGATGTCATTCGGCAGAAACTGAAAAATAATTCAACTAAAAGACTTATA
AATGAGAATTCAATTTTAGATACAAAAGACTTGATCAGTATAGCTTCTGA
TATTCTGGAGGCATTGAAATTTTTGGAGGAAAAGAATTTTGTGCATAGGG
ATATCGCCGCTAGAAATTGTTTGGTAAGCATTCATAATAAAAACAAACGA
ATCACAAAACTTGGTGATTTCGGATTGGCTAGGGACATTTATTTCGATGA
ATATTACAGGAAAACCAGTGAAACTAAAATGCCAATTAGATGGATGGCAC
CAGAAACGATAAAAGATGGAATCTTTAGTGGAAAATCAGACGTCTGGTCT
TTTGGAGTTCTTTGTTGGGAAATCATGACATTTGGTGCTGATCCTTACAT
GGGGCAAACGAACGCAGAGGTGTTAAAGGATGTTATTGATGGCAAGCAGT
TGGGTCGTCCGGAAACCTGTCCAATTGATGTTTACGAAATGATGCTTCAA
TGTTGGAAATATTATCCCGAATGTCGACCAAGGTTTCTGGAAATCGACTT
AATCTTTCAATATTTCGATGGACCTAGAGACATTGAAGAAACTTCAACAT
TGAGTCGATTGGTTATGCGCAGTTATAATTCGAGTCATGAATCGGAATTC
GGCATAAATTCTGATCCGGTAACTGAAAAAACATCGATTGCATTTTCGGA
AAAATACCCAGAAATTGGTTCTCTGCCGCCGCCCACTGTGGAAAATGTGA
CAGTGAGGAAGAATTATGATAATTTAGGTTATGAAGTCCCATTGTCTCCG
GCAATAATTACCAAGCAGGAATCGGTTTTCCTCCACTACTCCAACGATGC
AAATTGAACCGGAACTATTTTCATAAATCAATAAATACATTTTCCTTTTA
CAAA
back to top

protein sequence of SMED30004366-orf-1

>SMED30004366-orf-1 ID=SMED30004366-orf-1|Name=SMED30004366-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1835bp
MLLLASFCFLAASVWPLSGIIIADNQRSFSVISIESINIKTVRIEWKIEE
KLIKQLHMFNLVACINTSAERNYNYLPTMRSLVMYNVSIECNRNELYAVF
TDLSTLGCIFYLHHLNAIYTVDNQFFGCFKDDCDFLLLNASSSILAISYG
KSLYDFYIYTRSALEWHDFRSTKFTILALRISDPIIKMDFDWLNELVLIL
TPSKIYQINIKNKSITHARITTNFSSIDAVADPINGLIHMLMQHNSSRFY
TTLHSTILENISFSNLKSTTLEIPDSCSLILASDGTSIKILQSNSLLTFQ
LKKMVLVKDFDLRNANFQPPVKLQLKQDTYVVWKTNVNFEFNENNTNVHT
FHSRMDHYASAKSINRNSPTPLISFVILNSFYGDNFLFVSWNQPIAKWQS
KFRWKLFSYKLQLRSNQTRVSTINVNNKAHFRFYGLRPNSKYEVIVSTKH
FLQSITGVTLNSKVNIAFHIFIIKNGTIKSMNFSLRTFKPKKYDSILSTL
TLVKDIHMFQNCGFVLHQNGFITRLVNHSITHKLSLQNAIKMEVDFSTGN
VFFIDGSNHWIYRYRIKDMLIYAIDVITPHWTDDFTLFPTLDVLFFGNVT
GTYYTDLNGLSVRHSGILEIKNERLFCGDHFVEIIILRNQHRILSRFKNG
SRFHCRSSALGIVMTSDSGISLRNWQGNSSLNLMRNHSGVSALSIKDSSI
CQDIYVKPIQAEFISISRSNSDDIVLSWIPENKDSHRSYLVFIINHNRKR
HWTFSTHATTINLKNFSRCSDSIEFSIKILYKTTFSDTVTKNFHVPCTTK
LPRITDLFITKKSIIGNIHRSLIEVQSEFQIYANTKKIDFQYSCVFVILF
RKKFQMISEVKKSSEISCLDQKFSTSFEVDQNYQFELDEICGSISFHDIS
IEKCIGNEIMKTNAKEIILSRRQKYVLTYLNESINRIFIDPSGTSVSMTI
DGSQFSRKILISETPVDKLEIDWIKNVLFWSERGPVEMKLFSVNLNGIKV
NLREDRLLWINQDGIGFIWSIDTIERKLRITTNQNESIINLDYGPEWHVD
HGYLVNCDKLINHRNILKCTNENISKNSVSAISSYFYPFKNLIIYENLNK
LVCKIVTVKRNYVIPNVVSSCAVKQFSNVKNIDSSVLSLNEKTLIDGIGN
VYSLSMSNNAQCNMSSIQFINLLLVKCYRNHAEVSISSSSRKHIFKLGIH
YVNMESHENHSVDILDNPFNDPIQHDISINDLHPGIFYQFIFTFNFTMSK
LQGIVTCQCFSKDDVPDSPVNVSILRQNFTHNRIMWKPGKTNGDNILDYK
IKMNFQNHLQKFNSIKNTYFDIAKSNQTGTISVEARNIVGFSLPSYLSLK
LTDTRKQISHYYLHSTMTFSTSLFLIIVLVSVSLILIISMYIHHRKTKRN
NKLIKSNIIVDAQTFELMNVNQGIKYEINSLYGFEKLPLTNFDKIPHILN
ECLNYSHLIGNGAFGMVFKGTMTVESDNKTSQKPVALKIRNGKSISEEDF
KREAVLLFKYGHPNIVILLGVSFDCPDKQCLILEYMEKGNLRQYLQHHRP
DVIRQKLKNNSTKRLINENSILDTKDLISIASDILEALKFLEEKNFVHRD
IAARNCLVSIHNKNKRITKLGDFGLARDIYFDEYYRKTSETKMPIRWMAP
ETIKDGIFSGKSDVWSFGVLCWEIMTFGADPYMGQTNAEVLKDVIDGKQL
GRPETCPIDVYEMMLQCWKYYPECRPRFLEIDLIFQYFDGPRDIEETSTL
SRLVMRSYNSSHESEFGINSDPVTEKTSIAFSEKYPEIGSLPPPTVENVT
VRKNYDNLGYEVPLSPAIITKQESVFLHYSNDAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0016740transferase activity
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0005515protein binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR020635Tyr_kinase_cat_dom
IPR013783Ig-like_fold
IPR0110426-blade_b-propeller_TolB-like
IPR017441Protein_kinase_ATP_BS
IPR002011Tyr_kinase_rcpt_2_CS
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR003961FN3_dom
IPR011009Kinase-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane