Protocadherin-11 X-linked

Overview
NameProtocadherin-11 X-linked
Smed IDSMED30004358
Length (bp)3447
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-11 X-linked (SMED30004358) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30004358) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-11 X-linked (SMED30004358) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30004358) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004358

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30004358SMESG000066775.1 dd_Smed_v4_13412_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30004358SMESG000066775.1 SmedASXL_013819SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30004358SMESG000066775.1 dd_Smed_v4_13412_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004358SMESG000066775.1 dd_Smed_v4_13412_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004358SMESG000066775.1 dd_Smed_v4_13412_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30004358SMESG000066775.1 dd_Smed_v4_13412_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004358SMESG000066775.1 dd_Smed_v4_13412_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004358SMESG000066775.1 dd_Smed_v4_13412_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004358SMESG000066775.1 dd_Smed_v6_13412_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004358SMESG000066775.1 OX_Smed_1.0.00549ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30004358SMESG000066775.1 dd_Smed_v4_13412_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30004358SMESG000066775.1 dd_Smed_v4_13412_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 228.024 bits (580), Expect = 2.926e-60
Identity = 199/699 (28.47%), Postives = 315/699 (45.06%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIR--FDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNL--DREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM-KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTN 2499
            F +    + I EN  IG+ +P+P+A D+D+   GV +Y          E Q           Q+      QEE  P L ++ N+DRE + S+   +   D G+  +  S  + V V D NDNAP++ + +Y+  + E    G  ++++ AND D     N  + Y      E   +V ++  ++ N   +T   + G ++R ++   R  + A D   N +     V + ++D ND+ P I I         +    + E+  ++  +  VQV D D+G N    C +       L+       D+   Y ++T   T  D EK+  YT+EI  VD GNP +SS     + ++DVNDNAP F   +      ENN  G  + ++ A D DS +N  +VYS+     +   F IS   GEIQ K   DRE+ +SYE  V A D G P L  +  V V + D ND  P F    Y F + E+         +  +   D D G+N  V                +L  E  N   V  +G  ++  +L  DRE+ S+    ++A D G P  S    + I VLD NDNAP    PSN  + + ++ +  +G+T+  V  +D D G+N  + +S+   N     P+ +   G    A T+ KE         RL++K SD G+ P+   A +++    +L N
Sbjct:  168 FASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASY----------ELQAGPEAQELFGLQVAE---DQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSD--QGANAEIEYTFHQAPE---VVRRLLRLDRNTGLIT---VQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENM---PALSPVGMVTVIDGDKGENAQV----------------QLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGN-----PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLAN 818          

HSP 2 Score: 107.457 bits (267), Expect = 7.723e-23
Identity = 82/305 (26.89%), Postives = 138/305 (45.25%), Query Frame = 1
Query: 1429 VDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIYGEIQSKIK-------FDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL-----FPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTIT 2292
            V  G+P +   Q   I + D+NDN P F + +    + EN  IGS      A D D+  NG   Y +     + + F + +  + + K          DRE+ DSY+  +  +D G P    S +++V + D ND  P FE+  Y   ++E+   S     + Q+KA D D G N  ++Y       +           +R L+++  + G I+V G +DRE++S+++  V A D G    S    +++ V D+NDNAP          ++     N+S +      +  V+  D D+G N  +T
Sbjct:  144 VQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSEN---SPIGHSVIQVKANDSDQGANAEIEYTFHQAPEV-----------VRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVT 431          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 226.868 bits (577), Expect = 3.454e-60
Identity = 199/699 (28.47%), Postives = 315/699 (45.06%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIR--FDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNL--DREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM-KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTN 2499
            F +    + I EN  IG+ +P+P+A D+D+   GV +Y          E Q           Q+      QEE  P L ++ N+DRE + S+   +   D G+  +  S  + V V D NDNAP++ + +Y+  + E    G  ++++ AND D     N  + Y      E   +V ++  ++ N   +T   + G ++R ++   R  + A D   N +     V + ++D ND+ P I I         +    + E+  ++  +  VQV D D+G N    C +       L+       D+   Y ++T   T  D EK+  YT+EI  VD GNP +SS     + ++DVNDNAP F   +      ENN  G  + ++ A D DS +N  +VYS+     +   F IS   GEIQ K   DRE+ +SYE  V A D G P L  +  V V + D ND  P F    Y F + E+         +  +   D D G+N  V                +L  E  N   V  +G  ++  +L  DRE+ S+    ++A D G P  S    + I VLD NDNAP    PSN  + + ++ +  +G+T+  V  +D D G+N  + +S+   N     P+ +   G    A T+ KE         RL++K SD G+ P+   A +++    +L N
Sbjct:  168 FASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASY----------ELQAGPEAQELFGLQVAE---DQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSD--QGANAEIEYTFHQAPE---VVRRLLRLDRNTGLIT---VQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENM---PALSPVGMVTVIDGDKGENAQV----------------QLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGN-----PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLAN 818          

HSP 2 Score: 106.686 bits (265), Expect = 1.294e-22
Identity = 88/337 (26.11%), Postives = 148/337 (43.92%), Query Frame = 1
Query: 1375 DTSFDREKIS-----------VYTVEIKCVD---QGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIYGEIQSKIK-------FDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL-----FPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTIT 2292
            +TS DRE +            +   E+   D    G+P +   Q   I + D+NDN P F + +    + EN  IGS      A D D+  NG   Y +     + + F + +  + + K          DRE+ DSY+  +  +D G P    S +++V + D ND  P FE+  Y   ++E+   S     + Q+KA D D G N  ++Y       +           +R L+++  + G I+V G +DRE++S+++  V A D G    S    +++ V D+NDNAP          ++     N+S +      +  V+  D D+G N  +T
Sbjct:  112 ETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSEN---SPIGHSVIQVKANDSDQGANAEIEYTFHQAPEV-----------VRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVT 431          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDHGB6 (protocadherin gamma subfamily B, 6 [Source:HGNC Symbol;Acc:HGNC:8713])

HSP 1 Score: 202.216 bits (513), Expect = 5.947e-53
Identity = 196/708 (27.68%), Postives = 322/708 (45.48%), Query Frame = 1
Query:  184 VEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKL--YLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIY-------KIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-------EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTI-------IIEVL-DLNDNAPVFLFPSNNMNF 2202
            + +S+ E    G VVGN+   L        +  ++ + +  +FS++  SGDL+VK+ +DRE IC+  +  C ++L   ++   +   +++ I D+ND+ P F   +  + I E+   GT   L  A D D     +K Y I                N+  +F +    +     YP L + K +DREE  S   IL A D G+  ++ +  + + V D NDN P +++D Y++++ E    G  +L++ A D+D+    N  ++Y      +  K    +F ++     + NN+     +     + + A DG G   +  V I I D ND+ P I I +   ++LEN    +++   + +D D G NG   C           NI  D  F IY       K+ T  D + DRE+   Y V I   D+G P +SS +  ++ + D+NDNAP F     + HV ENNP G+++ QV A D D   NGHI YSI+ S+ +  A+S Y       G + ++  FD E+  ++   + ARD+G P L+ ++ ++V + D ND  P         +   FF +     E      + ++ A D D G N  + Y ++     G+         LR        G +     L   + +  +LLV   D G P LS T T+       + E+L DL+D  PV   P   + F
Sbjct:   33 IRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLRVSAEKLHFSVDAESGDLLVKNRIDREQICKERRR-CELQLEAVVENPLNIFHVIVVIEDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKI----------------NSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEYRISLSENLPPGSPVLQVTATDQDE--GVNAEINYYFRSTAQSTK---HMFSLDEKTGMIKNNQSFDFEDVERYTMEVEAKDGGGLSTQCKVIIEILDENDNSPEIIITSLSDQILENSPPGMVVALFKTRDLDFGGNGEVRC-----------NIETDIPFKIYSSSNNYYKLVT--DGALDREQTPEYNVTIVATDRGKPPLSSSRSITLYVADINDNAPVFDQTSYVVHVAENNPPGASIAQVSASDPDLGLNGHISYSIVASDLEPLAVSSYVSVSAQSGVVFAQRAFDHEQLRAFALTLQARDHGSPTLSANVSLRVLVGDRNDNAPRVLYPALGPDGSAFFDMVPRSAE--PGYLVTKVVAVDADSGHNAWLSYHVLQASEPGL-----FSLGLRT-------GEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADNLQEILPDLSDR-PVLSDPQAELQF 690          

HSP 2 Score: 94.7449 bits (234), Expect = 5.828e-19
Identity = 88/297 (29.63%), Postives = 137/297 (46.13%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI--------YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI 2340
            + I DVND+AP+F  K     + E+   G+ +    A D D + N    Y I NSN  F++ +        Y E+  +   DRE+  S+  ++TA D G+P  + +  +++ ++D ND  PVF +D + RI+ S      +  L Q+ ATD+D G N  + Y             S  ++           G I    + D E++    + V+A D G   LST   +IIE+LD NDN+P  +  S +   +  S     G  +   KT+DLD G NG      +  N   + PFKI
Sbjct:  121 VVIEDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKI-NSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEY-RISLSENLPPGSPVL-QVTATDQDEGVNAEINYYF----------RSTAQSTKHMFSLDEKTGMIKNNQSFDFEDVERYTMEVEAKDGG--GLSTQCKVIIEILDENDNSPEIIITSLSDQILENSPP---GMVVALFKTRDLDFGGNGE-----VRCNIETDIPFKI 394          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDHGB6 (protocadherin gamma subfamily B, 6 [Source:HGNC Symbol;Acc:HGNC:8713])

HSP 1 Score: 202.601 bits (514), Expect = 1.072e-52
Identity = 196/708 (27.68%), Postives = 322/708 (45.48%), Query Frame = 1
Query:  184 VEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKL--YLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIY-------KIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-------EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTI-------IIEVL-DLNDNAPVFLFPSNNMNF 2202
            + +S+ E    G VVGN+   L        +  ++ + +  +FS++  SGDL+VK+ +DRE IC+  +  C ++L   ++   +   +++ I D+ND+ P F   +  + I E+   GT   L  A D D     +K Y I                N+  +F +    +     YP L + K +DREE  S   IL A D G+  ++ +  + + V D NDN P +++D Y++++ E    G  +L++ A D+D+    N  ++Y      +  K    +F ++     + NN+     +     + + A DG G   +  V I I D ND+ P I I +   ++LEN    +++   + +D D G NG   C           NI  D  F IY       K+ T  D + DRE+   Y V I   D+G P +SS +  ++ + D+NDNAP F     + HV ENNP G+++ QV A D D   NGHI YSI+ S+ +  A+S Y       G + ++  FD E+  ++   + ARD+G P L+ ++ ++V + D ND  P         +   FF +     E      + ++ A D D G N  + Y ++     G+         LR        G +     L   + +  +LLV   D G P LS T T+       + E+L DL+D  PV   P   + F
Sbjct:   33 IRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLRVSAEKLHFSVDAESGDLLVKNRIDREQICKERRR-CELQLEAVVENPLNIFHVIVVIEDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKI----------------NSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEYRISLSENLPPGSPVLQVTATDQDE--GVNAEINYYFRSTAQSTK---HMFSLDEKTGMIKNNQSFDFEDVERYTMEVEAKDGGGLSTQCKVIIEILDENDNSPEIIITSLSDQILENSPPGMVVALFKTRDLDFGGNGEVRC-----------NIETDIPFKIYSSSNNYYKLVT--DGALDREQTPEYNVTIVATDRGKPPLSSSRSITLYVADINDNAPVFDQTSYVVHVAENNPPGASIAQVSASDPDLGLNGHISYSIVASDLEPLAVSSYVSVSAQSGVVFAQRAFDHEQLRAFALTLQARDHGSPTLSANVSLRVLVGDRNDNAPRVLYPALGPDGSAFFDMVPRSAE--PGYLVTKVVAVDADSGHNAWLSYHVLQASEPGL-----FSLGLRT-------GEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADNLQEILPDLSDR-PVLSDPQAELQF 690          

HSP 2 Score: 94.7449 bits (234), Expect = 5.867e-19
Identity = 88/295 (29.83%), Postives = 136/295 (46.10%), Query Frame = 1
Query: 1480 IIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI--------YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI 2340
            I DVND+AP+F  K     + E+   G+ +    A D D + N    Y I NSN  F++ +        Y E+  +   DRE+  S+  ++TA D G+P  + +  +++ ++D ND  PVF +D + RI+ S      +  L Q+ ATD+D G N  + Y             S  ++           G I    + D E++    + V+A D G   LST   +IIE+LD NDN+P  +  S +   +  S     G  +   KT+DLD G NG      +  N   + PFKI
Sbjct:  123 IEDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKI-NSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEY-RISLSENLPPGSPVL-QVTATDQDEGVNAEINYYF----------RSTAQSTKHMFSLDEKTGMIKNNQSFDFEDVERYTMEVEAKDGG--GLSTQCKVIIEILDENDNSPEIIITSLSDQILENSPP---GMVVALFKTRDLDFGGNGE-----VRCNIETDIPFKI 394          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDHGB5 (protocadherin gamma subfamily B, 5 [Source:HGNC Symbol;Acc:HGNC:8712])

HSP 1 Score: 198.749 bits (504), Expect = 6.259e-52
Identity = 194/707 (27.44%), Postives = 320/707 (45.26%), Query Frame = 1
Query:  181 NVEFSVDENCRIGHVVGNVYSKLN----QLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQ--ENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQE-EIYPSLEIIKNIDREEFVSFVFILIATDFGNQ--TGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-------EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTI-------IIEVL-DLNDNAPVFLFPSNNMNF 2202
             + + + E    G VVGN+ + L     +LP       ++ + +  YF+++  SG+L+V S LDRE IC   K  C+++     +       + +   + N    + TQ    +Q  E+   GT + L VA+D D     ++ Y +             ++  +F        K KQ+   YP L + K +DRE+      +L A D G+   +G+  + + VTD NDN P + +D Y+V+++E    G  +L++ A D+D+    N  ++Y    RT       QIF +N     +T  +           + +   DG G + + +V+I I+D ND+ P ++  +    +LEN     ++  +++ D+D G NG   C L   G++  K I    N   YK+ T  D + DRE+   Y V I   D+G P +SS     ++I DVNDNAP F     +  V ENNP G+++ QV A DLD   NG + YSI+ S+ +  A++ Y       G + ++  FD E+  ++E  + ARD G P L+ ++ ++V + D ND  P         +    F +     E      + ++ A D D G N  + Y ++     G+         LR        G +     L   + +  +LLV   D G P LS T T+       + EVL D+ D  PV   P   + F
Sbjct:   32 QIRYRIPEEMPKGSVVGNLATDLGFSVQELPTRK----LRVSSEKPYFTVSAESGELLVSSRLDREEIC-GKKPACALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKL-------------SLNPSFSLII----KEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDE--GINSEITYSFY-RT------GQIFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQ--GEVPFKIISSSKNS--YKLVT--DGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAE--PGYLVTKVVAVDADSGHNAWLSYHVLQASEPGL-----FSLGLRT-------GEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDITDR-PVPSDPQAELQF 686          

HSP 2 Score: 160.229 bits (404), Expect = 1.586e-39
Identity = 136/451 (30.16%), Postives = 211/451 (46.78%), Query Frame = 1
Query: 1120 MNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQV-KDEDKGRNGM--FECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGE-SIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI------QPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLG 2439
            +N   V++ IED NDH P  +  N F   +    Q      ++V +D D G N +  ++ SLN S  L +K  +    +    +E     + DRE+ S + + +  +D G+P +S   +  I + D NDN P F   +    + EN P G+TV QV A D D   N  I YS   +   F++ S  GEI ++ K D E+T  Y  VV  RD G   L     V++ IQD ND +P   +  F  + E   E ++    +  IK  D+D G+NG V  +L    P  I  +SK      N  K+  DG       LDRE+     + + A D G P LS++ ++I+ + D+NDNAPVF         V+V      G +I  V   DLD G+NG +++S++ S+     P  +        +  ++ A    ++   R+    L ++A D G
Sbjct:  114 LNFYHVNVEIEDINDHTPKFT-QNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEK----TLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQIFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGG--GLVAQCTVEINIQDENDNSP---EVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSK------NSYKLVTDG------TLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVF---HQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLE---PLALASYVSMSAQSGVVFAQRAFDYEQLRTF--ELTLQARDQG 534          

HSP 3 Score: 159.844 bits (403), Expect = 2.508e-39
Identity = 154/577 (26.69%), Postives = 262/577 (45.41%), Query Frame = 1
Query:  844 PEWTKDNYKVNIQECQSEGD--ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKL-HLTNNRISGLINRNNIRIYITATDGNGR--MNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHI--------VYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITE--SYGESIKNERLEQIKATDKDLGQNGTVKYRLI--DVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPS----NNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNP 2508
            P++T++++++ I E    G   ILE +A D D     N L  Y+LS       I+ +    +G+K   L   +      ++  R+ +TA DG        T + I + D ND+PPV +       + EN      +  V   D+D+G N     S   +G++      F  N    +I T      D E+   Y++ ++  D G   + +     INI D NDN+P       +  ++EN   G+ +  ++  D DS  NG +         + I++S+ N       ++ +    DRE+T  Y   +TA D G+P L+ S+ V + I+D+ND  PVF +  Y   + E    G SI      Q+ A+D DLG NG V Y ++  D++P+ +     + A+          G +      D E++ + +L +QA D G P+LS   ++ + V D NDNAP  L+P+     +  F  V    E G  +  V   D D G N  +++ ++ +++   F   ++  GE+  A  + +    R    RL++   D GQ P +  ATL++ +  SL  + P
Sbjct:  131 PKFTQNSFELQISESAQPGTRFILE-VAEDAD--IGLNSLQKYKLSLNPSFSLIIKE--KQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQI------FSLNSKSGEITT--QKKLDFEETKEYSMVVEGRDGG--GLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSKNSY-----KLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIA-----QVCASDLDLGLNGQVSYSIMASDLEPLALASYVSMSAQ---------SGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLR-TGEVRTARALGDRDAAR---QRLLVAVRDGGQPPLSATATLHLVFADSLQEVLP 669          

HSP 4 Score: 87.8113 bits (216), Expect = 7.121e-17
Identity = 91/287 (31.71%), Postives = 133/287 (46.34%), Query Frame = 1
Query: 1504 PRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAISI-YGEIQSKIKFDREK------TDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYF-FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGA----ISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEI--GKTICTVKTKDLDQGINGTITHSLINSNK 2316
            P    +I+ + + E  P GS VG + A DL  S        +  S++   F +S   GE+    + DRE+        + EF   A    E  LN    V V+I+DIND TP F ++ F  +I+ES   +    R     A D D+G N   KY+L             L      +IK   DG+    +++   LDRE+ S  +L++ A D G+P LS TT + I+V D NDN PVF     N +   VS+   +  G T+  V   D D+GIN  IT+S   + +
Sbjct:   27 PALCEQIR-YRIPEEMPKGSVVGNL-ATDLGFSVQELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVA----ENPLN-FYHVNVEIEDINDHTPKFTQNSFELQISES---AQPGTRFILEVAEDADIGLNSLQKYKL------------SLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVF-----NRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQ 286          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 160.614 bits (405), Expect = 2.078e-39
Identity = 168/560 (30.00%), Postives = 258/560 (46.07%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNN---------IRIYITATDGNGRMNETS--VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKI----SVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAI-SVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNF-VNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQP-EGEIIIAHTM--KEFSNFRSLPDRLIIKASDLGQNPKN 2454
            +P + KD+Y   I+E    G  +L + A D D  + +NG + Y L +              NG  L L  N  SG+I             IR+ + A+D      E++  V+I + D ND+ PV +  +    +LEN     ++ TV+  DED G NG    S+  S  +    I +                  RE+I    S  T  I+  D   PA+SS    +IN+ID+ND+AP  +   KM  + EN  IG  VG+V A+D DS  NG I YS+  S D       G I++    DRE T  Y   VTARD G P LN S  + V ++DIND  P F+ K+Y   I+E   E  +  ++  +KA D D  Q   + YR+            +   E+ +++ +   GAI SV G L R++   +++ + A D G   L     + + + D+N +AP F    N+  F V +     IG  + T+K +D D+G N  I +S+ +S       F+I P  G+I ++  +  ++ + F      +I+ ASD    P N
Sbjct:  267 SPIFEKDSYFGEIREDAPIGTTVLSVFARDLD--SGENGEIEYSLGEG-------------NGKNL-LAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTL-----------RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISE---EMPRGSQIITLKAVDNDEDQK--ITYRI-----------EEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYF----NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF-----FRIDPSSGDISVSSDLDREDRATF-----SVIVTASDHASPPLN 765          

HSP 2 Score: 128.257 bits (321), Expect = 2.081e-29
Identity = 156/608 (25.66%), Postives = 269/608 (44.24%), Query Frame = 1
Query:  487 TTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQG--IDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQT--GSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNN--IRIYITATDGNGRMNETSVDIAIEDCN------DHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLI---DVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPV---FLFPSNNMNFVNVSVEWEIG 2232
              QK+I ++EN+ IG       A D+DS   G+  Y +   +   ID+++ +                         ++  K +DRE    +   + A D G  +   S T+ V++ D+NDNAP + K  Y V I E    G  I+ L A D D+    +  ++Y++ +   DR++ S I  I      L+   +SG + R +  +R+ I+ATD  G      V++ I+D N      DHP  +       K+ E+      + T++ +D D+G N     S++ S     +  R D +     + +      DRE  + ++V +   D  +P +++  +  + + D+NDN+P+F +      + E+ P+G++  QV A+D D   NG + Y +  S+ + +I ++      G ++   K DRE+       + ARD G P L+ +  + + + D+ND  P FE+  Y   I E+   S     +  I A D D G N  + +R+    D K   I  +++    +R L +  FD            + SS QL            S+T  + I V D+NDN P    F+   N   F NV +  +IG
Sbjct:  481 AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGL-------------------------IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE----DQKITYRIEE--ADREVFS-ILDIGDQGAILS---VSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSV-------KIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-----QFFRIDPSSGDISVSS----DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN---SPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL------------SSTVPVRIHVSDVNDNKPALKDFVILMN--RFDNVQMARQIG 1020          

HSP 3 Score: 125.561 bits (314), Expect = 1.461e-28
Identity = 133/477 (27.88%), Postives = 216/477 (45.28%), Query Frame = 1
Query:  931 DDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATD-GNGRMN-ETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNE-----RLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            D+ +  NG++ Y + + +ED       F I+ +   +   +   L++R     Y   +TA D G   +N  T++ + ++D ND+ P          + E   +   + T++  D D+ +   +     D    ++ +I   D  AI  +         R+   V  VEI   DQG   +      ++ I DVN +AP F +      + E++PIG  V  ++A D D  +N  IVYSI +S+  F I    G+I      DRE   ++  +VTA D+  P LN S  ++V + DIND +P F        + SY  +I  +        Q+ A D D+G NG V Y L +        +S    +L  L + S  G + V   LDRE+ + I L + A D G PSLS  + I + + D+NDNAP F   S ++     S    +G T+ T+  +D D+G N  I+  +      + F
Sbjct:  505 DEDSGPNGIIKYSM-EGSED-------FIIDEDSGLIKTTK---LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDI--GDQGAILSVSG----ELKRQDHKV-RVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF-------TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE-------SSSSPSIQLFRLDRTS--GTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENS---PVGSTVGTIVARDADEGDNADISFRIFGGADAKLF 940          

HSP 4 Score: 113.62 bits (283), Expect = 5.349e-25
Identity = 105/352 (29.83%), Postives = 169/352 (48.01%), Query Frame = 1
Query: 1498 NAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFV-NVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGKK 2526
            NA  F  +  +  + E+ PI + +  V+A    S     + YS++   D+ + +++      GEI+     DRE  D +   VTA +  +P ++ S  V V + D+ D +P+FEKD YF  I E   ++     +  + A D D G+NG ++Y L +       GN K      NL+ + +  G I     LDRE +S I+L V A D G P   +T  + I V+D+NDNAPVF   S N+  + N++    I   I TVK  D D G NG + +S+ +S+            GE+    T++E  + ++ P   +I+A D  Q   ++   L I  I  + +  PT I  +
Sbjct:  161 NAVHFQQEKYVKELPEDTPIETIIASVKASHASSQP---LYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIRE---DAPIGTTVLSVFARDLDSGENGEIEYSLGE-------GNGK------NLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENIT----IPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYS-TGEV----TLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVI-DINDHAPTLIAAQ 483          

HSP 5 Score: 109.383 bits (272), Expect = 1.288e-23
Identity = 164/650 (25.23%), Postives = 280/650 (43.08%), Query Frame = 1
Query:  193 SVDENCRIGHVVGNVYS-KLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQEN-QVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATD-GNGRMN-ETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGK-LNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAISIYGE------IQSKIKFDRE-KTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLID---VKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQ 2088
            +++EN  IG  VG VY+   +  PN      M+ +E    F ++  SG +     LDRET    + +  +  +       +  I + + DINDN P F   +  + I E +P G+      A D D  +   K  Y  R +  D+E   +  IG+      +     +Q+             R E       + ATD G   G C V V + DVN  AP +    + V I E    G  ++ L A D D     N  + Y +          SQ F I+ +   ++ +      +R    + +TA+D  +  +N  T +++ ++D ND+ P  + ++    + E+         V   D D G NG+ +  LN+S    +++  R D      ++ +      DRE+ +V  + I   D+G P++S+  + ++ + DVNDNAP F       ++ EN+P+GSTVG + A D D  +N  I + I    D   F I    E      I ++ +FD E K + + F + A      QL+ ++ V++ + D+ND  P  +   F  +   +       ++  I A D D  QN T++Y L +   ++     G   +K E +  + VSF   +S   N +      I +LV+
Sbjct:  487 TLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ---KITY--RIEEADREVFSILDIGDQGAILSVSGELKRQDHKV----------RVE-------ISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHD--RGDNARIVYSIDS--------SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSS----KLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALKD--FVILMNRFDNVQMARQIGFIPAFDPD--QNATLEYFLEENDLIEAEKYTGKILVKQEWKRNMDVSFKTCVSDGANTECSTCRFIHVLVE 1089          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 151.754 bits (382), Expect = 1.222e-36
Identity = 140/450 (31.11%), Postives = 214/450 (47.56%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKI----SVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAI-SVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNF-VNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQP-EGEIIIAHTM--KEFSNFRSLPDRLIIKASDLGQNPKN 2454
            V+I + D ND+ PV +  +    +LEN     ++ TV+  DED G NG    S+  S  +    I +                  RE+I    S  T  I+  D   PA+SS    +IN+ID+ND+AP  +   KM  + EN  IG  VG+V A+D DS  NG I YS+  S D       G I++    DRE T  Y   VTARD G P LN S  + V ++DIND  P F+ K+Y   I+E   E  +  ++  +KA D D  Q   + YR+            +   E+ +++ +   GAI SV G L R++   +++ + A D G   L     + + + D+N +AP F    N+  F V +     IG  + T+K +D D+G N  I +S+ +S       F+I P  G+I ++  +  ++ + F      +I+ ASD    P N
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTL-----------RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISE---EMPRGSQIITLKAVDNDEDQK--ITYRI-----------EEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYF----NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF-----FRIDPSSGDISVSSDLDREDRATF-----SVIVTASDHASPPLN 406          

HSP 2 Score: 127.872 bits (320), Expect = 2.337e-29
Identity = 156/608 (25.66%), Postives = 269/608 (44.24%), Query Frame = 1
Query:  487 TTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQG--IDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQT--GSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNN--IRIYITATDGNGRMNETSVDIAIEDCN------DHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLI---DVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPV---FLFPSNNMNFVNVSVEWEIG 2232
              QK+I ++EN+ IG       A D+DS   G+  Y +   +   ID+++ +                         ++  K +DRE    +   + A D G  +   S T+ V++ D+NDNAP + K  Y V I E    G  I+ L A D D+    +  ++Y++ +   DR++ S I  I      L+   +SG + R +  +R+ I+ATD  G      V++ I+D N      DHP  +       K+ E+      + T++ +D D+G N     S++ S     +  R D +     + +      DRE  + ++V +   D  +P +++  +  + + D+NDN+P+F +      + E+ P+G++  QV A+D D   NG + Y +  S+ + +I ++      G ++   K DRE+       + ARD G P L+ +  + + + D+ND  P FE+  Y   I E+   S     +  I A D D G N  + +R+    D K   I  +++    +R L +  FD            + SS QL            S+T  + I V D+NDN P    F+   N   F NV +  +IG
Sbjct:  122 AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGL-------------------------IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE----DQKITYRIEE--ADREVFS-ILDIGDQGAILS---VSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSV-------KIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-----QFFRIDPSSGDISVSS----DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN---SPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL------------SSTVPVRIHVSDVNDNKPALKDFVILMN--RFDNVQMARQIG 661          

HSP 3 Score: 125.176 bits (313), Expect = 1.788e-28
Identity = 133/477 (27.88%), Postives = 216/477 (45.28%), Query Frame = 1
Query:  931 DDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATD-GNGRMN-ETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNE-----RLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            D+ +  NG++ Y + + +ED       F I+ +   +   +   L++R     Y   +TA D G   +N  T++ + ++D ND+ P          + E   +   + T++  D D+ +   +     D    ++ +I   D  AI  +         R+   V  VEI   DQG   +      ++ I DVN +AP F +      + E++PIG  V  ++A D D  +N  IVYSI +S+  F I    G+I      DRE   ++  +VTA D+  P LN S  ++V + DIND +P F        + SY  +I  +        Q+ A D D+G NG V Y L +        +S    +L  L + S  G + V   LDRE+ + I L + A D G PSLS  + I + + D+NDNAP F   S ++     S    +G T+ T+  +D D+G N  I+  +      + F
Sbjct:  146 DEDSGPNGIIKYSM-EGSED-------FIIDEDSGLIKTTK---LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDI--GDQGAILSVSG----ELKRQDHKV-RVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF-------TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE-------SSSSPSIQLFRLDRTS--GTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENS---PVGSTVGTIVARDADEGDNADISFRIFGGADAKLF 581          

HSP 4 Score: 108.612 bits (270), Expect = 1.788e-23
Identity = 166/650 (25.54%), Postives = 281/650 (43.23%), Query Frame = 1
Query:  193 SVDENCRIGHVVGNVYS-KLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQEN-QVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATD-GNGRMN-ETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKL-NLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAISIYGE------IQSKIKFDRE-KTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLID---VKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQ 2088
            +++EN  IG  VG VY+   +  PN      M+ +E    F ++  SG +     LDRET    + +  +  +       +  I + + DINDN P F   +  + I E +P G+      A D D  +   K  Y  R +  D+E   +  IG+      +     +Q+             R E       + ATD G   G C V V + DVN  AP +    + V I E    G  ++ L A D D     N  + Y +          SQ F I+ +   ++ +      +R    + +TA+D  +  +N  T +++ ++D ND+ P  + ++    + E+         V   D D G NG+ +  LN+S    +++  R D      ++ +      DRE+ +V  + I   D+G P++S+  + ++ + DVNDNAP F       ++ EN+P+GSTVG + A D D  +N  I + I    D   F I    E      I ++ +FD E K + + F + A      QL+ ++ V++ + D+ND  P   KD F  +   +       ++  I A D D  QN T++Y L +   ++     G   +K E +  + VSF   +S   N +      I +LV+
Sbjct:  128 TLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ---KITY--RIEEADREVFSILDIGDQGAILSVSGELKRQDHKV----------RVE-------ISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHD--RGDNARIVYSIDS--------SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSS----KLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPAL-KD-FVILMNRFDNVQMARQIGFIPAFDPD--QNATLEYFLEENDLIEAEKYTGKILVKQEWKRNMDVSFKTCVSDGANTECSTCRFIHVLVE 730          

HSP 5 Score: 65.4698 bits (158), Expect = 2.853e-10
Identity = 54/186 (29.03%), Postives = 86/186 (46.24%), Query Frame = 1
Query: 1771 VVKVKIQDINDCTPVFEKDYFFRITESYGESIKN-----ERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNF-VNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINS 2310
            +V++ + D+ND  PVF  D       SY  +I         +  +KATD+D G NG V Y +     IG             L      G +++   +D +  S I  +++A D   P+LS+T  + I V+D+ND+AP  +     +    NV++  E+G+    V   D D G NG I +S+  S
Sbjct:    1 MVEITVVDVNDNAPVFASD-------SYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIG------------GLTIDYSTGEVTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGR----VYAIDEDSGPNGIIKYSMEGS 162          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 129.413 bits (324), Expect = 8.436e-30
Identity = 170/710 (23.94%), Postives = 302/710 (42.54%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXX--XAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNG---RMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDN--APRFVNKIKMFHVVENNPIGSTVGQVRAM---DLDSSNNGHIVYSILNSND--NFAISIYGEIQSKIKFDREKTDSYEFVVTARDNG-----EPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYG--NLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGKKSHSSDNN 2547
            F +  +++ + E+ PIGT      A D+D+   G   Y I    G   E  V T+        + +  SK         ++K  ++ E +     + A D G    S   T+ +   +   ++P++ + +Y + I E +  G DI ++ AND D  N  NG + + L +  E   ++S        KL  + +R        ++  +       G   R++ T++ I++ED ND+PP   + +   ++ E+      ++ +   DED G+N   +  LN S K+     R D +     I   P+   D  K   + + I+  D G+P +S+     + ++D+  N  A  F +  K   V EN+ IG+ V  + A    D       ++ Y I+  +   +F+I   G +++    DRE   +Y   V ARD+      +P+  D + V ++I D ND  PV +K  Y   + E+   ++   ++E   A D D      + +++    P      S  + +L +       G I+  G   LDRE+ S  +L V   D G P L +   +I+ VLD NDN+P F          + SV  +    +C +   D D+G N  +T+++   + R    F I   G II +  +    ++      L ++A+D G   +   AT  +        L   S G+K   S N+
Sbjct:  608 FSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHE--VLTVDEQSGEITVASDLSK---------LMK--EKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGN--NGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDR-----EDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLN-SEKVPF---RIDHHSGCIFIHA-PEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDP-----QSFFRIDLTS-------GYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTF-----TQAIHHYSVRSKFAGKLCRIFAVDADEGENARLTYNITEGDAR----FSIDNNGNIIASEAIHGDESY-----ALTVQATDHGTPGQQFAATRVV--------LTANSAGQKPRKSKNS 1258          

HSP 2 Score: 107.071 bits (266), Expect = 5.560e-23
Identity = 197/777 (25.35%), Postives = 335/777 (43.11%), Query Frame = 1
Query:  190 FSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSY--FSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQ--DTHAXXXXXXXXXXXXX-XXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDR-EKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQ-VRAMDLDSSNNGHIVYSILNSNDN-FAIS-IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVN-VSVEWEIGKTICTVKTKDLDQGINGTITHSL-INSNKREN---FPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYI 2475
            FSV E+  +G+V+G V     ++     + +  + E DS+  FS+ R++G +IVKS LDRE      K    M +  D     HAI  V       ++  P F    +   I E+  +GT+  +  A D+D    G   + +                        +NP     E    L +   +DRE+   +  I  ATD G        T++V+DVND+ P++ K+ + +++    S   IL    + +DD  + N +  + +    E+      +F+I+ N   L   R   + N+   ++ +TA DG    + T V I ++   D       AN+   + EN K+    T V  +    G N  F+ S ND G + + N R      I K++      +++ +++  + + I    Q N  +   +  ++ I ++NDN P+ + K+    + EN P      Q +  +  + ++   I + +++     F I  I G +      D E    +   V A D    +  D   + V + D ND  P FEK  Y  ++ ES  ESI  E L   +A+  D  QN T++Y L   KP  +     L A+          G +++   LD E +S+++L V A D G P L T   + I V+D NDNAP F        +V  V    + G+ + TVK  D+D    G +++ L I S    +    PF I   G+++I+ ++ ++   +     L + A D G+ P  + A L I
Sbjct: 2615 FSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRER-----KNQWKMTIRADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVE----------------------ENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQFEKEEFNIDLH-LPSTSPILHF--SIKDDDLSPNNVSQFFIPKGNEE-----GVFWIDSNN-DLLLKRPEIVENKMQYQLKVTAFDGVFETS-TKVKINLKSSKDSDIRCPEANKTVILAENSKKG---TVVLGESSLLGPNVTFKLSDND-GNVFVVNFRN----GIVKVKESDQIDYEKNQQLEFHRLTI----QDNSEVCK-ELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDG---EFEDKATILVTVIDQNDNAPTFEKSTYSMKVMES--ESIGYE-LAHFRASGGD--QNETIEYYL---KPSDVTSFVNLNAQT---------GILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKF----EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSI-DYEKIKKY--NLKVIAKDGGRPPLRSEALLEI 3314          

HSP 3 Score: 97.8265 bits (242), Expect = 3.643e-20
Identity = 98/383 (25.59%), Postives = 166/383 (43.34%), Query Frame = 1
Query: 1150 EDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTS-FDREKISVYTVEIK--CVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI----SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTP-VFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVK-PIGIPGNSKLKAELRNLIKVSFDGAISVYG---NLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKD 2262
            E  N H PV S      +V E+     ++  +Q  DED G NG     ++D    + + +  D+     +I    D S   +EK+ V  V++K   +D G P  SS++   + I DVN+++P+F        + EN   G  + +V A D D  NNG I +S+ N+ +  ++    +  G ++     DRE  D + F + A D G P       + + ++D+ND  P    +    RI E          +  + A D+D+GQN  +K+ L   K P  I  +S               G I ++     LD  +     L ++  D G P LST+  + +E++D+  N     F  +     +V    EIG  +  ++ K+
Sbjct:  599 ESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSG--EITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPH---GAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHS---------------GCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEF-DDVAKEASVYENSEIGTEVIMIEAKE 960          

HSP 4 Score: 88.1965 bits (217), Expect = 3.944e-17
Identity = 82/331 (24.77%), Postives = 148/331 (44.71%), Query Frame = 1
Query:  865 YKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNE--TSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYP-----DTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYF 1833
            Y  +I E   EGD + +++   DD   +N  + Y L D +E     SQ F ++  +  +T  +         + + I ATD     +   T+V++ I   +   P  S ++    V+E+     ++          GR    E  +++     +      D+F  + +E         +S DRE+ + + + I+    G   + ++   +++I DVNDNAP F    + F + E+  +G++V    AMD D S +G I +S++  N  F ++   G +    + DREK D Y+ +  A D G    N  +   + + D+ND  P FEK+ F
Sbjct: 2510 YSTSISESAKEGDTVMMVSATDDD---ENDTIEYSLLDGSE-----SQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVI----------GRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAG--GVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQFEKEEF 2818          

HSP 5 Score: 82.4185 bits (202), Expect = 2.043e-15
Identity = 92/341 (26.98%), Postives = 149/341 (43.70%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNL-IKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWE-IGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIR 2478
            + +ID NDNAP F        V+E+  IG  +   RA   D   N  I Y +  S+    +++    G +      D E   + +  V A+D+G P L     V++ + D ND  P FEK+ Y  ++ E+   S   E++  +KA D D    G V Y L  V        S+   +   L   ++ +G + +  ++D E+I    L V A D G P L +   + I V D ND+AP F    ++ N   +  E E IG  +      DLD   NG      I  +  ++  FK+  + E++ A  ++     + L   L + A D+     +   T++IR
Sbjct: 3101 VTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGD--QNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKEN---SKSGEKVLTVKALDVDSEHFGAVSYELEIV--------SETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTF----DDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKS--FKVNEKLELLTAKKLEYRKKDKYL---LTVIAKDVKGKTTDCPLTIFIR 3419          

HSP 6 Score: 82.0333 bits (201), Expect = 2.318e-15
Identity = 71/288 (24.65%), Postives = 127/288 (44.10%), Query Frame = 1
Query: 1087 IYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--------FAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGT 1926
            + + A+DG    ++ ++ + + D ND+ P    +    KV+E++     L   +    D+  N   E  L  S   +  N+                   D E +S   + +   D G P + +  +  I+++D NDNAP+F  +  +  V EN+  G  V  V+A+D+DS + G + Y +   ++         FAI+  G++      D EK   Y   V A+D G P L    ++++ ++D ND  P F+      + +  GE+I   RL +   +D D  +NG 
Sbjct: 3084 LTVVASDGEFE-DKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYLKPSDVTSFVNLNAQTGILTLA------KPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQE-GEAI-GHRLLKFSVSDLDGPKNGA 3360          

HSP 7 Score: 70.0922 bits (170), Expect = 1.010e-11
Identity = 75/300 (25.00%), Postives = 131/300 (43.67%), Query Frame = 1
Query: 1438 GNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY---GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQN-GTVKYRLIDVKPIG---IPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSN 2313
            G  A S++   ++++ID+ND  P FV       + E+   G TV  V A D D   N  I YS+L+ +++   S++   G I    K + +   +    + A D+  P  + +  V+V I   +   P F    Y F + E                 D D+G   G V+    ++  I    +PG+ +  + L   ++ S  G I V  +LDRE  +  ++ ++A  D    +   TT+ +++ D+NDNAP F     +     +S +  +G ++      D D   +G I  SL+  N
Sbjct: 2484 GRRAFSTL---TLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDD--ENDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVME-----------------DADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERS-TGKIIVKSSLDRERKNQWKMTIRA--DAAGGVHAITTVTVDIGDVNDNAPAF---HGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEEN 2755          

HSP 8 Score: 57.3806 bits (137), Expect = 9.113e-8
Identity = 87/366 (23.77%), Postives = 154/366 (42.08%), Query Frame = 1
Query: 1141 IAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTV-EIKCVDQGNPAMSSMQKFSINIIDVNDNAP---RFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYF---FRITESYGESIKNERLEQ--IKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLST--TTTIIIEVLDLNDNAPVFLFPSNNMN 2199
            + I D ND+ P       F  V E+     +L TV   D+D+G NG+   S+    + +L  I           E       D E   V ++  I+ +D    A S   + S++I + N+ AP   +F  K+    + ++   G+ V     + L++ ++G + Y +  +   F + ++ G +       + K           ++ E Q + + V+  KI   N  +P+F +  +    R     G S+ ++ L    + A D+D G NG V YR++  K                +  V  + GAI    + D E++      VQAFD G P   +   + I++ V+D ND  P   FPSN+++
Sbjct: 1455 VNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSG------EVRLAKPLDPELQHVESILRIRAIDSA--ANSLKDEMSLHIRNSNE-APETAKFDRKVYQTTLYDSTRPGTPV-----LVLNALHHGTVSYKLEPNCTFFEVHTLSGAVHLATWLTKLKHRKSVECTAIVESTEGQQDIAKVI-AKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKD-------------EQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPP--RFPSNSLD 1790          

HSP 9 Score: 56.9954 bits (136), Expect = 9.586e-8
Identity = 94/378 (24.87%), Postives = 169/378 (44.71%), Query Frame = 1
Query: 1444 PAMSSMQKFSINIIDVNDNAPRFVNKIKM-FHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN-------FAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMV---VKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDG---AISVYG---NLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVF-LFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL--INSNKRENFPFKIQPEGEIIIAHTMKEF--SNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNP 2508
            P + + +  +I I  + ++  RF++  K+     E  PIG  + ++     +  +   I YS+  S  +       FAI S  G ++   K +R +   Y F V A  +G   +N+ +    V ++I D ND  PVF   +  +     G+    + L ++ ATD+D G+NG + Y+     P+ I  N+    E+  L++V   G     +V+     L    +S++ L+   + +G    +    III+  + N ++PVF  FP      V V+ +  IG  +  ++  D D G NG I + +  I  +  E      Q  GEI +A  + +        L  +L + A D G   K+++ T+ +R I  + N +P
Sbjct:  360 PVIPTNETVTIQIERLAEHLIRFLDNEKLTLKTDEMAPIGRILYRMNVNVENPDDVSLIRYSLEYSKSDLPNATLPFAIGSKNGILRVSAKINRSER-VYNFKVIASLHG---INEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKP--GDVLVKVDATDQDEGENGKIVYKFTSELPLEINANT---GEI-TLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMF--YKNGTKIPAKPKPIIIQESE-NKHSPVFSSFP----EIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQ-SGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLR-IKDVNNHSP 718          

HSP 10 Score: 51.9878 bits (123), Expect = 3.965e-6
Identity = 63/252 (25.00%), Postives = 100/252 (39.68%), Query Frame = 1
Query: 1063 LINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTS-------FDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFV-VTARDNGEPQLNDSMVVKVK 1785
            L+ R  +R+ I+ TDG    + ++V I +       P  S ++    V E       + T++   E  G   +           NL ++  DD     KI   P +         D E        ++ V Q N  M S   FS+NI D NDN+P FV       V E++ +   +  V A D D   NG + YSI++ N+     I    GE++     D E       + + A D+    L D M + ++
Sbjct: 1326 LLKRGELRLNISVTDGQA-WDHSTVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLV---------FNLFSV--DDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQ-VQQAN--MKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIR 1562          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 117.857 bits (294), Expect = 3.271e-26
Identity = 92/289 (31.83%), Postives = 133/289 (46.02%), Query Frame = 1
Query: 1075 NNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYR 1938
            + + + I AT  +G  N+T V I IED ND+PP  S +     + E+ K       VQ  D+DK +NG    S+  S   +  +I  D     +  +    +  D E    Y + +K  D G P  SS     I+++DVNDNAP F        V+EN+P  + VG+V A D DS  NG IVY I N ++ F I    G + +K   DRE     +  + A D G P  + +   ++ + D+ND  P         I    G  +    +  I A D D G NG+V YR
Sbjct:  803 DTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGS--SIEIDQ----FTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLS--ITPIVVPAGSPLSTA-IGTIVAMDPDKGLNGSVLYR 1082          

HSP 2 Score: 89.3521 bits (220), Expect = 1.322e-17
Identity = 96/318 (30.19%), Postives = 137/318 (43.08%), Query Frame = 1
Query: 1384 FDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI----LNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDG-----YPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINS 2310
             DRE    Y + I+  D G PA     + SI IID NDNAP F        V  N  IGS +  V+A D D   N  I Y I      SN NFAIS  G I +        T  ++ +V A D+G P L+ S VV + +      +P    D  + +  +    ++N  L  I A      Q    K RLI        G+S L  +  +   V     + + G LDRE  S   L      DG     +P L T       + D+NDNAP +     + + +++S+    G +  T+  KD D G NG I +S++++
Sbjct:  191 LDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPAST--HDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPL--DIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLI--------GSSALCPQQTDQAHVYL---LLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLT-------IGDINDNAPQW-----HSSQIHISLNRTQGGS-RTLTAKDPDLGQNGWIRYSVLDT 480          

HSP 3 Score: 83.5741 bits (205), Expect = 8.214e-16
Identity = 126/510 (24.71%), Postives = 214/510 (41.96%), Query Frame = 1
Query:  844 PEWTKDNYKVNIQECQSEGDIL-ELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLI---------NRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKI--ETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTAR-DNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIK-NERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFV-NVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNK 2316
            P++ K  ++V I E    G  L +++AN+    N+K   + Y L ++ E                HLT + +SG +          + + +  + AT+ N   + + + I ++D ND+ P+         V E  K +  L  V   D D   +G F       G+++   +    +F+I  +  E +      R +   + + +   D G  +  +     I +ID +   P+F          E+   G  +G V AM         + YSI + + +   SI    G+I      D +  D+    + A   +GE   N + VV + I+D ND  P F       +  S  E +K +E    ++A+DKD  +NG V+Y +I       PG+S         I++  F G +S    LD E   + +L V+A D G P  S+  T+ I VLD+NDNAP F      M  + N   +  +GK +     +D D   NG I + + N ++
Sbjct:  538 PQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKR--IRYSLQNQDE----------------HLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMD---SGTF-------GEVSYHILSESSSFSINPVTGEVFAQKPLARGR---FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM-------SKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGES--NQTQVV-IFIEDHNDNPPQFSSSL---VEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSH----PGSS---------IEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVA----RDKDSLENGQIVYRITNGSE 986          

HSP 4 Score: 82.4185 bits (202), Expect = 1.684e-15
Identity = 71/258 (27.52%), Postives = 120/258 (46.51%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAIS---IYGEIQSKI----KFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIK-NERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAP----VFLFPSNNMNFV 2205
            + + D NDNAP F +++    + E   +G++       D D        + IL  N N  F ++   +  ++Q+ +    + DRE  D YE ++ A+D G+P     +   ++I D ND  PVF +    R T S   +I     L  ++ATD D+G+N  + Y   D+K    P NS           +S  G I+   +L     S+  ++V A D G PSLS++  + I VL    ++P    ++L  SN+ + +
Sbjct:  110 VEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRS---RYTASVSANISIGSHLITVQATDADIGENSRISY---DIKKTSAPSNSNF--------AISQSGVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLM 351          

HSP 5 Score: 77.7962 bits (190), Expect = 4.605e-14
Identity = 80/368 (21.74%), Postives = 160/368 (43.48%), Query Frame = 1
Query: 1141 IAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKF--SINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARD-NGEPQLNDSMVVKVKIQDINDCTPVFEKDYF---FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNL-DREEISSIQLLVQAFDDGYPSLSTTTTIIIEV--LDLNDNAPVFLFPSNNMNFVNVS 2214
            + + D ND+ PV +    +  + ++      +  +   D+D G NG     +     LN+  +  + +    ++  + D   D    + + + ++  D G+PA +++ K   S+ +   + +AP FV  +   HV+E+  +G+ + ++RA +     N  ++YS+        I +  GE+  K   D E        ++  D NG   +   + +K+ ++ +++  PVF K  +     I+   GES+      Q++A D+D G +G VKY + D +       S +K E          G I +   L  R  ++  Q+ V A+    P+  + TT+ +E+   D+  + P  L  S  +     S
Sbjct: 2218 VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNI--VTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAV---VPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVG-----QMQAIDEDGGVHGVVKYSISDRQ-------STVKIE-------EHTGIIRLQKPLVSRRNLTIEQITVVAYSS--PTKQSKTTVYLEIGPFDVQPSLPKLLLHSKPVQIAVAS 2559          

HSP 6 Score: 77.7962 bits (190), Expect = 4.804e-14
Identity = 103/428 (24.07%), Postives = 169/428 (39.49%), Query Frame = 1
Query: 1072 RNNIRIYITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPR----FVNKIKMFHVVENNPIGSTVGQVR-AMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGE-----PQLNDSMVVKVKIQDINDCTPVFEKDYF-FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNK 2316
            R+   + I A DG    ++ +    I I D ND+ PV S +     V  N      L TVQ  D D G N      +  +   +      + NFAI +      T+      S + V +   D G+P++SS    +I ++    ++P     ++ +    H++EN+ +GS V +V  A     +    I  S L         +Y  +   I  DRE    +        +G+     PQL       + I DIND  P +        +  + G S        + A D DLGQNG ++Y ++D + + I   +               G I V   +D    S I+  V+A D G P+LST   ++ ++LD     P F      +  V +  +  IG  +  V   +   G +  I +SL N ++
Sbjct:  196 RDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPS------NSNFAISQSGVI-TTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGI-LDRETASEHHLKFLLEKDGQIIIEHPQL-------LTIGDINDNAPQWHSSQIHISLNRTQGGS------RTLTAKDPDLGQNGWIRYSVLDTELVSIDKET---------------GRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQF---EKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDE 584          

HSP 7 Score: 75.0998 bits (183), Expect = 3.672e-13
Identity = 101/435 (23.22%), Postives = 182/435 (41.84%), Query Frame = 1
Query: 1087 IYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFG-KVLENQKQKIILTTVQVKDEDKGRNGMFECSL--NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDN------AP-RFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI--YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKAT--DKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE 2349
            + I  TDG  R +  +V + + D ND+ P +  +     ++ E+ +   +L   +  D D G+NG F   L  + SG L+L  +    +  + ++ +          +  + ++++ VD G P +   +   I+    N N      AP  F+ +  +  + E  P G  + +++           + YSI+  N + A S+   G I++ ++ DRE  + Y   V    +G+ Q+     V V++ ++ND  P F      R+ E       N R+    AT   KD+     ++Y L+       P +  +           F G I +   LD E +    L ++A D    S  T T + I V D+NDNAP F  P         +  +  G+    ++  DLD    G +T+SL    +  +  F++ PE
Sbjct: 1697 LIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDL--VPETGDLVLRRLSS----------LQSWKIKLRVVDHGVPGLYVEKNLEIS----NRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQP------ELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQ-QIGTR--VDVRVNNLNDNVPSFPMSKPRRVPE-------NLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNID---------QFTGTIHLTAPLDFEVLPEHTLTIKATDG---SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPAT--FSPGQPFAKIEAHDLDA--RGALTYSL---GQGSSSIFRVAPE 2080          

HSP 8 Score: 72.0182 bits (175), Expect = 2.690e-12
Identity = 60/237 (25.32%), Postives = 114/237 (48.10%), Query Frame = 1
Query: 1240 TVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLI 1944
            T+  KD D G+NG    S+ D+  +++      +   I+     P+T  D    S     ++  D G+PA+S+  +   +++D     P+F   +    + E+ PIG+ + +V A +    N+  I YS+ N +++  + ++ G +  +  FD EK  SY+  V A  N   + + S+ + ++++D+ND  P+F   +Y   + E        E L  + A+D D G  G V Y ++
Sbjct:  459 TLTAKDPDLGQNGWIRYSVLDTELVSIDK----ETGRIF----VPNT-IDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIAT-NANSETSTSL-ISIRLKDVNDNWPIFYPNEYHLTVREG---PKPEEPLLVVSASDMDSGTFGEVSYHIL 681          

HSP 9 Score: 68.9366 bits (167), Expect = 2.351e-11
Identity = 102/423 (24.11%), Postives = 174/423 (41.13%), Query Frame = 1
Query: 1063 LINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLK-NIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENN-PIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDC-TPVFEKDYF-FRITE--SYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSN 2313
            ++ R ++++  T   G+G+   T VD+ + + ND+ P   ++ +  +V EN +    + TV  KD D      +    + SG+     NI   D F      T P    D E +  +T+ IK  D    +  +    +I + D+NDNAP F   +    V       G    ++ A DLD+   G + YS+   + +            +K      + Y   VTA DNG P  + S+ V V I +      P FEK  F F + E    G  I N   E+ +             YR+ D              E   +  +   G + V G +DRE+ ++ +  V+  ++   S        + VLD NDN PVF   ++   ++++      G+ I  +   D D G NG +++ +++ N
Sbjct: 1892 ILERYSLKVIGT---GSGQQIGTRVDVRVNNLNDNVPSFPMS-KPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNI---DQFTGTIHLTAP---LDFEVLPEHTLTIKATDG---SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESRE----------FHYRIQD-------------PEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVF---TSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGN 2273          

HSP 10 Score: 67.781 bits (164), Expect = 5.197e-11
Identity = 90/366 (24.59%), Postives = 146/366 (39.89%), Query Frame = 1
Query: 1504 PRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNF--AISIYGEIQSKIKFDREKTDSYEFV-VTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVS-------FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSI-----GKKSHSSDNNNFG 2556
            P F   +  F V E+  IG+ +G +     +S+   + V         F       GEI +    D EK   ++ V V   ++GE     ++ + V++ D ND  P F           + +   +  L  +  TD D G    V   +I            L+  + N+ K++           + V G LDRE     +LL++A D G P+        IE++D NDNAPVF   S +    +VS    IG  + TV+  D D G N  I++ +  ++   N  F I   G I    ++   S        +I+ ASD G    ++ A + I  + S  +  P  I        +H  +N+  G
Sbjct:   20 PTFCQCLTKFTVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGE-----TIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTV--TDGD-GPKFDVHRFVI------------LQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF---SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTH-----DVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLG 357          

HSP 11 Score: 65.855 bits (159), Expect = 1.954e-10
Identity = 90/419 (21.48%), Postives = 178/419 (42.48%), Query Frame = 1
Query: 1087 IYITATDGNGRMNETSVDIAI----EDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQ----SKIKFDREKTDSYEFVVTARDNGEPQLN--DSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL 2301
            + +TATD       TSV +++     +  D P       RF +V+EN K       +Q+ +     +  F   + D     + +I   D F       +     DRE+ + +  +++  ++   +     K  + ++D NDN P F +      + ++   G  +GQ+ A D DS  NG + Y IL+ ND   +++    G IQ    +  + D     +++ +V ARD+G P       + V +K+   +   P F    Y   + E   ++     L++I+A+++   +N  + Y L +          KL  +++        G +++  +LD E    I + +   D    S      I++E +D  + APVF   S  +    + +    G+++  ++  D D G++G + +S+
Sbjct: 2098 VTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRF-EVMENSK-----IGLQIGNLSGEESREFHYRIQDPEASKIFSI---DKFG----RLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLE---DTSVGTVLQKIRASNRLGMRNDGLLYSLKE-------HQGKLGIDVKT-------GELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLKIVVEPVD--EFAPVFTKSSYTL---QIPISTPAGESVGQMQAIDEDGGVHGVVKYSI 2481          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 100.138 bits (248), Expect = 8.258e-21
Identity = 115/415 (27.71%), Postives = 192/415 (46.27%), Query Frame = 1
Query: 1234 LTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT--SFDREKIS---VYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL--NSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESY--GESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFR-SLPDRLI---IKASDLG 2439
            L TV V++ D+    +F+ +  DS + ++ + R  D+  + K      T  S D E+ S   V+ +     D  N  +S++ K +I I+D+NDN+PRF  ++  F+V EN+     +G V A D+D S+   + Y I+  ++N  F ++  G+I+S    DRE    Y  +V A D+G+P+   +  V V + D +D  P F + +   + E    GE +      Q+ A+D D   N   +   +D    GIP                  G + V  +LD E+  S ++ V+  D  +      T++ + V D+NDNAP+F  P     F++     EIG+        D+D   NG I +S+ +        FKI+P   ++        S FR  LP  L+   + A+D G
Sbjct: 1952 LDTVSVREHDEQELAVFKAN-GDSIRYSIVS-RCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFD--NKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSG-PKLIGHVIARDIDRSS--RVFYEIVGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRIFHVEVPEDVRIGEPVI-----QLSASDADEHSNHRFE---LDGGGEGIPFRVDENT-----------GMVFVNDSLDFEKKQSYRIKVKLTDGAW---LIETSLFVNVKDVNDNAPIFEKP--EYLFISEENSAEIGQ----FHASDMDSENNGKIRYSVTSPY------FKIEPSTGVL--------SRFRQQLPQPLMSLKVTATDHG 2317          

HSP 2 Score: 90.1225 bits (222), Expect = 8.255e-18
Identity = 98/343 (28.57%), Postives = 154/343 (44.90%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHI-VYSILNSNDNF-AISIYGEIQS--------KIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAP---VFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIA 2463
            I+++DVNDN+P F   ++   + E  PIG  V    A D D   NG I  Y +++S      +S +G +QS          K DRE  D Y   +TA D G P+L+ S  + + I DIND  P    ++  R        + N +L  + ATD D  +N  + YR++   P               +  +S D  I V  N + E +   + +V+A D G P LSTT  I++ +   N++ P   +  +PS +  F+ V  E   GKT+  +   D D  +    T  + N N++  F    +    I+   T+K   N       L  +A+D GQ+P + I 
Sbjct:  105 IDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPP----NFGIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTS------------EMFSIS-DENILVTQN-NTECLQRCEFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINIRFYPS-DYPFIIVQPEDVNGKTLAILSITDSDGPLGANSTIWIENGNEQSIFSLISRQSINIL---TVKHVENANQEQYILEFRAND-GQSPADRIT 424          

HSP 3 Score: 83.5741 bits (205), Expect = 8.564e-16
Identity = 149/652 (22.85%), Postives = 274/652 (42.02%), Query Frame = 1
Query:  535 TYPL----PVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNN---IRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLN-----DSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILN-SNDNFAIS-IYGEIQSKIKFDREK-TDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASD 2433
            +YPL     +A+D D  + G+ TY I              +  N   F + +       + P       +DREE      ++ A D G  + + +  + + V D+NDN PE+   +Y + I E    G  I+ ++A D+D    K+  + Y L    E    ++  F IN     +T   ++G +NR      R ++  TDG  + ++  V+I +ED ND+ P+I+  N    V +  +   I+  + V D DK  +  F  + +     ++G++ LK+           ++T               V ++     +    +  ++  +      + P FV K+    V E++         + + +  +N   I YSI++  +D+  +    G +++K   D E+ ++   F++         L+      +KI DIND +P F++  Y F +TE+ G  +    +       +D+ ++  V Y ++     G   N +          V+  G I    +LDRE  S   L+V+A DDG P     TT+I+ VLD +DNAP F    + +  V V  +  IG+ +  +   D D+  N    H        E  PF++     ++  +   +F   +S   R+ +K +D
Sbjct: 1666 SYPLIIGSSIAEDLDEGQNGLVTYSI--------------LSGNTSLFAVNSTTGDILSLIP-------LDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKD----KDAELQYSLESNDE----ITIPFRINVATGWIT---VAGKVNREENEEFRFFVKVTDGE-KSSKVIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSENGEITLKS----------PLQT--------------AVPVRVTVSDDAGHVAFMEYLFHP-HSRKHFPVFVEKLDTVSVREHDE--------QELAVFKANGDSIRYSIVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIGHVIA------RDIDRSSRVFYEIV-----GGDANHEFM--------VTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF----SRIFHVEVPEDVRIGEPVIQLSASDADEHSN----HRFELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSY--RIKVKLTD 2222          

HSP 4 Score: 77.411 bits (189), Expect = 6.171e-14
Identity = 78/276 (28.26%), Postives = 125/276 (45.29%), Query Frame = 1
Query: 1141 IAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGM---FEC--SLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTP-----VFEKDYFFRITESYGESIKNERLEQIKATDKD--LGQNGTV 1929
            I + D ND+ P+  I  +  ++ E       +      D D+G+NG    +E   SL     ++   I   D F   ++        DRE   +Y++ +  +DQG P +SS    +I I+D+NDN P F   I+   +  N    + +  + A DLDS+ N  + Y IL S     + SI  E     + + E     EFVV ARD+G P L+ ++ + V ++  N+  P      +  DY F I +   E +  + L  +  TD D  LG N T+
Sbjct:  105 IDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTG----KLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNF--GIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDENILVTQNNTECLQRCEFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINIRFYPSDYPFIIVQP--EDVNGKTLAILSITDSDGPLGANSTI 372          

HSP 5 Score: 73.559 bits (179), Expect = 9.251e-13
Identity = 84/264 (31.82%), Postives = 120/264 (45.45%), Query Frame = 1
Query: 1618 VYSILNSNDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIK------------ATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQ-PEGEIIIA 2367
            V+ I +++ NF IS + G I +    D E   +Y F +TA  +       +  V + + D ND  P F       IT   G+ +  + LE++             A D D GQNG V Y ++        GN+ L A        S  G I     LDREE S  +LL++A D G PSLS T+ I+I V D+NDN P F   S    F+ +S   +IG  I  +   D D+  +  + +SL  SN     PF+I    G I +A
Sbjct: 1588 VFRIQDNDYNFTISPFDGTIFTNSPLDFENIKTYRFNITAGKS-------TSQVIIHVTDENDEAPRF-------IT---GDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILS-------GNTSLFA------VNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSS---YFIKISENSKIGSKIIRILATDKDK--DAELQYSL-ESNDEITIPFRINVATGWITVA 1815          

HSP 6 Score: 72.7886 bits (177), Expect = 1.534e-12
Identity = 51/159 (32.08%), Postives = 84/159 (52.83%), Query Frame = 1
Query: 1489 VNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNF-----AISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLG-QNGTVKYRLID 1947
            +N ++P  + +I   HV+EN PIG+  G+++A D DS  +G + Y IL  +D++       S  G ++S   FD EK  SY F   A+D G P    +    + I+D+ND  P F   Y+       G+S  NE +  ++A D D+  +N  ++Y L++
Sbjct:  626 LNQHSP--ICQITEIHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRYYTATIS--GKS--NETVAIVQANDNDVDVKNQKLQYHLLN 778          

HSP 7 Score: 71.633 bits (174), Expect = 4.186e-12
Identity = 90/319 (28.21%), Postives = 141/319 (44.20%), Query Frame = 1
Query:  949 NGLVSYQLS---DR-TEDRKIV-------SQIFYINGNKLHLTNNRISGLINRN------NIRIY---ITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFG-KVLENQKQ---KIILTTVQVKDEDKGRNGMFECS-LNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY-----GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPV 1815
            NG   + +S   DR TE  KIV         +F I  N  + T +   G I  N      NI+ Y   ITA     +     V I + D ND  P     +    KVLE        +I+ +   +D D+G+NG+   S L+ +  L   N    D  ++  +        DRE+ S++ + I+  D G P++S+  K  I++ D+NDN P F        + EN+ IGS +  +R +  D   +  + YS L SND   I        G I    K +RE+ + + F V   D GE   +  ++V++ ++D ND  P+
Sbjct: 1557 NGTFEFNISETADRFTEVGKIVILGAGLEGSVFRIQDNDYNFTISPFDGTIFTNSPLDFENIKTYRFNITAGKSTSQ-----VIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSLFAVNSTTGDILSLIPL--------DREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKI--IRILATDKDKDAELQYS-LESNDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTD-GEK--SSKVIVEIHVEDFNDNHPM 1856          

HSP 8 Score: 69.3218 bits (168), Expect = 1.800e-11
Identity = 82/296 (27.70%), Postives = 122/296 (41.22%), Query Frame = 1
Query: 1087 IYITAT---DGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIY---KIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHV--VENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRL 1941
            ++I AT   D       T   I I D ND+ P          V EN   K+I   V  +D D+     +E    D+          +  F +    +IE+  D   DRE  S Y + ++ +D G P         + ++D +DNAPRF    ++FHV   E+  IG  V Q+ A D D  +N    + +    +     +    G +      D EK  SY   V   D G   +  S+ V VK  D+ND  P+FEK  +  I+E     I      Q  A+D D   NG ++Y +
Sbjct: 2012 VFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLI-GHVIARDIDRSSRVFYEIVGGDA----------NHEFMVTESGQIESVRD--LDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFS---RIFHVEVPEDVRIGEPVIQLSASDADEHSNHR--FELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTD-GAWLIETSLFVNVK--DVNDNAPIFEKPEYLFISEENSAEIG-----QFHASDMDSENNGKIRYSV 2281          

HSP 9 Score: 60.8474 bits (146), Expect = 6.689e-9
Identity = 64/231 (27.71%), Postives = 103/231 (44.59%), Query Frame = 1
Query: 1678 SKIKFDREKTDSYEFVVTARDNGEPQLNDSMVV----------KVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTV-KYRLID-------VKPIGIPGNSKLKAELRNLIKVSFDGAI--SVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINS 2310
            SKIKFD +   + E  V++  + E +    M++           + + D+ND +P+F  D   +  E    +    R++   ATD D G+NGT+ KY L+D       + P GI               V  DG +   V G LDRE      + + A D G P LS++  + I +LD+NDN P F   S  +N+  +         + ++   DLD   N  +T+ ++ S
Sbjct:   64 SKIKFDEQ---TLELSVSSPLDRESENAIDMLIITSPPSIIHILIDVLDVNDNSPIFPID--VQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGI---------------VQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSLTLNWNGLP-----NTKLFSLNATDLDSNENSLLTYRILPS 269          

HSP 10 Score: 60.4622 bits (145), Expect = 1.028e-8
Identity = 93/378 (24.60%), Postives = 157/378 (41.53%), Query Frame = 1
Query:  712 LEIIKNIDREEFVS-FVFILIATDFGNQTGSCXXXXXXXXXXXX--APEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFY--INGNKLHLTNNRISGLI---------NRNNIRIYITATDGNG--RMNETSVDIAIEDCNDHPPVISIANRFGKVL-----ENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKV 1782
            L+   ++D EE+    VFI+  T F N+  S      +  V+ N  +P + +  Y+ N+ E      I  +IA D D                       S++FY  + G+  H      SG I          ++   + + A D     R   T+V + + D +D+ P      RF ++      E+ +    +  +   D D+  N  FE    D G   +   R D+N  +     + + S D EK   Y +++K  D      +S+    +N+ DVNDNAP F     +F   EN+   + +GQ  A D+DS NNG I YS+  ++  F I     + S+ +  +         VTA D+G P+L  +++  +
Sbjct: 1996 LKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIGHVIARDIDRS---------------------SRVFYEIVGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAP------RFSRIFHVEVPEDVRIGEPVIQLSASDADEHSNHRFEL---DGGGEGIP-FRVDENTGM----VFVNDSLDFEKKQSYRIKVKLTDGAWLIETSL---FVNVKDVNDNAPIFEKPEYLFISEENS---AEIGQFHASDMDSENNGKIRYSV--TSPYFKIEPSTGVLSRFR-QQLPQPLMSLKVTATDHGVPRLQKTVLAHL 2329          

HSP 11 Score: 56.6102 bits (135), Expect = 1.299e-7
Identity = 57/204 (27.94%), Postives = 91/204 (44.61%), Query Frame = 1
Query: 1063 LINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT-----SFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLD-SSNNGHIVYSILNSNDNFAI 1656
            L+NRN  +  I             + + ++  N H P+  I      VLEN     I   +Q +DED G +G+       S K+  K+   DD   I+ +++   +     +FD EK   YT E +  D G P+ ++    +I I DVNDN P+F +  + +    +     TV  V+A D D    N  + Y +LN +D F +
Sbjct:  608 LVNRNTTQTSI-------------ITLIVKPLNQHSPICQITEI--HVLENAPIGTIFGRIQARDEDSGLSGVV------SYKILTKS---DDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGS--RYYTATISGKSNETVAIVQANDNDVDVKNQKLQYHLLNYHDFFQL 785          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 158.688 bits (400), Expect = 1.349e-38
Identity = 176/597 (29.48%), Postives = 282/597 (47.24%), Query Frame = 1
Query:  712 LEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXX--XXXXXXXXAPEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRM--NETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDN--APRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSN-NGHIVYSILNSNDN--FAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIG-IPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIA 2463
            L+II  +DRE    +V  +   D GN T S +  +   + DVNDN P   K      + E    G ++  + A D D  +  N  V+Y LS    D       F +N     L  N+      ++N  ++ITA DG   +  +E  V + ++D ND+ PV  +     KV E+  +  +L  ++  DED G N   + SL +  + + +  R D +    + + Y     D E   V+ + +  +D G+P+++S     I IIDVN+N  AP F + +    V EN P G+ V  V A D+D+ + N  I YSI   +    FA++  G I S  + D E  + Y   + A+D     L++ + V +++++ ND  P+ +K  Y+  +TE+   S++N  +  +KA D D+    T+ Y ++    +G    +SK       +IK       +    LDRE  +   L V   D+G P LS+T+ I++ VLD+NDN+P F      +  V V     + ++I  V   D D G NG IT+S I S K +N  F+I  + G I IA  +   + F      + IKA D G   K+  A
Sbjct:  829 LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDAD--SGINAQVTYALSVECSD-------FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQ-DEELFRIDKHTGAIRTQGY----LDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEA---SVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSK-----TGVIK-------TTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEF---DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYS-IKSGKGKN-KFRIDSQRGHIHIAKPLDSDNEF-----EIHIKAEDNGIPKKSQTA 1386          

HSP 2 Score: 150.214 bits (378), Expect = 5.467e-36
Identity = 177/621 (28.50%), Postives = 283/621 (45.57%), Query Frame = 1
Query:  661 FFQIKNPKSKQEEIYPSLE--IIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDIL-ELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATDGNGRMNE--TSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI---SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKAS--DLGQNPKNNIATLYIRYI 2484
            FF +   K  Q +I  S E  I K +DRE+ + +   +IATD G  T    V + V D+NDN P   K  Y ++  E  S G  L E+ A D D        + + LS +  D       F I      L   +++  ++R      ++     DG     E  + + I + D ND+ P+ S+A     V E+ +   ++T V   D+D G N   + SL      N    +   +  I ++      S DRE IS++ + +K  D G P + S+   ++NI+D+NDN P F  +     ++EN   G+ V +V A  +D   N  I Y I++ N+       S  G++      D E +  Y   + A D G P L+++  V + I DIND +P F ++  +RI  +    + ++ L+ +KATD+D   NG V Y +     IG     +   + +N       G ISV   LDRE IS   L +QA D G P    +  I I +LD NDNAP+  F S+N + V +     +G    T K  D D+  N T  ++    +  E   F+++ +G +    T   F++  +L D  +I+    D G  P  + A + ++ I
Sbjct: 3003 FFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATD-GKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD----FQSKLRFYLSGKGADD------FSIGKESGIL---KVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE---NHDYFKISKSTGIIRLHK----SLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQN-LYRINVNEDIFVGSKILD-VKATDEDSDVNGLVTYNIERGDNIG-----QFSIDPKN-------GTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPI--FSSSNYSVV-LQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGSL---RTASRFNH--NLQDEFVIQVRVFDNGTPPLYSDAWVVVKII 3579          

HSP 3 Score: 144.05 bits (362), Expect = 4.066e-34
Identity = 122/422 (28.91%), Postives = 197/422 (46.68%), Query Frame = 1
Query: 1243 VQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDN--APVFLFPSNNMNFV---NVSVEWEIGKTICTVKTKDLDQ-GINGTITHSLINSNKRENFPFKIQPEGEII-IAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIR 2478
            ++ KD D G NG    +++D    ++   R D +    +I  Y     DRE+ + Y + I   D GNP  S+ +   I I+DVNDN P     +  F + E+  IG+ V  + A D DS  N  + Y++     +F + +  G ++     DREK D+Y   +TA+D G P L+   +V V + D+ND  PVF  ++Y F++ E      +   L  I+A D+D+G N  +++ L            K + +   L ++    GAI   G LD E      L+V A D G PSL++  +I+I ++D+N+N  AP F       +FV    V      G  +  V  +D+D   +N  IT+S+   +      F +  +G I  ++    E  NF      L + A D    P +N   +YI+
Sbjct:  794 IEAKDRDLGYNGKLVFAISDGDYDSV--FRIDPDRGELQIIGY----LDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLP---RGTVLAVIEAVDEDIGPNAEIQFSL------------KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEF------DDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLG--IFAVNDQGSITSLSQLDAETKNFY----WLTLCAQDCAIVPLSNCVEVYIQ 1182          

HSP 4 Score: 102.834 bits (255), Expect = 1.514e-21
Identity = 93/359 (25.91%), Postives = 157/359 (43.73%), Query Frame = 1
Query: 1129 TSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNG---MFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLE-----QIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPV 2172
             +V + I D ND+PP  S+     K+LEN      +  V     D G N     F  S N+ GK  + +   D            + + D E    Y + I+ +D G P +S+    +I+I+D+NDN+P F+  +   +V E+  +GS +  V+A D DS  NG + Y+I   ++    SI    G I      DRE    Y   + A D G+PQ  +S+ + + I D ND  P+F        + +Y   ++  RL        K +D D   N T  Y   D++     GN         L ++  DG++      +        + V+ FD+G P L +   +++++++ +   P+
Sbjct: 3257 ATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGD---------LVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFS-------SSNYSVVLQENRLLGYVFLTFKISDADETPN-TTPYTF-DIRS----GNEG------GLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPI 3587          

HSP 5 Score: 102.834 bits (255), Expect = 1.704e-21
Identity = 133/473 (28.12%), Postives = 190/473 (40.17%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL-NSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSF-----DGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGKKSHS 2535
            V I + D ND+ P          V EN ++ I L  V   D D G NG     L +S   N++NI FD    IY       TS DRE  S Y  ++   D G+P   +    +I I+D NDNAP F   I+   V EN   G+ +  +  +D D        + +  +    F I   GE+      DRE+   Y   + A D    +      V++ ++DIND TP   K    R   S  ESI                   ++   L++VK I     SKL+  L       F      G + V   LDRE     +L+    D    +    + III V D+NDN P+F   S     V+V  + ++   I  V   D D G+N  I +SL+  N      FKI     II  H   +          L +KA D G    ++IAT+ +  +    N NP     + +S
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYL-ESDTENIQNI-FD--IDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKP---RYHISTNESI-------------------SIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF---SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDY---FKISKSTGIIRLHKSLDRETISLF--NLTVKAEDCGVPKLHSIATVAVNILD--INDNPPEFSMRQYS 3279          

HSP 6 Score: 102.064 bits (253), Expect = 2.409e-21
Identity = 147/554 (26.53%), Postives = 232/554 (41.88%), Query Frame = 1
Query:  844 PEWTKDNYKVNIQE-CQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVS--QIFYINGNKLHLTNNRISGLINRNNIRIYITATDGN-GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL--NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYG---------ESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTT--IIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICT--VKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASD 2433
            P++ KD Y VNI E  + E  I++L A DRD+    +  + Y L   T+D   ++  +I  I+GN +     R+       +I I      G  G+ N   + + + D NDH P  +      KV E+      L  V+  D D G N   + S+   + G +       D  F I  +      + +  KI  Y +++K VD GNP +SS     I +    ++ P+F        + EN PIG+ V QV A    S     I ++I++ N N +  I    G I      D E    +   V   +        +++  + I D ND  P F + +Y   + ES           +S K+    Q+K  D D+G NG V+Y ++D                +N  K+ S  GAI +   LD E  +     V   D G P L +TTT  + I V+++ND  PVF     N   +NV++     + +    V  KD D   N T+   +++ N  E   F+I+    II     +  +N       L ++ASD
Sbjct: 1504 PQFAKDVYHVNISENIEEESVIMQLHATDRDE----DKKLFYHLH-ATQDPSSLALFRIDSISGNVI--VTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSV----FEIDPTFGIITLAG----NLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSS-----IFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNII--IHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVK--DADVGVNGMVEYHIVD-------------DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF-----NERELNVTLFLPTFENVFVRQVSAKDAD---NDTLRFDIVDGNTNEC--FQIEKYTGIITTRNFEILNNENDRDYALHVRASD 2010          

HSP 7 Score: 102.064 bits (253), Expect = 3.025e-21
Identity = 71/263 (27.00%), Postives = 122/263 (46.39%), Query Frame = 1
Query: 1399 ISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVS-FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP 2184
            ++ Y   ++  D+G P   S    SI II+ + N P F     +  ++E+ P G+ + ++  +      N    +SI    D+F IS  GE+  +   DRE+ +S+  +V A  +  P       V + ++D ND  P F+  ++        E + +  L ++ ATD D G NG ++Y L                 ++N+  +  + G I++  +LDRE  S     V A D+G+P       + I+++D NDNAPVF  P
Sbjct: 2726 VNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMI-----GNYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVIS--LVKVSATDADTGPNGDIRYYL-----------ESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLP 2970          

HSP 8 Score: 93.2041 bits (230), Expect = 1.446e-18
Identity = 111/410 (27.07%), Postives = 181/410 (44.15%), Query Frame = 1
Query: 1111 NGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITE--SYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            N R   TS+DI++ D ND+ P+      +  V  +  +  I+  V+  D D   NG     L    K N +  + D       I+ + +   +R     Y + +   D      SS     + +ID   + P F  +     V E+  + S +    +++ +S     ++Y+I + + +F I    G I    + D EK  S++  + A D+    +   +V+ V I D+NDC P  E D Y   I E  S+G  I      +I ATD D G N  + Y    ++ I    NS+L       I V+ DG + +   LD E+I    ++V   D G PSLS+ + + I V DLNDNAP F+ PS    F  VSV    G+ +   K  D D     ++ + ++  N+ + +
Sbjct: 2118 NVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELK---KGNGELFKLDRKSGELSIKQHVE-GHNRN----YELTVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDVEMYSALSV--SIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLS-GVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQIL-----KINATDNDSGANAKLSYY---IESINGQNNSELF-----YIDVT-DGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPS---YFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTY 2497          

HSP 9 Score: 87.0409 bits (214), Expect = 1.050e-16
Identity = 109/440 (24.77%), Postives = 183/440 (41.59%), Query Frame = 1
Query: 1093 ITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPD-----TSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIK----ATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSF-----DGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL-------FPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI 2340
            I+ TDG      T++ + + D ND+PP  +       + EN +++ ++  +   D D+ +   +          +L   +   + A+++I++           D EK + + + +   DQG P   +  K  +N+ D ND+ P F  KI    V E+  IGS + +VRA+D DS +N  I YSI+  N      I   +G I      +  K   Y   V A D G P L+  + V + +    +  P F  +           +I  E  E +      T      + ++ + +I        GN          I  SF      G I + GN+D E I    L V+  +    + S+   III +LD NDN P F+        P +      V    +  K   T++ KD D G+NG + + +++ +  +NF FKI
Sbjct: 1479 ISVTDGTFTAF-TNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFY----------HLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTN-----------NIAIEIFENLPIGTFVTQVTARSSSSIFFNIIS-------GN----------INESFRINPSTGVIVINGNIDYESIKVFNLTVKGTN--MAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVD-DLAKNF-FKI 1875          

HSP 10 Score: 81.2629 bits (199), Expect = 6.432e-15
Identity = 139/609 (22.82%), Postives = 256/609 (42.04%), Query Frame = 1
Query:  646 GNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNT-KNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATD----GNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFD-DNFA-IYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQ-KFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQS-KIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKI--QDINDCTPVF---------EKDYFFRITESYGESIKN-------ERLEQIKATDKDLGQN----------------------GTVKYRLIDVKPIGIPGNSKL-----KAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL 2301
            GN    F +K  ++K +E Y  L    +++++ F+ +   L+A D G   +    +V + +   + N P +T++ Y+V+I E       + +I     DP+  KN LV  ++    E  +     F IN +   L   +      +++  + ++A D    G+ + +   V I+++D ND+ P+    N+   + EN      +  +  KD D G N     S+      NL  + F+ D+F+ I K  +  D  F+  K + Y + I+  D G P     + K SI + D+NDN P+F        V ++ P+G+ V    A+D D+ +   I Y + + N++   ++     S  I  D +KT     ++          +D +++ V +  +D+   + +          E     R+ E+   + KN            +  T    GQN                       TV +  I+ K   +  N KL       +  ++ ++  D G + + G LDRE  +   L +  +D G P+ ST+  + I +LD+NDN PV       +    ++    IG  +  +   D D GIN  +T++L
Sbjct:  332 GNPDGTFLLKAAETK-DEYYIELNQFAHLNQQHFI-YNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPIN--MPVIRLKVSDPDLGKNALVYLEIVGGNEGDE-----FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSI-----ANLNAVPFEIDHFSGIVKTTSLLD--FETMKRN-YELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGD--IISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAW--IEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVI---QKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL 916          

HSP 11 Score: 80.4925 bits (197), Expect = 1.040e-14
Identity = 114/435 (26.21%), Postives = 182/435 (41.84%), Query Frame = 1
Query: 1243 VQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPA--MSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSND-NFAISIYGEI---QSKIKFDREKTDSYEFVVTARDNGEPQLNDSMV-VKVKIQDINDCTPVFEKDYFFRITESYGESIKNERL--EQIKATDKDLGQNGTVKYRLIDVKPIGI------PGNSKLKAELR------NLIKVS------FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLND-------NAPVF----LFPS------NNMNFVNVSVEWEI------GKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEI-IIAHTMKEFSN 2391
            ++V D D G+N +    +    + +   I  D          Y     D EK S YT+ +  +DQ N      S  K  I++ D+NDN P F N  K+  + ENN  GS V ++ A D DS  N +I YSI N N   F I  +  I    S + F+  K + YE ++ A D G P    + + + + ++DIND  P FE+         YG+  K+  +  E    +  D      + YRL D    G        G+  +  +L+       ++KVS      F   + +  +L  E++     ++  F       +     + E L L +       +  VF    L PS      +   FVN   E  I      G+T+  ++ KD D G NG +  ++  S+   +  F+I P+ GE+ II +  +E  N
Sbjct:  422 LKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGM------LYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRN-YELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFER------VNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAI--SDGDYDSVFRIDPDRGELQIIGYLDRERQN 841          

HSP 12 Score: 74.3294 bits (181), Expect = 7.099e-13
Identity = 144/552 (26.09%), Postives = 227/552 (41.12%), Query Frame = 1
Query:  310 FSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTT--YPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNG--RMNETSVDIAIEDCNDHPPVISIANRFG-KVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT-----SFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSS-NNGHIVYSILNSNDN--FAISIYGEIQSKIKFDREKTDSYEFVVTAR--DNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRIT-ESYGESIKNERLEQIKATDKD 1908
            FS+ + SG L V S LDRET       T   KL      H         +        +    V +I +N+PI +   Y + V +D        K + + +  G++++ +   +G N  +F+I    SK   I   + + K++DRE    F   + A D G        TV V + D+NDN PE++   Y   I E  + G ++ ++ A   D     N  + Y +    E  K     F ++     L  N            + I A DG      N   V+I+I D ND+ P   + N +   V E+      +  V+  DED   NG+              NI   DN   + I+    T       DRE IS YT+EI+  DQG+P   +    +INI+D NDNAP F +      + EN  +G      +  D D + N     + I + N+   F +   G +++  +F+    D  EFV+  R  DNG P L     V VKI + +   P+        +T  S+ +      + ++ A+D+D
Sbjct: 3112 FSIGKESGILKVASALDRET-------TPKYKLV----AHVQDGKDFTQECFS-----EIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKI----SKSTGI---IRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSID--IGVNADIHYFIMSGNEQGK-----FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTF-LQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVT-----------YNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQD--EFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTP---LEVTINSFEDDFSGAFIGKVHASDQD 3616          

HSP 13 Score: 71.633 bits (174), Expect = 4.571e-12
Identity = 82/333 (24.62%), Postives = 141/333 (42.34%), Query Frame = 1
Query: 1384 FDREKISVYTVEIKCVDQGNPAMSS-----MQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTD------------SYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVE--WEIGKTICTVKTKDLDQGINGTITHSLINSNKREN 2325
            FDRE   +Y + ++        M+S     +    I+++DVNDN P FVN      V  ++P G+ + QV+A+DLDS+ NG + Y +   N        GE+    K DR+  +            +YE  V A D      +    ++VK+  I+   PVFEK +       Y  S+K E +E   A    +     +   LI            + +E ++       G+I V   LD E+ISS  + ++A  D    +     + + ++D+ND      +P    +  N+++      G  I  +   D D G N  +++ + + N + N
Sbjct: 2093 FDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGN--------GEL---FKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQF-------YTVSVK-EDVEMYSALSVSIEAESPLGRSLI----------YTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRA-TDSLSGVYAEVVLSVSIMDVND-----CYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNN 2388          

HSP 14 Score: 71.2478 bits (173), Expect = 6.967e-12
Identity = 80/307 (26.06%), Postives = 139/307 (45.28%), Query Frame = 1
Query: 1384 FDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILN--SNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEP---QLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNER----LEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQ 2271
             DRE  + + +E+   D G+P +SS  +  ++++D+NDN+P F  ++    V  +  +  ++ QV A+D DS  NG I YSI +    + F I S  G I      D +  + +E  + A DNG P   Q     +V V +   +   P+  +    + +E+  +  +N++    + QI A D D   N  + Y + +       GN        N   +  D G I +   LD E   S  L +   D  + +    T ++++V+D+NDN P F   + ++  VN+S   E    I  +   D D+
Sbjct: 1257 LDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVR----KTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISN-------GNDD------NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAF---TNLLVQVIDINDNPPQF---AKDVYHVNISENIEEESVIMQLHATDRDE 1535          

HSP 15 Score: 59.6918 bits (143), Expect = 2.229e-8
Identity = 88/391 (22.51%), Postives = 160/391 (40.92%), Query Frame = 1
Query: 1300 DSGKLNLKNIRFDDNFAIYKIETYPD-TSFDREKISVYTVEIKCV----DQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNG-----EPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTV-KYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREE-ISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASD 2433
            D  KL     +   +FA   I T  +    +REK   Y + +K      D+   +  +     I ++D ND +P F        + E+ P   ++ +V A D D   NG I YS+L  ++ FAI    GEI    +    +   +E  V A D G     +        V + ++ +N   P      F  +T +    I       ++  DKD G NG + +  ++D  P    G   LKA      K  +   ++ + +L+++  I ++ LL +  D G P      ++ I++   + N P+F   +  +  V++     I   +  +K  D D G N  +   ++  N+ +   F+I P+  ++  +T K+    +     L + A D
Sbjct:  108 DKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYG----IVRVNDKDTGINGNIGRLEIVDGNP---DGTFLLKAA---ETKDEYYIELNQFAHLNQQHFIYNLTLLAE--DLGTPRRFAYKSVPIQIKPESKNIPIF---TQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE--FRINPDSGML--YTAKQLDAEKKSSYTLTVSAID 479          

HSP 16 Score: 59.3066 bits (142), Expect = 2.943e-8
Identity = 99/421 (23.52%), Postives = 165/421 (39.19%), Query Frame = 1
Query: 1087 IYITATDG-NGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIET-----YPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDG----YPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLI 2304
            + I ATD  +G   E  + ++I D ND  P I        + EN      +  +   D D G N              +++I   +N  ++ I+      Y  T  D E+I  + + +   D G+P++SS     I + D+NDNAP FV       V      G  V   +A D D S+   + Y I+  N+    SI    G I  +   +     S    ++  D           +K+ +   N  +P+F++  Y  ++ E+    +    +  +KA+D D G    + Y ++               E++ +  +    G I+     DRE+     +L++  D G    + SL            +NDN P FL     M    VS   E  +TI TVK KD D   NG++   ++
Sbjct: 2310 VSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKL--------SYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAY---ARLKISLLPENVYSPLFDQSTYEAQVPENL---LHGHNIITVKASDGDFGTYANLYYEIV-------------SEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVD------VNDNVPYFLLKEYKMV---VSTTVEANQTILTVKAKDDDIVDNGSVHFQIV 2694          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 158.688 bits (400), Expect = 1.349e-38
Identity = 176/597 (29.48%), Postives = 282/597 (47.24%), Query Frame = 1
Query:  712 LEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXX--XXXXXXXXAPEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRM--NETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDN--APRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSN-NGHIVYSILNSNDN--FAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIG-IPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIA 2463
            L+II  +DRE    +V  +   D GN T S +  +   + DVNDN P   K      + E    G ++  + A D D  +  N  V+Y LS    D       F +N     L  N+      ++N  ++ITA DG   +  +E  V + ++D ND+ PV  +     KV E+  +  +L  ++  DED G N   + SL +  + + +  R D +    + + Y     D E   V+ + +  +D G+P+++S     I IIDVN+N  AP F + +    V EN P G+ V  V A D+D+ + N  I YSI   +    FA++  G I S  + D E  + Y   + A+D     L++ + V +++++ ND  P+ +K  Y+  +TE+   S++N  +  +KA D D+    T+ Y ++    +G    +SK       +IK       +    LDRE  +   L V   D+G P LS+T+ I++ VLD+NDN+P F      +  V V     + ++I  V   D D G NG IT+S I S K +N  F+I  + G I IA  +   + F      + IKA D G   K+  A
Sbjct:  829 LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDAD--SGINAQVTYALSVECSD-------FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQ-DEELFRIDKHTGAIRTQGY----LDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEA---SVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSK-----TGVIK-------TTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEF---DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYS-IKSGKGKN-KFRIDSQRGHIHIAKPLDSDNEF-----EIHIKAEDNGIPKKSQTA 1386          

HSP 2 Score: 150.214 bits (378), Expect = 5.467e-36
Identity = 177/621 (28.50%), Postives = 283/621 (45.57%), Query Frame = 1
Query:  661 FFQIKNPKSKQEEIYPSLE--IIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDIL-ELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATDGNGRMNE--TSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI---SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKAS--DLGQNPKNNIATLYIRYI 2484
            FF +   K  Q +I  S E  I K +DRE+ + +   +IATD G  T    V + V D+NDN P   K  Y ++  E  S G  L E+ A D D        + + LS +  D       F I      L   +++  ++R      ++     DG     E  + + I + D ND+ P+ S+A     V E+ +   ++T V   D+D G N   + SL      N    +   +  I ++      S DRE IS++ + +K  D G P + S+   ++NI+D+NDN P F  +     ++EN   G+ V +V A  +D   N  I Y I++ N+       S  G++      D E +  Y   + A D G P L+++  V + I DIND +P F ++  +RI  +    + ++ L+ +KATD+D   NG V Y +     IG     +   + +N       G ISV   LDRE IS   L +QA D G P    +  I I +LD NDNAP+  F S+N + V +     +G    T K  D D+  N T  ++    +  E   F+++ +G +    T   F++  +L D  +I+    D G  P  + A + ++ I
Sbjct: 3003 FFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATD-GKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD----FQSKLRFYLSGKGADD------FSIGKESGIL---KVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE---NHDYFKISKSTGIIRLHK----SLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQN-LYRINVNEDIFVGSKILD-VKATDEDSDVNGLVTYNIERGDNIG-----QFSIDPKN-------GTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPI--FSSSNYSVV-LQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGSL---RTASRFNH--NLQDEFVIQVRVFDNGTPPLYSDAWVVVKII 3579          

HSP 3 Score: 144.05 bits (362), Expect = 4.066e-34
Identity = 122/422 (28.91%), Postives = 197/422 (46.68%), Query Frame = 1
Query: 1243 VQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDN--APVFLFPSNNMNFV---NVSVEWEIGKTICTVKTKDLDQ-GINGTITHSLINSNKRENFPFKIQPEGEII-IAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIR 2478
            ++ KD D G NG    +++D    ++   R D +    +I  Y     DRE+ + Y + I   D GNP  S+ +   I I+DVNDN P     +  F + E+  IG+ V  + A D DS  N  + Y++     +F + +  G ++     DREK D+Y   +TA+D G P L+   +V V + D+ND  PVF  ++Y F++ E      +   L  I+A D+D+G N  +++ L            K + +   L ++    GAI   G LD E      L+V A D G PSL++  +I+I ++D+N+N  AP F       +FV    V      G  +  V  +D+D   +N  IT+S+   +      F +  +G I  ++    E  NF      L + A D    P +N   +YI+
Sbjct:  794 IEAKDRDLGYNGKLVFAISDGDYDSV--FRIDPDRGELQIIGY----LDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLP---RGTVLAVIEAVDEDIGPNAEIQFSL------------KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEF------DDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLG--IFAVNDQGSITSLSQLDAETKNFY----WLTLCAQDCAIVPLSNCVEVYIQ 1182          

HSP 4 Score: 102.834 bits (255), Expect = 1.514e-21
Identity = 93/359 (25.91%), Postives = 157/359 (43.73%), Query Frame = 1
Query: 1129 TSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNG---MFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLE-----QIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPV 2172
             +V + I D ND+PP  S+     K+LEN      +  V     D G N     F  S N+ GK  + +   D            + + D E    Y + I+ +D G P +S+    +I+I+D+NDN+P F+  +   +V E+  +GS +  V+A D DS  NG + Y+I   ++    SI    G I      DRE    Y   + A D G+PQ  +S+ + + I D ND  P+F        + +Y   ++  RL        K +D D   N T  Y   D++     GN         L ++  DG++      +        + V+ FD+G P L +   +++++++ +   P+
Sbjct: 3257 ATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGD---------LVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFS-------SSNYSVVLQENRLLGYVFLTFKISDADETPN-TTPYTF-DIRS----GNEG------GLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPI 3587          

HSP 5 Score: 102.834 bits (255), Expect = 1.704e-21
Identity = 133/473 (28.12%), Postives = 190/473 (40.17%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL-NSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSF-----DGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGKKSHS 2535
            V I + D ND+ P          V EN ++ I L  V   D D G NG     L +S   N++NI FD    IY       TS DRE  S Y  ++   D G+P   +    +I I+D NDNAP F   I+   V EN   G+ +  +  +D D        + +  +    F I   GE+      DRE+   Y   + A D    +      V++ ++DIND TP   K    R   S  ESI                   ++   L++VK I     SKL+  L       F      G + V   LDRE     +L+    D    +    + III V D+NDN P+F   S     V+V  + ++   I  V   D D G+N  I +SL+  N      FKI     II  H   +          L +KA D G    ++IAT+ +  +    N NP     + +S
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYL-ESDTENIQNI-FD--IDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKP---RYHISTNESI-------------------SIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF---SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDY---FKISKSTGIIRLHKSLDRETISLF--NLTVKAEDCGVPKLHSIATVAVNILD--INDNPPEFSMRQYS 3279          

HSP 6 Score: 102.064 bits (253), Expect = 2.409e-21
Identity = 147/554 (26.53%), Postives = 232/554 (41.88%), Query Frame = 1
Query:  844 PEWTKDNYKVNIQE-CQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVS--QIFYINGNKLHLTNNRISGLINRNNIRIYITATDGN-GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL--NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYG---------ESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTT--IIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICT--VKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASD 2433
            P++ KD Y VNI E  + E  I++L A DRD+    +  + Y L   T+D   ++  +I  I+GN +     R+       +I I      G  G+ N   + + + D NDH P  +      KV E+      L  V+  D D G N   + S+   + G +       D  F I  +      + +  KI  Y +++K VD GNP +SS     I +    ++ P+F        + EN PIG+ V QV A    S     I ++I++ N N +  I    G I      D E    +   V   +        +++  + I D ND  P F + +Y   + ES           +S K+    Q+K  D D+G NG V+Y ++D                +N  K+ S  GAI +   LD E  +     V   D G P L +TTT  + I V+++ND  PVF     N   +NV++     + +    V  KD D   N T+   +++ N  E   F+I+    II     +  +N       L ++ASD
Sbjct: 1504 PQFAKDVYHVNISENIEEESVIMQLHATDRDE----DKKLFYHLH-ATQDPSSLALFRIDSISGNVI--VTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSV----FEIDPTFGIITLAG----NLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSS-----IFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNII--IHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVK--DADVGVNGMVEYHIVD-------------DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF-----NERELNVTLFLPTFENVFVRQVSAKDAD---NDTLRFDIVDGNTNEC--FQIEKYTGIITTRNFEILNNENDRDYALHVRASD 2010          

HSP 7 Score: 102.064 bits (253), Expect = 3.025e-21
Identity = 71/263 (27.00%), Postives = 122/263 (46.39%), Query Frame = 1
Query: 1399 ISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVS-FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP 2184
            ++ Y   ++  D+G P   S    SI II+ + N P F     +  ++E+ P G+ + ++  +      N    +SI    D+F IS  GE+  +   DRE+ +S+  +V A  +  P       V + ++D ND  P F+  ++        E + +  L ++ ATD D G NG ++Y L                 ++N+  +  + G I++  +LDRE  S     V A D+G+P       + I+++D NDNAPVF  P
Sbjct: 2726 VNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMI-----GNYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVIS--LVKVSATDADTGPNGDIRYYL-----------ESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLP 2970          

HSP 8 Score: 93.2041 bits (230), Expect = 1.446e-18
Identity = 111/410 (27.07%), Postives = 181/410 (44.15%), Query Frame = 1
Query: 1111 NGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITE--SYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            N R   TS+DI++ D ND+ P+      +  V  +  +  I+  V+  D D   NG     L    K N +  + D       I+ + +   +R     Y + +   D      SS     + +ID   + P F  +     V E+  + S +    +++ +S     ++Y+I + + +F I    G I    + D EK  S++  + A D+    +   +V+ V I D+NDC P  E D Y   I E  S+G  I      +I ATD D G N  + Y    ++ I    NS+L       I V+ DG + +   LD E+I    ++V   D G PSLS+ + + I V DLNDNAP F+ PS    F  VSV    G+ +   K  D D     ++ + ++  N+ + +
Sbjct: 2118 NVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELK---KGNGELFKLDRKSGELSIKQHVE-GHNRN----YELTVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDVEMYSALSV--SIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLS-GVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQIL-----KINATDNDSGANAKLSYY---IESINGQNNSELF-----YIDVT-DGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPS---YFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTY 2497          

HSP 9 Score: 87.0409 bits (214), Expect = 1.050e-16
Identity = 109/440 (24.77%), Postives = 183/440 (41.59%), Query Frame = 1
Query: 1093 ITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPD-----TSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIK----ATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSF-----DGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL-------FPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI 2340
            I+ TDG      T++ + + D ND+PP  +       + EN +++ ++  +   D D+ +   +          +L   +   + A+++I++           D EK + + + +   DQG P   +  K  +N+ D ND+ P F  KI    V E+  IGS + +VRA+D DS +N  I YSI+  N      I   +G I      +  K   Y   V A D G P L+  + V + +    +  P F  +           +I  E  E +      T      + ++ + +I        GN          I  SF      G I + GN+D E I    L V+  +    + S+   III +LD NDN P F+        P +      V    +  K   T++ KD D G+NG + + +++ +  +NF FKI
Sbjct: 1479 ISVTDGTFTAF-TNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFY----------HLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTN-----------NIAIEIFENLPIGTFVTQVTARSSSSIFFNIIS-------GN----------INESFRINPSTGVIVINGNIDYESIKVFNLTVKGTN--MAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVD-DLAKNF-FKI 1875          

HSP 10 Score: 81.2629 bits (199), Expect = 6.432e-15
Identity = 139/609 (22.82%), Postives = 256/609 (42.04%), Query Frame = 1
Query:  646 GNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNT-KNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATD----GNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFD-DNFA-IYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQ-KFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQS-KIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKI--QDINDCTPVF---------EKDYFFRITESYGESIKN-------ERLEQIKATDKDLGQN----------------------GTVKYRLIDVKPIGIPGNSKL-----KAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL 2301
            GN    F +K  ++K +E Y  L    +++++ F+ +   L+A D G   +    +V + +   + N P +T++ Y+V+I E       + +I     DP+  KN LV  ++    E  +     F IN +   L   +      +++  + ++A D    G+ + +   V I+++D ND+ P+    N+   + EN      +  +  KD D G N     S+      NL  + F+ D+F+ I K  +  D  F+  K + Y + I+  D G P     + K SI + D+NDN P+F        V ++ P+G+ V    A+D D+ +   I Y + + N++   ++     S  I  D +KT     ++          +D +++ V +  +D+   + +          E     R+ E+   + KN            +  T    GQN                       TV +  I+ K   +  N KL       +  ++ ++  D G + + G LDRE  +   L +  +D G P+ ST+  + I +LD+NDN PV       +    ++    IG  +  +   D D GIN  +T++L
Sbjct:  332 GNPDGTFLLKAAETK-DEYYIELNQFAHLNQQHFI-YNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPIN--MPVIRLKVSDPDLGKNALVYLEIVGGNEGDE-----FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSI-----ANLNAVPFEIDHFSGIVKTTSLLD--FETMKRN-YELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGD--IISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAW--IEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVI---QKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL 916          

HSP 11 Score: 80.4925 bits (197), Expect = 1.040e-14
Identity = 114/435 (26.21%), Postives = 182/435 (41.84%), Query Frame = 1
Query: 1243 VQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPA--MSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSND-NFAISIYGEI---QSKIKFDREKTDSYEFVVTARDNGEPQLNDSMV-VKVKIQDINDCTPVFEKDYFFRITESYGESIKNERL--EQIKATDKDLGQNGTVKYRLIDVKPIGI------PGNSKLKAELR------NLIKVS------FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLND-------NAPVF----LFPS------NNMNFVNVSVEWEI------GKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEI-IIAHTMKEFSN 2391
            ++V D D G+N +    +    + +   I  D          Y     D EK S YT+ +  +DQ N      S  K  I++ D+NDN P F N  K+  + ENN  GS V ++ A D DS  N +I YSI N N   F I  +  I    S + F+  K + YE ++ A D G P    + + + + ++DIND  P FE+         YG+  K+  +  E    +  D      + YRL D    G        G+  +  +L+       ++KVS      F   + +  +L  E++     ++  F       +     + E L L +       +  VF    L PS      +   FVN   E  I      G+T+  ++ KD D G NG +  ++  S+   +  F+I P+ GE+ II +  +E  N
Sbjct:  422 LKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGM------LYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRN-YELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFER------VNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAI--SDGDYDSVFRIDPDRGELQIIGYLDRERQN 841          

HSP 12 Score: 74.3294 bits (181), Expect = 7.099e-13
Identity = 144/552 (26.09%), Postives = 227/552 (41.12%), Query Frame = 1
Query:  310 FSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTT--YPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNG--RMNETSVDIAIEDCNDHPPVISIANRFG-KVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT-----SFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSS-NNGHIVYSILNSNDN--FAISIYGEIQSKIKFDREKTDSYEFVVTAR--DNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRIT-ESYGESIKNERLEQIKATDKD 1908
            FS+ + SG L V S LDRET       T   KL      H         +        +    V +I +N+PI +   Y + V +D        K + + +  G++++ +   +G N  +F+I    SK   I   + + K++DRE    F   + A D G        TV V + D+NDN PE++   Y   I E  + G ++ ++ A   D     N  + Y +    E  K     F ++     L  N            + I A DG      N   V+I+I D ND+ P   + N +   V E+      +  V+  DED   NG+              NI   DN   + I+    T       DRE IS YT+EI+  DQG+P   +    +INI+D NDNAP F +      + EN  +G      +  D D + N     + I + N+   F +   G +++  +F+    D  EFV+  R  DNG P L     V VKI + +   P+        +T  S+ +      + ++ A+D+D
Sbjct: 3112 FSIGKESGILKVASALDRET-------TPKYKLV----AHVQDGKDFTQECFS-----EIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKI----SKSTGI---IRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSID--IGVNADIHYFIMSGNEQGK-----FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTF-LQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVT-----------YNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQD--EFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTP---LEVTINSFEDDFSGAFIGKVHASDQD 3616          

HSP 13 Score: 71.633 bits (174), Expect = 4.571e-12
Identity = 82/333 (24.62%), Postives = 141/333 (42.34%), Query Frame = 1
Query: 1384 FDREKISVYTVEIKCVDQGNPAMSS-----MQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTD------------SYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVE--WEIGKTICTVKTKDLDQGINGTITHSLINSNKREN 2325
            FDRE   +Y + ++        M+S     +    I+++DVNDN P FVN      V  ++P G+ + QV+A+DLDS+ NG + Y +   N        GE+    K DR+  +            +YE  V A D      +    ++VK+  I+   PVFEK +       Y  S+K E +E   A    +     +   LI            + +E ++       G+I V   LD E+ISS  + ++A  D    +     + + ++D+ND      +P    +  N+++      G  I  +   D D G N  +++ + + N + N
Sbjct: 2093 FDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGN--------GEL---FKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQF-------YTVSVK-EDVEMYSALSVSIEAESPLGRSLI----------YTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRA-TDSLSGVYAEVVLSVSIMDVND-----CYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNN 2388          

HSP 14 Score: 71.2478 bits (173), Expect = 6.967e-12
Identity = 80/307 (26.06%), Postives = 139/307 (45.28%), Query Frame = 1
Query: 1384 FDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILN--SNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEP---QLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNER----LEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQ 2271
             DRE  + + +E+   D G+P +SS  +  ++++D+NDN+P F  ++    V  +  +  ++ QV A+D DS  NG I YSI +    + F I S  G I      D +  + +E  + A DNG P   Q     +V V +   +   P+  +    + +E+  +  +N++    + QI A D D   N  + Y + +       GN        N   +  D G I +   LD E   S  L +   D  + +    T ++++V+D+NDN P F   + ++  VN+S   E    I  +   D D+
Sbjct: 1257 LDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVR----KTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISN-------GNDD------NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAF---TNLLVQVIDINDNPPQF---AKDVYHVNISENIEEESVIMQLHATDRDE 1535          

HSP 15 Score: 59.6918 bits (143), Expect = 2.229e-8
Identity = 88/391 (22.51%), Postives = 160/391 (40.92%), Query Frame = 1
Query: 1300 DSGKLNLKNIRFDDNFAIYKIETYPD-TSFDREKISVYTVEIKCV----DQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNG-----EPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTV-KYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREE-ISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASD 2433
            D  KL     +   +FA   I T  +    +REK   Y + +K      D+   +  +     I ++D ND +P F        + E+ P   ++ +V A D D   NG I YS+L  ++ FAI    GEI    +    +   +E  V A D G     +        V + ++ +N   P      F  +T +    I       ++  DKD G NG + +  ++D  P    G   LKA      K  +   ++ + +L+++  I ++ LL +  D G P      ++ I++   + N P+F   +  +  V++     I   +  +K  D D G N  +   ++  N+ +   F+I P+  ++  +T K+    +     L + A D
Sbjct:  108 DKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYG----IVRVNDKDTGINGNIGRLEIVDGNP---DGTFLLKAA---ETKDEYYIELNQFAHLNQQHFIYNLTLLAE--DLGTPRRFAYKSVPIQIKPESKNIPIF---TQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE--FRINPDSGML--YTAKQLDAEKKSSYTLTVSAID 479          

HSP 16 Score: 59.3066 bits (142), Expect = 2.943e-8
Identity = 99/421 (23.52%), Postives = 165/421 (39.19%), Query Frame = 1
Query: 1087 IYITATDG-NGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIET-----YPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDG----YPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLI 2304
            + I ATD  +G   E  + ++I D ND  P I        + EN      +  +   D D G N              +++I   +N  ++ I+      Y  T  D E+I  + + +   D G+P++SS     I + D+NDNAP FV       V      G  V   +A D D S+   + Y I+  N+    SI    G I  +   +     S    ++  D           +K+ +   N  +P+F++  Y  ++ E+    +    +  +KA+D D G    + Y ++               E++ +  +    G I+     DRE+     +L++  D G    + SL            +NDN P FL     M    VS   E  +TI TVK KD D   NG++   ++
Sbjct: 2310 VSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKL--------SYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAY---ARLKISLLPENVYSPLFDQSTYEAQVPENL---LHGHNIITVKASDGDFGTYANLYYEIV-------------SEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVD------VNDNVPYFLLKEYKMV---VSTTVEANQTILTVKAKDDDIVDNGSVHFQIV 2694          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332722)

HSP 1 Score: 158.688 bits (400), Expect = 1.408e-38
Identity = 173/597 (28.98%), Postives = 281/597 (47.07%), Query Frame = 1
Query:  712 LEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXX--APEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRM--NETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDN--APRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSN-NGHIVYSILNSNDN--FAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIG-IPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIA 2463
            L+II  +DRE    +V  +   D GN T S +  + +T ++ N   P   K      + E    G ++  + A D D  +  N  V+Y LS    D       F +N     L  N+      ++N  ++ITA DG   +  +E  V + ++D ND+ PV  +     KV E+  +  +L  ++  DED G N   + SL +  + + +  R D +    + + Y     D E   V+ + +  +D G+P+++S     I IIDVN+N  AP F + +    V EN P G+ V  V A D+D+ + N  I YSI   +    FA++  G I S  + D E  + Y   + A+D     L++ + V +++++ ND  P+ +K  Y+  +TE+   S++N  +  +KA D D+    T+ Y ++    +G    +SK       +IK       +    LDRE  +   L V   D+G P LS+T+ I++ VLD+NDN+P F      +  V V     + ++I  V   D D G NG IT+S I S K +N  F+I  + G I IA  +   + F      + IKA D G   K+  A
Sbjct:  829 LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDAD--SGINAQVTYALSVECSD-------FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQ-DEELFRIDKHTGAIRTQGY----LDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEA---SVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSK-----TGVIK-------TTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEF---DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYS-IKSGKGKN-KFRIDSQRGHIHIAKPLDSDNEF-----EIHIKAEDNGIPKKSQTA 1386          

HSP 2 Score: 149.828 bits (377), Expect = 6.426e-36
Identity = 177/621 (28.50%), Postives = 283/621 (45.57%), Query Frame = 1
Query:  661 FFQIKNPKSKQEEIYPSLE--IIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDIL-ELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATDGNGRMNE--TSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI---SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKAS--DLGQNPKNNIATLYIRYI 2484
            FF +   K  Q +I  S E  I K +DRE+ + +   +IATD G  T    V + V D+NDN P   K  Y ++  E  S G  L E+ A D D        + + LS +  D       F I      L   +++  ++R      ++     DG     E  + + I + D ND+ P+ S+A     V E+ +   ++T V   D+D G N   + SL      N    +   +  I ++      S DRE IS++ + +K  D G P + S+   ++NI+D+NDN P F  +     ++EN   G+ V +V A  +D   N  I Y I++ N+       S  G++      D E +  Y   + A D G P L+++  V + I DIND +P F ++  +RI  +    + ++ L+ +KATD+D   NG V Y +     IG     +   + +N       G ISV   LDRE IS   L +QA D G P    +  I I +LD NDNAP+  F S+N + V +     +G    T K  D D+  N T  ++    +  E   F+++ +G +    T   F++  +L D  +I+    D G  P  + A + ++ I
Sbjct: 3003 FFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATD-GKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD----FQSKLRFYLSGKGADD------FSIGKESGIL---KVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE---NHDYFKISKSTGIIRLHK----SLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQN-LYRINVNEDIFVGSKILD-VKATDEDSDVNGLVTYNIERGDNIG-----QFSIDPKN-------GTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPI--FSSSNYSVV-LQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGSL---RTASRFNH--NLQDEFVIQVRVFDNGTPPLYSDAWVVVKII 3579          

HSP 3 Score: 144.05 bits (362), Expect = 3.931e-34
Identity = 122/422 (28.91%), Postives = 197/422 (46.68%), Query Frame = 1
Query: 1243 VQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDN--APVFLFPSNNMNFV---NVSVEWEIGKTICTVKTKDLDQ-GINGTITHSLINSNKRENFPFKIQPEGEII-IAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIR 2478
            ++ KD D G NG    +++D    ++   R D +    +I  Y     DRE+ + Y + I   D GNP  S+ +   I I+DVNDN P     +  F + E+  IG+ V  + A D DS  N  + Y++     +F + +  G ++     DREK D+Y   +TA+D G P L+   +V V + D+ND  PVF  ++Y F++ E      +   L  I+A D+D+G N  +++ L            K + +   L ++    GAI   G LD E      L+V A D G PSL++  +I+I ++D+N+N  AP F       +FV    V      G  +  V  +D+D   +N  IT+S+   +      F +  +G I  ++    E  NF      L + A D    P +N   +YI+
Sbjct:  794 IEAKDRDLGYNGKLVFAISDGDYDSV--FRIDPDRGELQIIGY----LDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLP---RGTVLAVIEAVDEDIGPNAEIQFSL------------KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEF------DDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLG--IFAVNDQGSITSLSQLDAETKNFY----WLTLCAQDCAIVPLSNCVEVYIQ 1182          

HSP 4 Score: 102.834 bits (255), Expect = 1.540e-21
Identity = 93/359 (25.91%), Postives = 157/359 (43.73%), Query Frame = 1
Query: 1129 TSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNG---MFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLE-----QIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPV 2172
             +V + I D ND+PP  S+     K+LEN      +  V     D G N     F  S N+ GK  + +   D            + + D E    Y + I+ +D G P +S+    +I+I+D+NDN+P F+  +   +V E+  +GS +  V+A D DS  NG + Y+I   ++    SI    G I      DRE    Y   + A D G+PQ  +S+ + + I D ND  P+F        + +Y   ++  RL        K +D D   N T  Y   D++     GN         L ++  DG++      +        + V+ FD+G P L +   +++++++ +   P+
Sbjct: 3257 ATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGD---------LVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFS-------SSNYSVVLQENRLLGYVFLTFKISDADETPN-TTPYTF-DIRS----GNEG------GLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPI 3587          

HSP 5 Score: 102.449 bits (254), Expect = 1.823e-21
Identity = 133/473 (28.12%), Postives = 190/473 (40.17%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL-NSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSF-----DGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGKKSHS 2535
            V I + D ND+ P          V EN ++ I L  V   D D G NG     L +S   N++NI FD    IY       TS DRE  S Y  ++   D G+P   +    +I I+D NDNAP F   I+   V EN   G+ +  +  +D D        + +  +    F I   GE+      DRE+   Y   + A D    +      V++ ++DIND TP   K    R   S  ESI                   ++   L++VK I     SKL+  L       F      G + V   LDRE     +L+    D    +    + III V D+NDN P+F   S     V+V  + ++   I  V   D D G+N  I +SL+  N      FKI     II  H   +          L +KA D G    ++IAT+ +  +    N NP     + +S
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYL-ESDTENIQNI-FD--IDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKP---RYHISTNESI-------------------SIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF---SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDY---FKISKSTGIIRLHKSLDRETISLF--NLTVKAEDCGVPKLHSIATVAVNILD--INDNPPEFSMRQYS 3279          

HSP 6 Score: 102.064 bits (253), Expect = 2.534e-21
Identity = 147/554 (26.53%), Postives = 232/554 (41.88%), Query Frame = 1
Query:  844 PEWTKDNYKVNIQE-CQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVS--QIFYINGNKLHLTNNRISGLINRNNIRIYITATDGN-GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL--NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYG---------ESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTT--IIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICT--VKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASD 2433
            P++ KD Y VNI E  + E  I++L A DRD+    +  + Y L   T+D   ++  +I  I+GN +     R+       +I I      G  G+ N   + + + D NDH P  +      KV E+      L  V+  D D G N   + S+   + G +       D  F I  +      + +  KI  Y +++K VD GNP +SS     I +    ++ P+F        + EN PIG+ V QV A    S     I ++I++ N N +  I    G I      D E    +   V   +        +++  + I D ND  P F + +Y   + ES           +S K+    Q+K  D D+G NG V+Y ++D                +N  K+ S  GAI +   LD E  +     V   D G P L +TTT  + I V+++ND  PVF     N   +NV++     + +    V  KD D   N T+   +++ N  E   F+I+    II     +  +N       L ++ASD
Sbjct: 1504 PQFAKDVYHVNISENIEEESVIMQLHATDRDE----DKKLFYHLH-ATQDPSSLALFRIDSISGNVI--VTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSV----FEIDPTFGIITLAG----NLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSS-----IFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNII--IHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVK--DADVGVNGMVEYHIVD-------------DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF-----NERELNVTLFLPTFENVFVRQVSAKDAD---NDTLRFDIVDGNTNEC--FQIEKYTGIITTRNFEILNNENDRDYALHVRASD 2010          

HSP 7 Score: 102.064 bits (253), Expect = 2.975e-21
Identity = 71/263 (27.00%), Postives = 122/263 (46.39%), Query Frame = 1
Query: 1399 ISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVS-FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP 2184
            ++ Y   ++  D+G P   S    SI II+ + N P F     +  ++E+ P G+ + ++  +      N    +SI    D+F IS  GE+  +   DRE+ +S+  +V A  +  P       V + ++D ND  P F+  ++        E + +  L ++ ATD D G NG ++Y L                 ++N+  +  + G I++  +LDRE  S     V A D+G+P       + I+++D NDNAPVF  P
Sbjct: 2726 VNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMI-----GNYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVIS--LVKVSATDADTGPNGDIRYYL-----------ESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLP 2970          

HSP 8 Score: 92.8189 bits (229), Expect = 1.627e-18
Identity = 111/410 (27.07%), Postives = 181/410 (44.15%), Query Frame = 1
Query: 1111 NGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITE--SYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            N R   TS+DI++ D ND+ P+      +  V  +  +  I+  V+  D D   NG     L    K N +  + D       I+ + +   +R     Y + +   D      SS     + +ID   + P F  +     V E+  + S +    +++ +S     ++Y+I + + +F I    G I    + D EK  S++  + A D+    +   +V+ V I D+NDC P  E D Y   I E  S+G  I      +I ATD D G N  + Y    ++ I    NS+L       I V+ DG + +   LD E+I    ++V   D G PSLS+ + + I V DLNDNAP F+ PS    F  VSV    G+ +   K  D D     ++ + ++  N+ + +
Sbjct: 2118 NVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELK---KGNGELFKLDRKSGELSIKQHVE-GHNRN----YELTVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDVEMYSALSV--SIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLS-GVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQIL-----KINATDNDSGANAKLSYY---IESINGQNNSELF-----YIDVT-DGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPS---YFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTY 2497          

HSP 9 Score: 87.0409 bits (214), Expect = 1.086e-16
Identity = 109/440 (24.77%), Postives = 183/440 (41.59%), Query Frame = 1
Query: 1093 ITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPD-----TSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIK----ATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSF-----DGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL-------FPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI 2340
            I+ TDG      T++ + + D ND+PP  +       + EN +++ ++  +   D D+ +   +          +L   +   + A+++I++           D EK + + + +   DQG P   +  K  +N+ D ND+ P F  KI    V E+  IGS + +VRA+D DS +N  I YSI+  N      I   +G I      +  K   Y   V A D G P L+  + V + +    +  P F  +           +I  E  E +      T      + ++ + +I        GN          I  SF      G I + GN+D E I    L V+  +    + S+   III +LD NDN P F+        P +      V    +  K   T++ KD D G+NG + + +++ +  +NF FKI
Sbjct: 1479 ISVTDGTFTAF-TNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFY----------HLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTN-----------NIAIEIFENLPIGTFVTQVTARSSSSIFFNIIS-------GN----------INESFRINPSTGVIVINGNIDYESIKVFNLTVKGTN--MAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVD-DLAKNF-FKI 1875          

HSP 10 Score: 81.2629 bits (199), Expect = 6.488e-15
Identity = 139/609 (22.82%), Postives = 256/609 (42.04%), Query Frame = 1
Query:  646 GNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNT-KNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATD----GNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFD-DNFA-IYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQ-KFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQS-KIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKI--QDINDCTPVF---------EKDYFFRITESYGESIKN-------ERLEQIKATDKDLGQN----------------------GTVKYRLIDVKPIGIPGNSKL-----KAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL 2301
            GN    F +K  ++K +E Y  L    +++++ F+ +   L+A D G   +    +V + +   + N P +T++ Y+V+I E       + +I     DP+  KN LV  ++    E  +     F IN +   L   +      +++  + ++A D    G+ + +   V I+++D ND+ P+    N+   + EN      +  +  KD D G N     S+      NL  + F+ D+F+ I K  +  D  F+  K + Y + I+  D G P     + K SI + D+NDN P+F        V ++ P+G+ V    A+D D+ +   I Y + + N++   ++     S  I  D +KT     ++          +D +++ V +  +D+   + +          E     R+ E+   + KN            +  T    GQN                       TV +  I+ K   +  N KL       +  ++ ++  D G + + G LDRE  +   L +  +D G P+ ST+  + I +LD+NDN PV       +    ++    IG  +  +   D D GIN  +T++L
Sbjct:  332 GNPDGTFLLKAAETK-DEYYIELNQFAHLNQQHFI-YNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPIN--MPVIRLKVSDPDLGKNALVYLEIVGGNEGDE-----FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSI-----ANLNAVPFEIDHFSGIVKTTSLLD--FETMKRN-YELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGD--IISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAW--IEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVI---QKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL 916          

HSP 11 Score: 80.1073 bits (196), Expect = 1.161e-14
Identity = 114/435 (26.21%), Postives = 182/435 (41.84%), Query Frame = 1
Query: 1243 VQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPA--MSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSND-NFAISIYGEI---QSKIKFDREKTDSYEFVVTARDNGEPQLNDSMV-VKVKIQDINDCTPVFEKDYFFRITESYGESIKNERL--EQIKATDKDLGQNGTVKYRLIDVKPIGI------PGNSKLKAELR------NLIKVS------FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLND-------NAPVF----LFPS------NNMNFVNVSVEWEI------GKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEI-IIAHTMKEFSN 2391
            ++V D D G+N +    +    + +   I  D          Y     D EK S YT+ +  +DQ N      S  K  I++ D+NDN P F N  K+  + ENN  GS V ++ A D DS  N +I YSI N N   F I  +  I    S + F+  K + YE ++ A D G P    + + + + ++DIND  P FE+         YG+  K+  +  E    +  D      + YRL D    G        G+  +  +L+       ++KVS      F   + +  +L  E++     ++  F       +     + E L L +       +  VF    L PS      +   FVN   E  I      G+T+  ++ KD D G NG +  ++  S+   +  F+I P+ GE+ II +  +E  N
Sbjct:  422 LKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGM------LYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRN-YELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFER------VNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAI--SDGDYDSVFRIDPDRGELQIIGYLDRERQN 841          

HSP 12 Score: 74.3294 bits (181), Expect = 6.981e-13
Identity = 144/552 (26.09%), Postives = 227/552 (41.12%), Query Frame = 1
Query:  310 FSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTT--YPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNG--RMNETSVDIAIEDCNDHPPVISIANRFG-KVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT-----SFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSS-NNGHIVYSILNSNDN--FAISIYGEIQSKIKFDREKTDSYEFVVTAR--DNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRIT-ESYGESIKNERLEQIKATDKD 1908
            FS+ + SG L V S LDRET       T   KL      H         +        +    V +I +N+PI +   Y + V +D        K + + +  G++++ +   +G N  +F+I    SK   I   + + K++DRE    F   + A D G        TV V + D+NDN PE++   Y   I E  + G ++ ++ A   D     N  + Y +    E  K     F ++     L  N            + I A DG      N   V+I+I D ND+ P   + N +   V E+      +  V+  DED   NG+              NI   DN   + I+    T       DRE IS YT+EI+  DQG+P   +    +INI+D NDNAP F +      + EN  +G      +  D D + N     + I + N+   F +   G +++  +F+    D  EFV+  R  DNG P L     V VKI + +   P+        +T  S+ +      + ++ A+D+D
Sbjct: 3112 FSIGKESGILKVASALDRET-------TPKYKLV----AHVQDGKDFTQECFS-----EIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKI----SKSTGI---IRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDI--GVNADIHYFIMSGNEQGK-----FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTF-LQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVT-----------YNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQD--EFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTP---LEVTINSFEDDFSGAFIGKVHASDQD 3616          

HSP 13 Score: 71.633 bits (174), Expect = 4.421e-12
Identity = 82/333 (24.62%), Postives = 141/333 (42.34%), Query Frame = 1
Query: 1384 FDREKISVYTVEIKCVDQGNPAMSS-----MQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTD------------SYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVE--WEIGKTICTVKTKDLDQGINGTITHSLINSNKREN 2325
            FDRE   +Y + ++        M+S     +    I+++DVNDN P FVN      V  ++P G+ + QV+A+DLDS+ NG + Y +   N        GE+    K DR+  +            +YE  V A D      +    ++VK+  I+   PVFEK +       Y  S+K E +E   A    +     +   LI            + +E ++       G+I V   LD E+ISS  + ++A  D    +     + + ++D+ND      +P    +  N+++      G  I  +   D D G N  +++ + + N + N
Sbjct: 2093 FDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGN--------GEL---FKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQF-------YTVSVK-EDVEMYSALSVSIEAESPLGRSLI----------YTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRA-TDSLSGVYAEVVLSVSIMDVND-----CYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNN 2388          

HSP 14 Score: 70.8626 bits (172), Expect = 7.517e-12
Identity = 80/307 (26.06%), Postives = 139/307 (45.28%), Query Frame = 1
Query: 1384 FDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILN--SNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEP---QLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNER----LEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQ 2271
             DRE  + + +E+   D G+P +SS  +  ++++D+NDN+P F  ++    V  +  +  ++ QV A+D DS  NG I YSI +    + F I S  G I      D +  + +E  + A DNG P   Q     +V V +   +   P+  +    + +E+  +  +N++    + QI A D D   N  + Y + +       GN        N   +  D G I +   LD E   S  L +   D  + +    T ++++V+D+NDN P F   + ++  VN+S   E    I  +   D D+
Sbjct: 1257 LDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVR----KTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISN-------GNDD------NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAF---TNLLVQVIDINDNPPQF---AKDVYHVNISENIEEESVIMQLHATDRDE 1535          

HSP 15 Score: 59.6918 bits (143), Expect = 2.155e-8
Identity = 88/391 (22.51%), Postives = 160/391 (40.92%), Query Frame = 1
Query: 1300 DSGKLNLKNIRFDDNFAIYKIETYPD-TSFDREKISVYTVEIKCV----DQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNG-----EPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTV-KYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREE-ISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASD 2433
            D  KL     +   +FA   I T  +    +REK   Y + +K      D+   +  +     I ++D ND +P F        + E+ P   ++ +V A D D   NG I YS+L  ++ FAI    GEI    +    +   +E  V A D G     +        V + ++ +N   P      F  +T +    I       ++  DKD G NG + +  ++D  P    G   LKA      K  +   ++ + +L+++  I ++ LL +  D G P      ++ I++   + N P+F   +  +  V++     I   +  +K  D D G N  +   ++  N+ +   F+I P+  ++  +T K+    +     L + A D
Sbjct:  108 DKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYG----IVRVNDKDTGINGNIGRLEIVDGNP---DGTFLLKAA---ETKDEYYIELNQFAHLNQQHFIYNLTLLAE--DLGTPRRFAYKSVPIQIKPESKNIPIF---TQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE--FRINPDSGML--YTAKQLDAEKKSSYTLTVSAID 479          

HSP 16 Score: 59.3066 bits (142), Expect = 3.070e-8
Identity = 99/421 (23.52%), Postives = 165/421 (39.19%), Query Frame = 1
Query: 1087 IYITATDG-NGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIET-----YPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDG----YPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLI 2304
            + I ATD  +G   E  + ++I D ND  P I        + EN      +  +   D D G N              +++I   +N  ++ I+      Y  T  D E+I  + + +   D G+P++SS     I + D+NDNAP FV       V      G  V   +A D D S+   + Y I+  N+    SI    G I  +   +     S    ++  D           +K+ +   N  +P+F++  Y  ++ E+    +    +  +KA+D D G    + Y ++               E++ +  +    G I+     DRE+     +L++  D G    + SL            +NDN P FL     M    VS   E  +TI TVK KD D   NG++   ++
Sbjct: 2310 VSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKL--------SYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAY---ARLKISLLPENVYSPLFDQSTYEAQVPENL---LHGHNIITVKASDGDFGTYANLYYEIV-------------SEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVD------VNDNVPYFLLKEYKMV---VSTTVEANQTILTVKAKDDDIVDNGSVHFQIV 2694          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 155.221 bits (391), Expect = 1.708e-37
Identity = 202/752 (26.86%), Postives = 332/752 (44.15%), Query Frame = 1
Query:  232 NVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG---NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRM--NETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN-FAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWE-IGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMK-EFSNFRSLPD---RLIIKASDLGQNP 2448
            N Y       NS     +K  + D  F +N +SGD+ +   LDRE   E T    +M       T    + +E+ DINDN PVF+       ++EN+P GT    P A DKD              +G++ + +   +G +   F I    S+  EI         +DREE   +   L+A D      +  S  +T+ V+DVNDN P++    Y V + E  S+G+ +    A D DD   +N +V Y +S R +    ++    +   KL L     S   +     I I+A D   +   ++  + + +      P    +AN    + E+ +   ++T V      KG  G    ++  +G +   ++R D N  +  +        D E   +Y + I+  D   P++ S+   ++N+ D NDNAP     I    V+E       +  V+A D DS +NG+++Y + N  D  F I+  GEI ++++ DRE+   Y FVV A D G P +  +  V + + D ND  P F + +   +TE+   +     + ++ ++D DLG N    Y   +      PG  K + E ++       G I+V G+LDRE+     L V A D  +      T I I + D NDNAP F     + +F  +      +G+ I T + K   QG N  I++SL    ++ +  F I P  GE+     ++ + S +   P+    L + A+D G+ P
Sbjct: 2409 NAYDADTPPLNSQVRYFLKEGDSD-LFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKD--------------EGLNAKLRFNLLGEHMHRFHID---SETGEI----STATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDD--GENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSH--DDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAI--AGGIMGDSLRVDPNSGLLSVG---QDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTEN---AEIGSFVIRVTSSDLDLGANANASYSFSEN-----PGE-KFRIEPQS-------GNITVAGHLDREQQDEYILKVVASDGAW---RAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDK---QGPNSVISYSL----QQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPP 3103          

HSP 2 Score: 147.517 bits (371), Expect = 3.294e-35
Identity = 200/737 (27.14%), Postives = 318/737 (43.15%), Query Frame = 1
Query:  169 VITLNVEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYING----NKLHLTNNRISGLINRNNIRIYITATD-GNGRMN-ETSVDIAIEDCNDHPPVISI-----ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAIS---IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQI-KATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPS-LSTTTTIIIEVLDLNDNAPVFLFP-------SNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL 2301
             +  + +F V E    G  VG + +K    P  S     + NE    F+L+  +G++     LDRE +    ++   + +   Q T+ I++ I++ D+NDN P F      I+  E+   GT   L  A D D  + GV   Y      +D         N F+     NP       Y  LE   N+DRE   S+   + A D G+  + G   V V + DVNDN P +   +Y V++ E    G  ++ ++A+D D  +  N  ++Y L++      +  +   I+     N    TN + S   ++ +    + A D G+ R +  T V + + D NDH P+IS        +   V EN     ++  V VKD D G NG     +    +L    +    +  I ++    +   DRE+I  Y + +  +DQG PA ++     I++ DVND+ P F        + E  P GS V  + A D D+  N  + Y IL+ N+    S   + G I +    DRE  D+ E  ++ARD G         +KV I D ND  P F +        + GE    + +  +  ATD D G NG+V + L        P    L A           G ++    LDRE++S  ++ V A D G P+  S T T+ + V D+NDN P F +P       +++ + + +  E E  + +  V   D D G N  I + L
Sbjct:   64 AVDTSADFEVLEGQPRGTTVGFIPTK----PKFS----YRFNEPPREFTLDPVTGEVKTNVVLDREGM----RDHYDLVVLSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVD---------NKFRLVTTANPSGDTS--YLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGD--NSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSA--SQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRV----NGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQR---EQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDA---------LTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQF-YPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRL 756          

HSP 3 Score: 144.821 bits (364), Expect = 2.521e-34
Identity = 138/513 (26.90%), Postives = 221/513 (43.08%), Query Frame = 1
Query: 1072 RNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRN-----GMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL--NSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNG------------------------------------EPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPD-RLIIKASDLG-QNPKNNIATLYI 2475
            ++   + I  +DG  +  E    I + D ND+PP+         + EN ++   +  +  +D D G+N     G+     ND   LN +         +  +        D E++  Y + ++  D G P++S+      N++D+NDNAP F        V EN PI + V  V A D+DS NNG I YSI   + +  F I   G I+++   DRE   +Y   VTARD                                      + +L+ ++ V + I+D+ND  PVF       I E+      N  +  +KA D D G+NG + Y + + +   +  +  L   L        DG + V   LDRE  SS  L + A D G P  ST + ++I +LD NDN+PVF          +V+    IG  +  V   D+D+G NG I +S++  ++  +F    +  G + +A  +    N+  L    L ++A D   +NP  + A L I
Sbjct: 1888 KSKYELRIRVSDGV-QYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQT-------GMLTLTA----RLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVA---INTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLN-----PTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVF---DPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSIS-EDTGVVRVAKNL----NYERLSRYSLTVRAEDCALENPAGDTAELTI 2372          

HSP 4 Score: 143.28 bits (360), Expect = 7.653e-34
Identity = 122/420 (29.05%), Postives = 179/420 (42.62%), Query Frame = 1
Query: 1147 IEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY-GEIQSKIKFDREK---------------------TDSYEFV-VTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDG--YPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            I D NDH PV    +    + E  K       +   D D G NG     + +     +  + F D +   +         DRE+   Y + + C D G P+ SS+    I++ID NDNAP+F N    F + EN P  + VG++ A+D D   N  + +++ +   +F I    G I++   FDRE                        +Y  +  T  DNG P+L D + VKV + D+ND  P F    Y   I+E   E      +  +   D D G NG V Y L         GN   +  L      S  G +S+   LDRE      L+V A D    +P LS+  +I I VLD NDNAP F   S+ ++ +  S     G  +   +  D DQG+N  +  S+   N+R+ F
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGV-FPDGYLFVR------APLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGT---HITHVFTQDADEGLNGDVYYSLAK-------GNEAGQFNLD-----SATGQLSLGRRLDRESQEIHHLIVVAKDAALKHP-LSSNASITIVVLDENDNAPEFTQSSSEVSVLETS---PTGTELMRFRASDADQGVNSQVVFSISAGNRRDTF 1432          

HSP 5 Score: 139.043 bits (349), Expect = 1.563e-32
Identity = 168/634 (26.50%), Postives = 282/634 (44.48%), Query Frame = 1
Query:  730 IDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXX--APEWTKDNYKVNIQE-CQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNK-------LHLTNN--------RISGLINRNNIRIYITATD-GNGRM-NETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL---NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQG-NPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN--DNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPS---LSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGK----TICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGKKS 2529
            +DREE   +   +   D G  + S  V V++  +++N  AP++T   +  +I E   ++  + +L A DRD    +N  +S+ LS +T+D  I ++  +I   +       + ++ N         + G +  N + +  T +D G  R+ ++  V + + D ND+ P    A     + E   +   +T V  +D D+G NG    SL   N++G+ NL +     +              DRE   ++ + +   D      +SS    +I ++D NDNAP F        V+E +P G+ + + RA D D   N  +V+SI   N  D F I SI G +      D E   SY   +TA D G P L+ +++  V + D ND  P+F      R  +  G  +K   +  + A D D G NG V Y +   +P  +P       + R+    +  G I     +DRE I + +L V A D   PS   LST   + + V D+NDNAPVF+    +MN   +  ++   K     +  V  KD D   NG +T+ +++  +     FK+Q    II      +F   + +  +L +K++D     +   + +YI      T + P S G +S
Sbjct: 1111 LDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRD--IGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLG---------RRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKE-GIPLKTP-IVTVTADDPDSGLNGKVSYAISKQEP-QLP-------QGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFV----SMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQEL---FKLQRNTGIITFTPGPQFK--QEVRYQLTLKSTDEAVQSERRSSEVYI------TIITPGSGGSES 1708          

HSP 6 Score: 137.117 bits (344), Expect = 6.112e-32
Identity = 131/433 (30.25%), Postives = 192/433 (44.34%), Query Frame = 1
Query: 1117 RMNET-SVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNG-----MFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL--NSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNG-EPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTM 2376
            R++ T  V I I+D ND  PV   AN    ++EN     ++  V+  D D+GRNG     M E    D G+ +      +      ++      + DRE  S Y + I   D+G P  S+  +  I I+D NDN+P F  K     V EN  IG+ V QV A D+D   NG I YSI+  + N +F+IS   G ++     + E+   Y   V A D   E    D+  + + I DIND  P F +  Y  R+ E+                  + G   TV     D  P+       LK    +L ++ +  G I++   LDRE+ S   L + A D G P L+ T  + +EV D+NDN PVF   S +     V      G  + T +  D D+G+N  +  +L+  +      F I  E GEI  A T+
Sbjct: 2146 RLSSTVKVTILIKDVNDEVPVFISANETA-IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVD----ALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMEN--------------TVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYH---ATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR---FHIDSETGEISTATTL 2553          

HSP 7 Score: 129.413 bits (324), Expect = 1.244e-29
Identity = 169/645 (26.20%), Postives = 287/645 (44.50%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXX-----APEWTKDNYKVNIQE-CQSEGD---ILELIANDRDDPNTKNGLVSYQLSDRTED----RKIVSQIFYINGNK--------LHLTNNRISGLINRNNIRIYITA-TDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQK--QKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREK-ISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN-FAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVF-LFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            F +T  V  I+E IP+ T      A D DS   G  +Y I++     QE Q+   G +F      N ++        +  ++ IDRE   +F   ++ATD    +     T  +  V        AP +   N  +   +   S+G    ++++ A D D  ++ NGLV+Y++    ++    ++    I +  G +        L L +   +    R +  +YIT  T G+G  +E+SV          P     +   G V EN+     I+  T  +   +      F  ++  +G     +  FD +  +  + T  +   DRE     Y VE+  +  G    +S  K  + ++D ND+ P+F++   +++V E+  IG T+  +RA D D+   G + + +++ +D  F +    G++      DRE    YE  +   D    Q  ++    +++ D ND  P+FE   Y F I E+   + +  ++ QI A D DLGQN  + Y ++          S    ++ +L   +  G +++   LD EE+    L+VQA D+G PSLSTT T+   VLDLNDNAP+F     ++  F NV +  E    + TV  KD+D G NG I +S+   +    F
Sbjct: 1489 FPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISK-----QEPQLPQ-GRHFGI----NTETG------VIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDAD--SSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGG-SESSV----------PQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIE---YFVTNVTATGSRGQVDRLFDIDAKLGILSTAAE--LDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTL--GSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDG--VQYTEAYAT-IQVSDTNDNPPLFEDTVYSFDIPEN---AQRGYQVGQIVARDADLGQNAQLSYGVV----------SDWANDVFSLNPQT--GMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATE----VVTVSAKDIDSGNNGLIEYSITAGDVDSEF 2075          

HSP 8 Score: 125.561 bits (314), Expect = 1.946e-28
Identity = 162/595 (27.23%), Postives = 264/595 (44.37%), Query Frame = 1
Query:  754 FVFILIATDFGNQT--GSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKN---GLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY----GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYF-FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTT----IIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLD-QGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM--KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYI 2475
            +   ++ATD G       C V + + D ++N P++ +  Y   + +    G  I+ + AND+ D  T      L+++ LS           IF +  +   +T  +   +       + + ATD     + +ET V I +   N   P  S+ +    V EN+     + TV   D+D G NGM   S+  SG    ++   D+      I+       D + I  Y + I   D G   +SS+   +I + DVNDN P F +K    ++ EN P+G+ V Q  A D DS  N  I Y+ L S  +    I     G I S + FD E+   Y   + A+ N +  +     + V +  +N+  P F +  F F ++E+   S    R+  ++ATDKD G++G V Y L+        G+S  K       ++  + G I V  +LDRE  + + L V A +  Y S+    T    +II + D ND  P F+    +     +S    +G  + TVK  D D +  N   ++S+IN N +++F   +Q  GEI  A  +  +E S +      L+I A D G  P+   AT++I
Sbjct: 3090 YALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLS----------SIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSI--SGGNERQDFSVDERTGGIVIQQ----QLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAK-NPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSET---SAVGTRVGAVQATDKDSGEDGRVYYLLV--------GSSNDKG-----FRIDTNTGLIYVARHLDRETQNRVVLTVMAKN--YGSIRGNDTDEAQVIISIQDGND-PPEFI---KHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQ-TGEISTASRLDREETSTY-----NLVIGAIDTGLPPQTGSATVHI 3639          

HSP 9 Score: 112.464 bits (280), Expect = 1.648e-24
Identity = 118/422 (27.96%), Postives = 189/422 (44.79%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVL---ENQK--QKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIET--YPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY--GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYF-FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRL--------IDVKPIGIPGNSKLKA----ELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAF--DDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            V+IAI D ND+ PV ++       +   EN    Q+I L+  +V+D D G N     SL ++          +  F I  +    Y       E  S+  VE+   D G+P +SS    S+ I DVND+ P F +      + E   + +    + A D+D  +NG I Y I+  N      ++  G +  +   DRE+ D Y   V+ RD G+P  +  + V + + D ND  P F    F F I E+   +  +  + ++ A D+D+G+N  + + L        ID +      N  +K     +   L+KVS +   S      R  ++   +L++A   D+G P L     + + V D+NDNAP FL    +   V +S     G  I  V T+D D+G+NG + +SL   N+   F
Sbjct:  928 VNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLS--RVRDRDAGVNSRISYSLTNNP---------NQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPEN---APADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTR------NGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYH---VTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQF 1326          

HSP 10 Score: 109.768 bits (273), Expect = 1.131e-23
Identity = 115/433 (26.56%), Postives = 181/433 (41.80%), Query Frame = 1
Query: 1069 NRNNIRIYITATDGNG--RMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT---SFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAP-----RFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSND--NFAISIYGE---IQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGY-PSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKR 2319
            +R + ++ I+A DG    R     V++ I D ND+PP+   ++    + E       + TV   D D G N      L ++      N          ++     T   S   +K  V+TV  +  D G+P        ++N++D ND+ P      F +  K+  V EN   G+ V  V   D DS  NG     I++ N+  +F +    +   ++     DRE+   Y   V A D G P    +  + + + D+ND  PVFEK  +  +      +     +  I ATD+D G N  V Y ++        GN     EL+        G I   G LDRE   +++L + A D G  P  + T   +I +LD ND AP F   S     V +  +      +  +   D DQG NG++T +L  S +R
Sbjct:  232 SRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFAR--DHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPT--GSFVASITATDEDTGVNAQVHYDILS-------GN-----ELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVI-ILDENDEAPQF---SQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVER 644          

HSP 11 Score: 98.9821 bits (245), Expect = 2.605e-20
Identity = 158/640 (24.69%), Postives = 269/640 (42.03%), Query Frame = 1
Query:  619 DQENQVKTIGNNFQ-FFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYI---TATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDK-GRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY---GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRIT---ESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNF-VNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSL 2493
            D  N +  + N+F   F+I    ++  EIY  + +    DREE   + F++ A D G  + TG+ +V + + D NDN P++T+  + +N+ E    G  ++ + ++D D     N   SY  S+   ++      F I     ++T   ++G ++R     YI    A+DG  R  ET + I I+D ND+ P    +       E Q+   ++  +   D DK G N +   SL     +   +    + F+  K   +  + + R   ++Y + +   D G P + S    +INI+D ++N P+F     +  + ++   G  + +V A D        + YS++  N +   S+    G I             YE VV A D G P  +D   V + +   N  TP F  + +  I    E  G +I       + ATD D G NG ++Y +         GN     E ++       G I +   LD + I    L +   D GY  LS+   + I + D+NDN PVF    N+  +   +     +G  +      D D   N  I ++ + S    +F    Q  G I  A +  ++   R     L IKA    +NP +++ +    Y+H L
Sbjct: 2841 DNGNVIYRLQNDFDGTFEI----TESGEIYTRMRL----DREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR-LFSLNVTENAEIGSFVIRVTSSDLD--LGANANASYSFSENPGEK------FRIEPQSGNIT---VAGHLDREQQDEYILKVVASDGAWRA-ETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFS-KKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILT-----VGATDDDTGPNGMLRYSISG-------GN-----ERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVF----NHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSF-DYEERRIY--TLQIKA----KNPDSSMESYANLYVHVL 3430          

HSP 12 Score: 97.0561 bits (240), Expect = 9.965e-20
Identity = 125/458 (27.29%), Postives = 193/458 (42.14%), Query Frame = 1
Query:  844 PEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLI--NRNNIRIY---ITATDGNGRMNE-TSVDIAIEDCND-HPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKIS--VYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLD-SSNNGHIVYSILNSN--DNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDY---FFRITESYGESIKNERLEQIKATDKDLGQNG-TVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDN 2163
            P +    Y   I E +  G  + +  A D+D P  KN ++ Y       DR      F+I    ++ +N  IS  +  +    RIY   I A + +  M    ++ + +   N+ +P  +     F  V E       +  VQ  D+D G +G     L   G  N K  R D N  +  +  +     DRE  +  V TV  K         +   +  I+I D ND  P F+       + E  P+G+ V  V+A+D D  + N    YSI+N N   +F I +  GEI +  + DRE+T +Y  V+ A D G P    S  V ++++D+ND  P F  +    +    E  G SI       + A+D DL +NG    Y+LI  K       S L  + RN       G +    + DRE    ++ +++  D G P   +   + I VLD NDN
Sbjct: 3332 PVFNHKEYHCYIPENKPVGTFVFQAHAADKDSP--KNAIIHYAFLPSGPDRH-----FFI----MNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHF-DVSETSAVGTRVGAVQATDKDSGEDGRVYYLL--VGSSNDKGFRIDTNTGLIYVARH----LDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMT-----LIASDPDLPRNGGPFTYQLIGGK-----HKSWLSVD-RN------SGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN 3753          

HSP 13 Score: 86.2705 bits (212), Expect = 1.893e-16
Identity = 142/573 (24.78%), Postives = 240/573 (41.88%), Query Frame = 1
Query:  271 RSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQE----NQV-KTIGNNFQF-----------FQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATD-GNGRMNET---SVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDED-KGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLD-SSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDL 1911
            R S+   NE+   FS++  +G ++++  LD + I E         L     +    + I + D+NDN PVF   +    I EN P+GT      A DKDS K  +  +Y     G D+     NQ   TI +   F            + KNP S       S+E   N+       +V +L   +F                    P++ +  +  ++ E  + G  +  + A D+D  + ++G V Y L   + D+      F I+ N   +   R      +N + + + A + G+ R N+T    V I+I+D ND PP          + E       +TTV+  D+D + +N  F  S+ +    NLK   F  +    +I T   +  DRE+ S Y + I  +D G P  +      I + DVNDN P F  +    ++ EN P G+++  + A D D   N G   Y ++       +S+    G ++S   FDRE T   E ++   D+G+P+     ++ + + D ND  P   +     ++   G+   N +L  ++  D D+
Sbjct: 3265 RYSISGGNERQD-FSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAI-IHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDS-------SMESYANL-------YVHVLGVNEF-------------------YPQFLQPVFHFDVSETSAVGTRVGAVQATDKD--SGEDGRVYYLLVGSSNDKG-----FRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIING---NLKQ-SFKIDVQTGEISTA--SRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQND-NPSTTRSLHIAVSLFNGDLPSNVKLADVRPNDIDI 3787          

HSP 14 Score: 80.8777 bits (198), Expect = 6.756e-15
Identity = 77/310 (24.84%), Postives = 131/310 (42.26%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNG-----HIV-------YSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQ---------LLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPV--FLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            I ++DVNDN+P F          E+   G+ +    A D D   NG      IV       + ++ + +    + Y  +++    DRE   SY+  ++ARD G P     + V V I D+ND  P+F+  DY   + E+   ++    +  + A+D DLG N  + Y L               AE  +   V+ + G IS    ++  + ++++           V A D G P     T + + +LD ND+ P+  F F  +      V      G  +  V  KD D G+NG  +  +++ N+  +F
Sbjct:  144 IKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNET---ALPGTPVVTVMASDNDLGDNSKITYYL---------------AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHF 435          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 153.68 bits (387), Expect = 3.919e-37
Identity = 133/454 (29.30%), Postives = 201/454 (44.27%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAI--EDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKN-IRFDD---NFAIYKIE--TYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVF 2175
            APE+     ++++ E    G  L   A+  D  +  +G V+Y L   +        +F I+    HL  ++     +     + +TATDG      T++ I +  +D ND+PPV         V E++     +  V   D D G N      + D+G  N+ N I   D   +F I+      Y     DRE    Y + +   D G PA  +  +  + ++D NDN P+F      F + EN   GS VG V A DLD   N  I YS+L  N +F +  + GEI ++   DRE  + Y+ VV ARD G P  +  + V++ + D+ND  P    D    +     E      + +++A D+D GQN ++ Y ++        G       L ++   S  G I     LD EE S  +L V A D G P   T   + +EVLDLNDN P F
Sbjct:  928 APEFEASMVRISVPESAELGAPL-YAAHAHDKDSGSSGQVTYSLVKESG-----KGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI-ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK-------GRDSDGHGLFSIDPTS--GVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF 1365          

HSP 2 Score: 151.754 bits (382), Expect = 1.539e-36
Identity = 185/664 (27.86%), Postives = 285/664 (42.92%), Query Frame = 1
Query:  502 INIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQE---CQSEGDILELIANDRDDPNTKN-GLVSYQLSDRTE------DRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDG-NGRMN-ETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDD-NFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQP-EGEIIIAHTMKEFSNFRSLPDRLIIKASDLG 2439
            +++ EN P+G       A D D     +  Y               TIG  F+       +S   EI     I   +D E   S+ F ++ATD G  + +  + + +TDVNDN P +    YKV+++E     S+     ++A    DP+  N G VSY++    E      DR    +IF +  + L +    +  L         I+ATDG N R N +  V ++I D    PP+   A     V E+  +  ++ +V     D         S+         +I  +  N  I K         D E  S   + I+    G P +    + +I + DVNDNAP F   +    V E+  +G+ +    A D DS ++G + YS++  +    FAI    G +      D E +  +  +VTA D G P L+ ++ + V +QD+ND  PVFEKD Y   ++ES   SI N ++ Q+ A+D D G N  + YR++D     +  +       ++       G I +   LDRE     QL V A D+G P+    T +I+ VLD NDN P   F  +   F  +      G  +  V   DLD G N  I +SL+  N      F++ P  GEI     +      R L D L+++A D G
Sbjct:  618 VSVAENEPVGRCILKVSASDPDCGVNAMVNY---------------TIGEGFKHLTEFEVRSASGEIC----IAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRS-TGEIFVVRPDMLSVRTQPMHML--------NISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAK-------PLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSES--RSI-NAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPK--FQKSKYEF-RIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS----FQVHPVTGEISTREPLDR--ELRELYD-LVVEARDQG 1232          

HSP 3 Score: 150.214 bits (378), Expect = 5.454e-36
Identity = 187/691 (27.06%), Postives = 300/691 (43.42%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQT--GSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETS--VDIAIEDCNDHPPVISIA----NRFGKVLENQKQKIILTTVQVKDED-KGRNGMFECSLND-SGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY-----GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKT---ICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLI-IKASDLGQNPKNNIATLYIRYIHSL 2493
            F  T   I   EN P      L  A+D D   Y  + Y I               GN    F++ + + +   +Y  L+I   +DRE    +  ++ A D G     G  TV + + DVNDN P + +  Y   + E  + G  +L++ A+D D    +NGLV Y ++ R  D++   Q+F I+     +  N+      +    + + A D   +  ET+  V I + D ND+ P I++     +   K+ E+ +    +  + V D D K        +LN   G   L      DN     I   P    DRE +S YT+ +   D+G P + + +   + I DVNDN P F   +   +V+E    G++V QV A D D   N  + YS+  + +  A         G I ++   D E     +  V ARD G P L+ +  V V I D+ND  P+F++  F+ ++ +  E +    L ++ A+D D G N  V Y       IG       + E+R     S  G I + G LD E  SS +  V A D G   LSTT  I +++ D+NDN PVF +P      +  S +     +   I  V   D D G  G +++ ++  N+   F    +  GEI +     +  + R+ P  ++ I A+D G    N  A +++  I ++
Sbjct:  174 FPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVS-------------GNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTD--ADENGLVEYAINRRQSDKE---QMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTT---RDNSIYLVIVHLP---LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQS-FYNVSVAENEPVGRCIL-KVSASDPDCGVNAMVNY------TIGEGFKHLTEFEVR-----SASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRID-RSTGEIFVVR--PDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAM 821          

HSP 4 Score: 118.627 bits (296), Expect = 2.557e-26
Identity = 195/794 (24.56%), Postives = 339/794 (42.70%), Query Frame = 1
Query:  277 SLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPS---LEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXX--XXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGN-KLHLTNNRISGL--INRNNIRIY---ITATDGNG--RMNETSVDIAIEDCNDHPPVISIANR-FGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT-----SFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQV----RAMDL------DSSNNGHIVYSILNSNDNFAISIY------GEIQSKIKFDREKTDSYEFVVTARD---NGEPQLNDSMVVKVKIQDINDCTPVFEKDYF-FRITES--YGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDG---YPSLSTTTTIIIEVLDLNDNAPVFLFPSNN---MNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDR--LIIKASDLGQNPKNNIATLYIRYIHSLTNLNP 2508
            SL+K + K   F+++  SG LI+   LD E+   +T    +    +   +  + I++++ D+NDN PVF+  +  +N+ E+  I        A D D+      TY I    G+D      +  +  Q F I          +P+   + +   +DRE    +   ++ATD G         V+V   D NDN P++ K  Y+  I+E    G ++              G+V+    D  E+  I   +  IN + ++H     IS    ++R    +Y   + A D     R     V I + D ND+ P I+        V E Q     +  V+  D D G+N     S+           R  D   ++ I+            D E+ S+Y + +   D GNP   +++   + ++D+NDN P F +   +F V E+  +G  VG +    R  D+      +S  +  + Y++     +   + +      G +      DRE    +   + A D   +  PQ + ++ VK+++ D+ND  P + +D    +++E+   G  I N       ATD D G NG ++YRLI       P  ++ + +  +L ++ S  GA+S+   LD E +    L+VQA D        L T+ T+ + +LD ND+AP F+ P+++      + +S    IG+ +  +   D D G NG +T+ +   N    F    Q  G I +  ++   +       R  LII A D GQ P+   ++L +  I   ++ NP
Sbjct:  969 SLVKESGK-GLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDA-GVDNVTNSISSSDVSQHFGI----------FPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVV--------------GVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKG--------RDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQ-SSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHN-----FTATDADTGTNGDLQYRLIRY----FPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQ-TGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PEPKKSSLNLHLIVQGSHNNP 1716          

HSP 5 Score: 115.161 bits (287), Expect = 2.872e-25
Identity = 119/427 (27.87%), Postives = 193/427 (45.20%), Query Frame = 1
Query:  916 IANDRDDPNTKNGLVSYQLS-DRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNP-AMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSND-NFAIS-IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMV-VKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLF 2181
            +AND    + + G+++ +   DR      V  ++  + N+    +   S  + +      I  T      +  ++ I + D ND+ P     + +G  +    +  ++ TV   D D+G N     S+      NL N +F  + +  ++   P    DRE+ S YT++I+  D+G P +       +I + D NDNAPRF        V E+ P+G++V Q+ A+D D   N  +VYS+ N     FAI    G I +  K DRE   SY F+V A D G  ++  + V V++ + DIND  P+FE+  +  I +        + L +++A D DLG N  + Y L          NS + A+ R  I  S  GA+S   +L  E    + L V A D G P  S+   I + + +     PV  F
Sbjct: 1762 VANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANR---QSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGG---NLGN-KFSIDSSSGELSARP---LDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER--YPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL-------NAENSAVSAKFR--INPS-TGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF 2166          

HSP 6 Score: 99.3673 bits (246), Expect = 1.940e-20
Identity = 143/557 (25.67%), Postives = 218/557 (39.14%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQL----SDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNE-----TSVDIAIEDCNDHPP---------------VISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL---NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDV----NDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILN--SNDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARD-NGEPQLNDSMVVK----------------------VKIQDINDCTPVFEKDYFFRITESYGESIKNER----LEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD---GAISVYGNLDREEISSIQLLVQAFDDGYP-SLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNK 2316
            APEW +D   + + E    G I+        D  T NG + Y+L        E ++    +F ++     L+              + + A D +  + E      +V + I D NDH P                IS A R G+V+ +         +   DED G NG     +   N  G+  + +        I  +++ P  + D EK   + + I   D G P     +K S+N+  +    ++N PRF+  +    ++EN P GS V QV A  L  + N ++ Y I    +ND F +    G I ++ +FDRE   SY   V  RD N +  L+ S V K                      + + D+ND +P       FR    YG S+        +  + A+D D G N  + Y +      G  GN           K S D   G +S    LDRE+ S   L +QA D G P S      I I V D NDNAP F          +V  +  +G ++  +   D D G+N  + +SL N  +
Sbjct: 1482 APEWPQDPIDLQVSEATPVGTIIHNFTATDADTGT-NGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAH---------IVAVDEDSGDNGQLTYEITGGNGEGRFRINS----QTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP---EPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPE------FRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITG----GNLGN-----------KFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTG---SVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQ 1996          

HSP 7 Score: 98.2117 bits (243), Expect = 3.718e-20
Identity = 105/356 (29.49%), Postives = 153/356 (42.98%), Query Frame = 1
Query: 1432 DQGNPAMSSMQKFSINIIDVNDNAPRF-VNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN--DNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMV-VKVKIQDINDCTPVFEKDYFFRITESYGESIK-NERLEQIKATDKDLGQNGTVKYRLIDVKP--IGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDG-YPSLSTTTTIIIEVLDLNDNAPVF-LFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATL 2469
            D  N     +    I + DVNDN+P F         V EN+  G  +  V A DLD   N  ++YSI   N  + F+I S  GE+ ++   DRE+   Y   + A D G+P+       + + ++D ND  P F+     + T S  E       + QI A D DLG N  + Y L +       I G S               G I+  G LDRE  +S   +V A D G Y   S T  + I VLD+NDN P+F  +P        V    + G+T+  V+  D D G N  I +SL   N   +  F+I P    + A       + + L   L + A D G  P++++  +
Sbjct: 1821 DTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFK---LSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQS---------------GLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY----IGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLL--HLEVVARDKGNPPQSSLGLI 2150          

HSP 8 Score: 94.3597 bits (233), Expect = 6.345e-19
Identity = 74/249 (29.72%), Postives = 116/249 (46.59%), Query Frame = 1
Query: 1444 PAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI----YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL 2178
            P ++S  +  I + D NDN+P+F  K  +  V E N  G+ V QV A D D+ +N  + Y I++ N + A  I     G +++ I  DRE  D Y+  + A D G PQ+  +  ++V+I D+ND  P F  +    ++E+   +     +  I A D D      + YRL     + I   S    +        + G + +   LD E     +L V A D  + +    T + + V D NDNAPVFL
Sbjct: 2300 PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEA---TELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALD-------RYSGKLVLKRRLDYELQQEYELDVIASDAAHEA---RTVLTVRVNDENDNAPVFL 2533          

HSP 9 Score: 92.4337 bits (228), Expect = 2.034e-18
Identity = 75/246 (30.49%), Postives = 115/246 (46.75%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKMFHVVENNP--IGSTVGQVRAMDLDSSNNGHIVYSIL--NSNDNFAIS--------IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVS-FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAP 2169
            + + D NDNAP F          EN P  +  T+   R +DL+  N     Y+I+  N ND F +S        +Y ++Q     DRE T  Y  ++ A D G P L   M V + IQD+ND  P+F +  YF  + E+   +     + Q+ A+D D  +NG V+Y +           ++ +++   + ++    GAI +   LD E     +L+V A D G   L TT  + I V D+NDN P
Sbjct:  162 VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQR--YNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPEN---ATVGTSVLQVYASDTDADENGLVEYAI-----------NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQP 391          

HSP 10 Score: 78.5666 bits (192), Expect = 3.332e-14
Identity = 75/276 (27.17%), Postives = 116/276 (42.03%), Query Frame = 1
Query: 1666 GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGA----ISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIR 2478
            GEI++K+K DRE   SY  V        P    ++ V V ++D ND  P F +        E+    +K   L    A D DL    T +Y ++        GN  +    R       DG     + + G LDRE      LL++A D G P L    T+ I + D+NDN P+F   + +  F  V     +G ++  V   D D   NG + +++      +   F+I P    I  +   +F   + L + L++ A D G+ P    A + IR
Sbjct:  130 GEIRTKVKLDRETRASYSLVAI------PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLL---PARDLDLEPYNTQRYNIVS-------GN--VNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF---NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFET-KELHE-LVVVAKDHGEQPLETTAFVSIR 382          

HSP 11 Score: 70.0922 bits (170), Expect = 1.558e-11
Identity = 68/246 (27.64%), Postives = 116/246 (47.15%), Query Frame = 1
Query: 1426 CVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS-NDNFAISIY------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIII 2139
            C       + S+Q F + + D NDN P+F     +  + EN P+GS+V +  A DLD    G + YSI  + +D  +  ++      G + S   FD E+   Y+  + A D G  +   S+ V+V+I+  ++ TP F E+ Y F +  +     +   + Q+ ATD D G +G V Y+L           S     ++  +K+  DG  ++Y  +D  +IS   L++ A    + SLS+   + I
Sbjct: 2834 CDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKA--SVAVRVEIESRDEFTPQFTERTYRFVLPAAVALP-QGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLY--MDGRDIS---LVISASSGRHNSLSSMAVVEI 3071          

HSP 12 Score: 51.2174 bits (121), Expect = 8.114e-6
Identity = 141/606 (23.27%), Postives = 245/606 (40.43%), Query Frame = 1
Query:  730 IDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVI---------SIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISV-----YTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKI-----KFDREKTDSYEF-VVTARDNGEP-----QLNDSMVVKVKIQDINDCTPVFEKD--YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSF-DGAISVYGNLDREE-ISSIQLLVQAFDDGYPS-LSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWE-IGKTICTVKTKDLDQGINGTITHSL--INSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLG 2439
            +DRE    +   +IATD G    TG+ T+ V + DVNDN P +  +N  V + E    G ++  I AND D   T   L     ++ T D + +S IF ++     L   R      +    + + A+D       T + + + D ND+ PV          +I     ++ E+      L TV   D D   N      + +  +         + F+++        +  R + +V     Y V I   D G PA+ S     +   D      +F+       + E  P+GS V Q+    LD S       +I+  N+  A  +   +QSK        DRE+ D Y+  +V +  +G P       +  + V + I D ND  P+F++   Y   I+E         +L+ I A D++   N  V Y +         GN +      ++  +    G + V   LD +    S +L+++A D  +   L +     +E+ D NDN P F        +V+   E E +G ++      DLD+G  G + +S+    S++     F++  E  ++ +  + ++   +     L+  ASD+G
Sbjct: 2386 LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVD---TYPALTYRLGAESTVDIENMS-IFALDRYSGKLVLKRRLDYELQQEYELDVIASDA-AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQ---------EGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQS------LAIIAGNEESAFEL---LQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDA-DQENTPNSEVVYDITS-------GNDE------HMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPL----TEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELL--ASDMG 2947          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 220.705 bits (561), Expect = 1.472e-58
Identity = 230/790 (29.11%), Postives = 364/790 (46.08%), Query Frame = 1
Query:  256 LPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSF-LDRETI--CENTKETCSMK-------LYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIG-NNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTE--------DRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFD--DNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN---FAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLN 2505
            LP++    L K      Y  ++  +GD+      +DRET+  C N  + C ++       L  +Q    I+  IE+ DINDN P F +    +++ EN  +G  + +P+A DKD+ + GV  Y +             T G      F ++  + + E++ P L ++ ++DRE   S+   + A D GN  +  S  + V++ D NDNAP++ K +Y+  + E    G  +L++ AND D     NG + Y L    +        DR   S I Y+ G    L    I      NN++ Y+ A D   + + ++T V I + D ND+ P + I        ++    + E+      +  VQV D+D+G N +  C +       L+       DN   Y ++T   T  D E++  Y VEI  VD GNPA+SS     + + D NDN+P F   +      E N  G  V +V A D DS  N  +VYSI+  +     F I    GE++++   DRE  D YEF VTA D G P    +  V +K+ D ND  P F    Y F + E+         +  +   D D G+N  V+   + V+P           ++   +  +  G I    + DRE+ SS    ++A D G P  S+   + I VLD NDNAPV   PSN+ +F+ +S        +  V+ +D+D G N  + +S+   N  +   F I P  GEI +    KE +   S   RL+IK SD G+  ++ IA ++I    ++ N++
Sbjct:   48 LPDTGH--LYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTL-------------TAGPEAVALFGLQVAEDRGEKL-PQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSD--LGPNGEIEYTLHQAIDPVPKLLRIDRS--SGIIYVKGP---LDREEI------NNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTT--TPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPL---SPVGMVTVQDMDEGENAQVQ---LSVEP-----------DVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDL--FYISPSNGEITLT---KELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANVS 783          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 221.09 bits (562), Expect = 2.551e-58
Identity = 230/790 (29.11%), Postives = 364/790 (46.08%), Query Frame = 1
Query:  256 LPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSF-LDRETI--CENTKETCSMK-------LYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIG-NNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTE--------DRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFD--DNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN---FAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLN 2505
            LP++    L K      Y  ++  +GD+      +DRET+  C N  + C ++       L  +Q    I+  IE+ DINDN P F +    +++ EN  +G  + +P+A DKD+ + GV  Y +             T G      F ++  + + E++ P L ++ ++DRE   S+   + A D GN  +  S  + V++ D NDNAP++ K +Y+  + E    G  +L++ AND D     NG + Y L    +        DR   S I Y+ G    L    I      NN++ Y+ A D   + + ++T V I + D ND+ P + I        ++    + E+      +  VQV D+D+G N +  C +       L+       DN   Y ++T   T  D E++  Y VEI  VD GNPA+SS     + + D NDN+P F   +      E N  G  V +V A D DS  N  +VYSI+  +     F I    GE++++   DRE  D YEF VTA D G P    +  V +K+ D ND  P F    Y F + E+         +  +   D D G+N  V+   + V+P           ++   +  +  G I    + DRE+ SS    ++A D G P  S+   + I VLD NDNAPV   PSN+ +F+ +S        +  V+ +D+D G N  + +S+   N  +   F I P  GEI +    KE +   S   RL+IK SD G+  ++ IA ++I    ++ N++
Sbjct:   48 LPDTGH--LYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTL-------------TAGPEAVALFGLQVAEDRGEKL-PQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSD--LGPNGEIEYTLHQAIDPVPKLLRIDRS--SGIIYVKGP---LDREEI------NNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTT--TPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENM---PPLSPVGMVTVQDMDEGENAQVQ---LSVEP-----------DVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDL--FYISPSNGEITLT---KELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANVS 783          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh17 (protocadherin 17 [Source:ZFIN;Acc:ZDB-GENE-090608-3])

HSP 1 Score: 210.305 bits (534), Expect = 5.856e-55
Identity = 212/707 (29.99%), Postives = 333/707 (47.10%), Query Frame = 1
Query:  124 MLIELDILIIFSIKLVITLNVEFSVDENCRIGHVVGNVYSKLN-QLPNSSRSSLMKA--NEKDSYFSLNRTSGDLIVKSFLDRETIC-ENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNN---IRIYITATD--GNGRMNETSVDIAIEDCNDHPPVIS-IANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFD-----DNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNER-------LEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEV 2145
            M + + + ++   + +   N+ +S+ E  +I  V+GN+      +L    + S  +   N       ++  SG L  K  +DRET+C +N+K   SM+++ + D     I +EI DINDN P F + Q  I+I EN   GT +PL  A D D+ + G+KTY I R              +++  F +          +P L + +++DREE      I+ ATD G   ++G+  + V VTD NDN+P + + +Y V I E    G  I++L A D D+    NG V+Y  S    DR  + ++F I+     +   +I G I+      I I + A D   N       V + + D ND+ P I  +A R G V E      ++  V+V D+D GRNG  +C +       L N+ F      DNF  Y + T  D   DRE    Y + I   D GNP ++S + F++ I+D NDNAPRF   + +  V ENN  G  +G V A D D   NG + YS+L SN    +I+ Y       G I +   F+ E+T  ++F V A+D+G P L  +  V+V + D+ND  PV        + ++    I   R       +  ++A D D G++G + Y + D       GN +   E+      S  G +     L  E    ++L+++  D G PSLS    +I++ 
Sbjct:    1 MHLSVFLFLLLWAQALTLKNLNYSIPEE-KIQGVIGNIAKDAELELGEQGKKSNFRVLENSAPHLIDVDPESGLLYTKQRIDRETLCRQNSKCQLSMEVFAN-DKEICMIKVEIQDINDNAPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTKENGLKTYQITR--------------DDYSIFSLDVKSRGDGTKFPELVVQRSLDREERSHHTLIITATDGGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDE--GINGQVTYSFSCYVPDR--IKELFSIDPRTGVI---KIQGKIDFEENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQGAVSEAATPGTVIALVRVTDKDSGRNGQLQCRI-------LGNVPFKLEENYDNF--YTVVT--DRPLDREVKDEYNITIVAKDNGNPPLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYLGSVLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPHLESNTTVRVSVLDVNDNIPVI----VLPLLQNDTAEIHVPRNVGVGHIITTVRAVDNDFGESGRLTYEISD-------GNEEHLFEID-----SVTGEVRTAQPLWEEVTPVVELIIKVTDHGKPSLSAMAKLIVKA 657          

HSP 2 Score: 169.859 bits (429), Expect = 2.606e-42
Identity = 172/589 (29.20%), Postives = 264/589 (44.82%), Query Frame = 1
Query:  781 FGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTK-NGLVSYQLSDRTEDRKIVSQIFYINGNKL---HLTNNRISGLINRNNIRIYITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGM----FECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPR--FVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS--------NDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP--SNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIR 2478
            F N    C + V + D+NDNAP +  +   ++I E  + G    L A    DP+TK NGL +YQ++   +D  I S      G+      L   R      R++  + ITATDG    +     +++ + D ND+ PV    +   ++ EN     ++  +   D D+G NG     F C + D  K   +    D    + KI+       D E+  +  ++++  DQG   +    K ++ ++D NDN P   FV  ++   V E    G+ +  VR  D DS  NG +   IL +         DNF   +     +    DRE  D Y   + A+DNG P LN +    VKI D ND  P F K  Y  ++ E+   +I  E L  + A D DLGQNGTV Y L+       P N   ++    +     DGAI    + + E+       VQA D G P L + TT+ + VLD+NDN PV + P   N+   ++V     +G  I TV+  D D G +G +T+ + + N+   F       GE+  A  + E          LIIK +D G+   + +A L ++
Sbjct:   99 FANDKEICMIKVEIQDINDNAPSFPSEQIDIDISENAAPGTRFPLAA--AYDPDTKENGLKTYQIT--RDDYSIFSLDVKSRGDGTKFPELVVQRSLDREERSHHTLIITATDGGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDEGINGQVTYSFSCYVPDRIK---ELFSIDPRTGVIKIQG----KIDFEENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFV-AVRQGAVSEAATPGTVIALVRVTDKDSGRNGQLQCRILGNVPFKLEENYDNFYTVV-----TDRPLDREVKDEYNITIVAKDNGNPPLNSTKSFTVKILDENDNAPRFTKMVYLLQVPEN---NIPGEYLGSVLAHDPDLGQNGTVSYSLL-------PSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPHLESNTTVRVSVLDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGHIITTVRAVDNDFGESGRLTYEISDGNEEHLFEID-SVTGEVRTAQPLWEEVTPVV---ELIIKVTDHGKPSLSAMAKLIVK 656          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: si:ch73-233f7.7 (si:ch73-233f7.7 [Source:ZFIN;Acc:ZDB-GENE-141215-50])

HSP 1 Score: 199.134 bits (505), Expect = 2.761e-52
Identity = 210/695 (30.22%), Postives = 331/695 (47.63%), Query Frame = 1
Query:  142 ILIIFSIKLVITLNV-EFSVDENCRIGHVVGNVYSKLN-QLPNSSRSSL---MKANEKDSYFSLNRTSGDLIVKSFLDRETIC-ENTKETC--SMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQL--SDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATD--GNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL-----NSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESI-----KNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTI 2133
            +L+ FS  L    +V  +S+ E    G VV N+ S L   +   SR  +   + +N+K  Y  +N+ +G+L V   +DRE +C   T  TC   M++ L+       I IEI DINDN P F+     ++I E+   G  + L  A D D     +KTYY++     D E Q    G+ F    +K P                +DREE  S   IL A D G   ++G+ ++ V V D NDNAP++ KD+Y +N+ E    G  +++L A+D+D+ +  + L SY L  S++T+      Q F +N N   +   R+  LIN  + RIY   I ATD   N    +  V I I D ND+ P ISI +    V E+     ++  V V D+D G NG  +  ++      LK     DN+     E       DREK+  Y + I   D+GNP +S  +  ++ ++DVNDN P+F        V+ENN  G+++  + A+D D   N ++VY I+     N++ +   SI    G + +   FD E    + F + ARD+G P L+ ++ V + I D ND TP+    +  + +E   E+I     K   + ++ A D D   N  + Y+ +      +    +   E+R +   S+  +        R++    +L+V A D+G P+LS T TI
Sbjct:   15 VLLFFSAILDTASSVTHYSIPEEMEEGSVVANLASDLGLDVATLSRRKMRLDIISNKK--YLDVNKETGELYVLEKMDREYLCLSKTATTCFIKMEVILENPVRIFNIEIEIVDINDNAPQFRRDTIHLDISESTAAGERFSLSNAVDPDIGSNSIKTYYLSESDHFDIEMQTGRDGSKFADLILKKP----------------LDREEQASHNLILTAVDGGVPARSGTASIIVRVLDTNDNAPQFDKDSYTINLTENAPIGSLVVKLNASDKDEGSNSDLLYSYSLYTSEKTQ------QTFSLNPNNGEI---RVKELINYEDFRIYDMEIIATDKGANSLTGKCKVKILITDMNDNHPEISIRSVTSPVKEDVAVNTVIAVVSVSDKDSGENGQVDIHISADLPFALK--ESSDNY----YELLVSEPLDREKLPEYDITITVTDRGNPPLSDNETITLELLDVNDNVPQFPQTFYTIPVMENNAPGASLSSITAVDPDLHENQYLVYFIIEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKDFLFHIEARDSGVPPLSSNVTVHIIIMDQNDNTPLIVSPWRAQGSE-VKETIPRSTDKGTLIAKVIAIDSDSVHNSRITYQFLQNTDATLFSLDQYNGEIRTMRMFSYRDS--------RDQ----RLVVIAKDNGEPALSATVTI 663          

HSP 2 Score: 108.997 bits (271), Expect = 1.399e-23
Identity = 135/568 (23.77%), Postives = 237/568 (41.73%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLH-LTNNRISGLINRNNIRIYITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNG--MFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHI--------VYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYF-FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNF---VNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHS 2490
            AP++ +D   ++I E  + G+   L +N  D     N + +Y LS+   D   +      +G+K   L   +      + +  + +TA DG    R    S+ + + D ND+ P     +    + EN     ++  +   D+D+G N   ++  SL  S K   +    + N    +++       + E   +Y +EI   D+G  +++   K  I I D+NDN P    +     V E+  + + +  V   D DS  NG +         +++  S+DN     Y E+      DREK   Y+  +T  D G P L+D+  + +++ D+ND  P F + ++   + E+   +     L  I A D DL +N  + Y +I+ K I           +  L  ++ + G +      D E        ++A D G P LS+  T+ I ++D NDN P+ + P           +    + G  I  V   D D   N  IT+  + +     F    Q  GEI    TM+ FS   S   RL++ A D G+   +   T+ +  + +
Sbjct:  131 APQFRRDTIHLDISESTAAGERFSL-SNAVDPDIGSNSIKTYYLSE--SDHFDIEMQTGRDGSKFADLILKKPLDREEQASHNLILTAVDGGVPARSGTASIIVRVLDTNDNAPQFDKDSYTINLTENAPIGSLVVKLNASDKDEGSNSDLLYSYSLYTSEKTQ-QTFSLNPNNGEIRVKEL----INYEDFRIYDMEIIATDKGANSLTGKCKVKILITDMNDNHPEISIRSVTSPVKEDVAVNTVIAVVSVSDKDSGENGQVDIHISADLPFALKESSDN-----YYELLVSEPLDREKLPEYDITITVTDRGNPPLSDNETITLELLDVNDNVPQFPQTFYTIPVMEN---NAPGASLSSITAVDPDLHENQYLVYFIIE-KEIA-------NTSMSMLFSINPENGNLYALKTFDYEIEKDFLFHIEARDSGVPPLSSNVTVHIIIMDQNDNTPLIVSPWRAQGSEVKETIPRSTDKGTLIAKVIAIDSDSVHNSRITYQFLQNTDATLFSLD-QYNGEI---RTMRMFSYRDSRDQRLVVIAKDNGEPALSATVTIKLSTVET 670          

HSP 3 Score: 103.219 bits (256), Expect = 9.016e-22
Identity = 123/469 (26.23%), Postives = 195/469 (41.58%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGM--FECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI-------------LNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIK-NERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEW--EIGKTICTVKTKDLDQGINGTITHSLIN---SNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLI-IKASDLGQNPKNNIATLYI 2475
            ++I I D ND+ P          + E+       +     D D G N +  +  S +D   + ++  R    FA   ++       DRE+ + + + +  VD G PA S      + ++D NDNAP+F       ++ EN PIGS V ++ A D D  +N  ++YS              LN N+       GEI+ K   + E    Y+  + A D G   L     VK+ I D+ND  P         +T    E +  N  +  +  +DKD G+NG V   +    P  +  +S    EL             V   LDRE++    + +   D G P LS   TI +E+LD+NDN P F        F  + V      G ++ ++   D D   N  + + +I    +N   +  F I PE   + A  +K F ++    D L  I+A D G  P ++  T++I
Sbjct:  120 IEIEIVDINDNAPQFRRDTIHLDISESTAAGERFSLSNAVDPDIGSNSIKTYYLSESDHFDIEMQTGRDGSKFADLILKK----PLDREEQASHNLILTAVDGGVPARSGTASIIVRVLDTNDNAPQFDKDSYTINLTENAPIGSLVVKLNASDKDEGSNSDLLYSYSLYTSEKTQQTFSLNPNN-------GEIRVKELINYEDFRIYDMEIIATDKGANSLTGKCKVKILITDMNDNHPEIS---IRSVTSPVKEDVAVNTVIAVVSVSDKDSGENGQVDIHISADLPFALKESSDNYYELL------------VSEPLDREKLPEYDITITVTDRGNPPLSDNETITLELLDVNDNVPQF-----PQTFYTIPVMENNAPGASLSSITAVDPDLHENQYLVYFIIEKEIANTSMSMLFSINPENGNLYA--LKTF-DYEIEKDFLFHIEARDSGVPPLSSNVTVHI 554          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 201.06 bits (510), Expect = 2.947e-52
Identity = 198/700 (28.29%), Postives = 318/700 (45.43%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRI---YITATDGNGRMNETS---VDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN---DNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNL--DREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSN-NMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLN 2505
            F +    ++I EN  +G  + +PVA D+DS   G+  Y  A   G +  N           F ++  +   E++ P L ++ N+DRE   S+   +   D G+  +  S  + + +TD NDN P++ + +Y+  + E    G  +L++ AND D     NG V+Y L    +    V ++  I+ N   +    + G ++R  I I   Y+ A D NG  +++S   V I ++D ND+ P I I         +    + E+      +  V+V D D+G N +  C +       L++     N    K      T  D E+I  Y +EI  VD GNPA+SS     + + D+NDNAP F   +      E N  G  V  V A D DS  N  + YSI   +     F I+   GE++   + DRE+ D Y+F+V A D G P L  +  V VK+ D ND  P F    Y F + E+         +  +   D D G+N  V+  +        P N K   +         +G  ++   +  DRE+ S+    ++A D G P  S+   I I VLD NDNAP    P+N +  F++     E    + +V+ +D+D G+N  +  +++  N      F+I  EGEI +A   KEF+       RL++K  D G  P+   A ++I    ++ N++
Sbjct:  141 FSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADY--ALTTGPEATN----------LFSLQVAQDSDEKL-PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSD--MGPNGEVTYSLH---QPSSPVMRLLSIDRNTGIIF---VKGSVDREEISILKFYVQAKD-NGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPL---SPVGMVTVNDHDEGENARVQLSV-------EPDNGKFMIQ---------NGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPET--HVESVEAEDIDIGLNSELDFNIVGGNPHGL--FRISSEGEITLA---KEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVS 792          

HSP 2 Score: 128.257 bits (321), Expect = 1.677e-29
Identity = 128/467 (27.41%), Postives = 203/467 (43.47%), Query Frame = 1
Query: 1141 IAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKL-NLKNIRFDDNFAIYKIETYPD----TSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFA--ISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERL------EQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQP-EGEIIIAHTM--KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYI 2484
            I I D ND+ P  S       + EN     +       D D G NG+ + +L    +  NL    F    A    E  P      + DRE    Y + IK VD G+P   S     I I D NDN P+F        + EN+P+G +V QV+A D D   NG + YS+   +      +SI    G I  K   DRE+    +F V A+DNG    +   +V + ++D ND  P         +T   G +  +E +        ++ +D+D G+N  V      V    +P   +  +E  N  K  +   +     LD E I   ++ + A D G P+LS+T ++ ++V D+NDNAPVF   S  +  V    E + G  +  V   D D G N  +T+S+   +  E   F+I P  GE+ +   +  ++  ++     + ++ A+D G       AT+ ++ +
Sbjct:  129 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNL----FSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTC----VVAGDVPFQLRSASETGNDRKRKY--FLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVF---SPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGL-FEINPNTGEVRVMSQLDREQLDHY-----QFLVAAADKGVPSLRGTATVVVKVL 576          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 221.861 bits (564), Expect = 4.202e-59
Identity = 233/824 (28.28%), Postives = 391/824 (47.45%), Query Frame = 1
Query:  172 ITLNVEFSVDENCRIGHVVGNVYSKLNQLPN--SSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKL--YLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLIN---RNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS-NDNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEI-------GKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGKKSHSSDNNNFGFRL 2565
            +   +++S+ E  R+G+V+GN+ + L       SSR   + +  K  Y +++  +GDL V   +DRE +C   ++ C + +   ++   H   I +EI D+NDN P F  +   I+I E   +GT + L  A+D D     +++Y ++         +V T G                  YP L + K +DRE+  S V IL A D G  ++TG+  + ++VTD+NDN P + KD Y+V + E    G  +++L A D D+    N  ++Y  +D  E+ +   ++F IN     +   +I+G ++     N  + + A DG G ++   + I + D ND+ P I I +    + E+ +   ++  V + D D G NG     +++S   +L  I    N+  YK+ T  D   DREK S Y + IK  D+G+P +++ +   + + DVNDNAP F     + ++ ENNP G++  +V A D D + NG +VY IL    ++  IS Y       G + ++  FD EK    EF + A D G PQL ++  +++ + D+ND  PVFEK DY   I E+   +       ++ ATD D+ +NG V Y ++      +P +S +          +  G +    + D E +    + V A D G PS S   T+ I + D NDNAP  L+PS +    +V   +E        G  +  V   D D G N  +++ L+      +F    Q  GEI I   ++E    R    R+++   D G    ++  TL +    +   + P    +   +  ++N  F L
Sbjct:   30 VICQLQYSIYEEQRLGYVIGNIANDLGVSAEELSSRKFHIVSRSKKQYLNVHLENGDLYVADRIDREALC-GMQQNCFLNIEAVMESPLHFYTINVEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLGNNSIQSYKLSANDYFGMLEKVNTDGRK----------------YPELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDADE--GSNAEITYLFNDIPENAQ---EVFAINPENGSV---QITGKLDYEVATNYEMTVEAKDGGGLVSYCKLLIQVSDVNDNAPDILITSFSDIIPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLPFHL--ISSSGNY--YKLVTSMD--LDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEKLR--EFYIQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQEN---NPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISIN-------TVSGVLYAQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASV---FEFIPHFSTKGYLVTKVVAVDADSGHNAWLSYHLLQV-PDPSFLIIGQNTGEIRITRDLQETDALRQ---RIVVMVKDNGYPMLSSTVTLNLVVAENFQQVLPEITNQHIDTESSSNATFYL 803          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000027042.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19134998:19145586:-1 gene:ENSXETG00000013174.1 transcript:ENSXETT00000027042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.001 bits (541), Expect = 1.139e-56
Identity = 209/726 (28.79%), Postives = 345/726 (47.52%), Query Frame = 1
Query:  124 MLIELDILIIFSIKLVITLNVEFSVDENCRIGHVVGNVYSKLNQLPN--SSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETC--SMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXX--APEWTKDNYKVNIQE-CQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI--------SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-------EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSI--QLLVQAFDDGYPSLSTTTTIII------EVLDLNDNAPVFLFPSNNMNF 2202
            ++ ++ I I+     +I   +++SV E  + G ++GN+ + LN   N  S R   + ++++  + S+N  +GDL V+  +DRET+C   +  C   +K  ++       I +EINDINDN P F      + + E    G  + L  AQD D     V++Y ++  +                +F +    S     YP L + K++DRE+  S    LI +D G+   +CT +V +   + N   P +T+D Y VNI E   +   +L+L A D DD    N  ++Y  S   E+ +   QIF IN     +   R +G ++    + Y   + A DG G ++   V I + D ND+ P I I++    + E+   + ++      D D G NG   C +  S +L  + I   +N+  YKI T   +  DRE+ + Y +EI   D+G+P + S +   + I DVNDNAP F     + +V ENNP G+++ ++ A DLD + NG I+YSI+++N   A+        S  G + +   FD E+   + F V ARD+G P LN S+ V++ I D ND  P         E+   F     Y  S K   + ++ A D D G N  + Y  + V    +    +   E+R          IS     D +E+ S+  +++V   D+G PSL+ T  + +      +VL   +N P+ L  ++N+ F
Sbjct:   10 VIWQVHIFILCIFYKMIYGQIQYSVYEELKPGSIIGNIANDLNLSINELSVRKFHIASHDRKQFISVNLDNGDLFVRERIDRETLC-GLEPQCILDLKAMIENPLQIFTIKVEINDINDNEPSFSKKSFEVEVSEFAVPGARFALDYAQDPDLGTNSVQSYGLSANK----------------YFSLGERTSSDGSKYPELVLEKHLDREKQSSLELSLIPSDGGSPKKTCTASVKIVVHDANDNYPVFTQDTYVVNINEDAPNSFLVLQLQAADEDD--GTNAQITYSFSHIPENAR---QIFTINPQTGEI---RKTGHLDYEVTKRYTITVEARDGGGLVSPCKVSIQVIDANDNAPEIQISSYSATIPEDAPTQTVIAIFNTYDMDSGENGKVVCQI--SEELPFQLISLTENY--YKIMT--SSRMDREETAEYNIEITAKDKGSPPLYSNKTIQLTISDVNDNAPVFEKPSYIAYVPENNPPGTSIHRINASDLDLNENGQIMYSIISNNTEDALVSSHVSINSGTGVVYALHSFDYEQIREFSFQVMARDSGSPPLNSSVTVRICIVDRNDNAPKILYPSLDSERTALFEFIPRY--STKGYLVTKVIAVDADTGHNAWLSYHFLQVPEPSMFTIGQHTGEIR----------IS----RDFQEVDSLKQKIVVLVKDNGDPSLTATVALNLVIAENFQVLPELNNQPIKLETTSNITF 688          

HSP 2 Score: 64.3142 bits (155), Expect = 1.186e-9
Identity = 62/201 (30.85%), Postives = 90/201 (44.78%), Query Frame = 1
Query: 1768 MVVKVKIQDINDCTPVFEKDYF-FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL--INSNKRENFPFKIQPE-GEI 2358
              +KV+I DIND  P F K  F   ++E    ++   R     A D DLG N    Y        G+  N       R     S    + +  +LDRE+ SS++L +   D G P  + T ++ I V D NDN PVF   + +   VN++ +      +  ++  D D G N  IT+S   I  N R+   F I P+ GEI
Sbjct:  116 FTIKVEINDINDNEPSFSKKSFEVEVSEF---AVPGARFALDYAQDPDLGTNSVQSY--------GLSANKYFSLGERTSSDGSKYPELVLEKHLDREKQSSLELSLIPSDGGSPKKTCTASVKIVVHDANDNYPVF---TQDTYVVNINEDAPNSFLVLQLQAADEDDGTNAQITYSFSHIPENARQI--FTINPQTGEI 300          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: vat1l (vesicle amine transport 1-like [Source:Xenbase;Acc:XB-GENE-952539])

HSP 1 Score: 202.216 bits (513), Expect = 4.971e-53
Identity = 198/685 (28.91%), Postives = 321/685 (46.86%), Query Frame = 1
Query:  169 VITLNVEFSVDENCRIGHVVGNVYSKL--NQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKL--YLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTP-------VFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLD 2151
             +T  + +S+ E  + G+ VGN+   L  N    + R   + +   + +F +N  +G+L V   +DRE++CE     C ++L   ++   +   + +EI DINDN P F        I EN P GT + L  AQD D+    ++TY I+       EN+         FF++    S     YP L + K +DRE+  +   IL A D G   +TG+  + + +TDVNDN P ++K+ Y VN+ E  +  D L +  N  D     NG + Y  S  +   KI  Q F I+    H    R  G ++    + Y   + A DG G  + T V I + D ND+ P I + +    + E+     ++  + ++D D G NG   C + DS    L +     N+  Y + T    + DRE++  Y + IK  D+G+  +S+ +   + I+DVNDNAP F     + ++ ENNP GS++ QV+A D D  NN  IVYS ++ N  +  +S Y       G + ++  FD E+   +   + A+DNG P LN +++VK+ + D ND +P       V E    F I        K E + ++ A D D G N  + Y+ +           +   E+R L +V              +E +  +++V   D+G P  S+T  + + V D
Sbjct:   29 AVTAQLHYSILEEEKKGYFVGNIAKDLGLNTQDLAKRKFRISSVTAEHFFHVNLENGNLYVADRIDRESVCE-MAPICLLRLKAVVENPLYVFHVEVEIQDINDNSPSFSRKNMNFEILENTPTGTRFVLGNAQDPDTGINTLQTYKIS-------ENE---------FFKLNEKTSTDGRKYPELVLEKPLDREKQSALEIILTALDGGTPIKTGTAIIKISITDVNDNTPMFSKEVYPVNLPE-NAPVDTLVICLNATDADEGVNGHILYSFSHIS---KIAQQTFTIDS---HTGEIRTKGTLDFEITKAYEMIVEAQDGGGLFSHTKVVIQVLDTNDNAPEIILTSVSNSIPEDSLPGTVVALIDIQDMDSGENGNVYCQITDSLPFALTS--SSSNY--YTLVT--TGTLDREEMPEYNITIKATDRGSLPLSTTKTIRLVILDVNDNAPIFEQPSYVVYIPENNPSGSSIFQVQASDPDLDNNAKIVYSTVHKNASDVPVSSYISLNSITGVLYAQRPFDYEQMREFTIQIMAKDNGSPPLNSTVIVKICVTDRNDNSPKILYPSSVVEDSAQFEIVPRSAN--KGELIAKVVAVDADSGHNAWLSYQFLQPSEPSYFSIGRHTGEIRTL-RV-----------FQEKETTKHKVIVLVKDNGNPPRSSTINLNLVVAD 669          

HSP 2 Score: 139.428 bits (350), Expect = 5.974e-33
Identity = 123/404 (30.45%), Postives = 186/404 (46.04%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGM--FECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILN----SNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGE-SIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRE 2322
            V++ I+D ND+ P  S  N   ++LEN            +D D G N +  ++ S N+  KLN K       +     E   +   DREK S   + +  +D G P  +      I+I DVNDN P F  ++   ++ EN P+ + V  + A D D   NGHI+YS  +    +   F I S  GEI++K   D E T +YE +V A+D G   L     V +++ D ND  P   +     ++ S  E S+    +  I   D D G+NG V  ++ D  P  +  +S   +    L+           G LDREE+    + ++A D G   LSTT TI + +LD+NDNAP+F  PS     V +      G +I  V+  D D   N  I +S ++ N  +
Sbjct:  122 VEVEIQDINDNSPSFSRKNMNFEILENTPTGTRFVLGNAQDPDTGINTLQTYKISENEFFKLNEKTSTDGRKYP----ELVLEKPLDREKQSALEIILTALDGGTPIKTGTAIIKISITDVNDNTPMFSKEVYPVNLPENAPVDTLVICLNATDADEGVNGHILYSFSHISKIAQQTFTIDSHTGEIRTKGTLDFEITKAYEMIVEAQDGG--GLFSHTKVVIQVLDTNDNAP---EIILTSVSNSIPEDSLPGTVVALIDIQDMDSGENGNVYCQITDSLPFALTSSS---SNYYTLVTT---------GTLDREEMPEYNITIKATDRGSLPLSTTKTIRLVILDVNDNAPIFEQPS---YVVYIPENNPSGSSIFQVQASDPDLDNNAKIVYSTVHKNASD 501          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000027771.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:18279501:18292255:1 gene:ENSXETG00000012600.1 transcript:ENSXETT00000027771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.601 bits (514), Expect = 6.105e-53
Identity = 194/717 (27.06%), Postives = 332/717 (46.30%), Query Frame = 1
Query:  121 RMLIELDILIIFSIKL-VITLNVEFSVDENCRIGHVVGNVYSKLN----QLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPI----------------GTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQE-CQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGE-----SIKNERLEQIKATDKDLGQNGTVKYRLIDV---KPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLD 2151
            RM  ++    +FS    +++  + +S+ E  R   V+ N+ + L     QL  S+R   + +   + YFS++  +G+L VK  +DRET+C     TC    +L  D            + + + VF    K+ +I +N P+                G  + L  A+D D     V+TY ++                + Q+F +    S     +P L + + +DRE       +L A+D G   +TG+  + V+VTD NDN P +T++ YKV+I E       +L + A+D D+    N  ++Y  S RT    + + +F IN     +T N +     + +  I + A DG G +  + V I I D ND+ P ISI + F  + E+     ++  ++V D+D  +N   +C +  S    L  +   D F  Y+I T   ++ DREK S Y + I   D+G+P +SS +   ++I+DVNDN P F+  +   ++ ENN  G+++ ++ A+DLD  +N  ++YSI N+N ++F +S Y       G + ++  FD E+   +   + A+DNG P L+ +  V ++I D ND  P            S  E     S++   + ++ A D D G N  + Y  I +    P  I  ++               G I     L  ++    +++V   D+G+P+LS T TI + V D
Sbjct:    5 RMRWQVTFSFLFSWFCHLVSGQLHYSIAEELRKDSVIANIANDLGLDIKQL--STRRLRIVSRVSEKYFSVDSENGNLYVKDRIDRETLC-GKDTTC----FLTFDA----------VVANPLNVFTVKIKIEDINDNPPVFFNDIVTLEMIELTLPGKQFVLQTAEDPDIGSNSVQTYKLS----------------DNQYFTLNEKTSSGGSKFPELVLERPLDRETKNIHELLLTASDGGTPVRTGTALIRVIVTDANDNTPVFTQEVYKVSISENTPINSTVLRVNASDMDE--GTNAQITYSFS-RTSVNSLHASMFSINPTSGEITTNNLLNFEAKKDYEISVQAKDGGGFVAHSKVLIEITDENDNAPEISITSLFTPIPEDTTPGTVIALIEVHDQDSEQNAEVDCQILGSAPFQL--VSSSDRF--YRIIT--SSALDREKASWYNITILATDRGSPELSSRKFIRLDILDVNDNPPIFIKSVYNVYLPENNLPGASIYRIHALDLDMGDNAKVIYSISNTNTEDFPVSSYFSINIETGVLYAQRSFDYEQDKEFHMHIAAKDNGSPSLSSNTTVIIRIMDQNDNAPKMLYPSIESGDSSQFEMVPFTSVEGSLITKVVAVDADSGHNSWLSYHFIQISESSPFSINQHT---------------GEIRTSRVLQEKDALKHKVIVMIKDNGHPTLSVTATINLVVAD 664          

HSP 2 Score: 129.413 bits (324), Expect = 9.246e-30
Identity = 140/539 (25.97%), Postives = 228/539 (42.30%), Query Frame = 1
Query:  910 ELIANDRDDPNT-KNGLVSYQLSDRTEDRKIVSQIFYIN------GNKL-HLTNNRISGLINRNNIRIYITATDGNG--RMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPS----NNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI-QPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATL 2469
            + +    +DP+   N + +Y+LSD        +Q F +N      G+K   L   R      +N   + +TA+DG    R     + + + D ND+ PV +       + EN      +  V   D D+G N     S + +   +L    F  N    +I T    +F+ +K   Y + ++  D G     +  K  I I D NDNAP          + E+   G+ +  +   D DS  N  +   IL S     +S    +  I +    DREK   Y   + A D G P+L+    +++ I D+ND  P+F K  Y   + E+   ++    + +I A D D+G N  V Y + +      P +S     +         G +    + D E+     + + A D+G PSLS+ TT+II ++D NDNAP  L+PS    ++  F  V      G  I  V   D D G N  +++  I  +  E+ PF I Q  GEI  +  ++E     +L  ++I+   D G    +  AT+
Sbjct:  147 QFVLQTAEDPDIGSNSVQTYKLSD--------NQYFTLNEKTSSGGSKFPELVLERPLDRETKNIHELLLTASDGGTPVRTGTALIRVIVTDANDNTPVFTQEVYKVSISENTPINSTVLRVNASDMDEGTNAQITYSFSRTSVNSLHASMFSINPTSGEITTNNLLNFEAKKD--YEISVQAKDGG--GFVAHSKVLIEITDENDNAPEISITSLFTPIPEDTTPGTVIALIEVHDQDSEQNAEVDCQILGSAPFQLVSSSDRFYRIITSSALDREKASWYNITILATDRGSPELSSRKFIRLDILDVNDNPPIFIKSVYNVYLPEN---NLPGASIYRIHALDLDMGDNAKVIYSISNTNTEDFPVSSYFSINIET-------GVLYAQRSFDYEQDKEFHMHIAAKDNGSPSLSSNTTVIIRIMDQNDNAPKMLYPSIESGDSSQFEMVPFTSVEGSLITKVVAVDADSGHNSWLSYHFIQIS--ESSPFSINQHTGEIRTSRVLQEKD---ALKHKVIVMIKDNGHPTLSVTATI 658          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ap4b1 (adaptor related protein complex 4 subunit beta 1 [Source:Xenbase;Acc:XB-GENE-949306])

HSP 1 Score: 201.06 bits (510), Expect = 1.055e-52
Identity = 213/721 (29.54%), Postives = 342/721 (47.43%), Query Frame = 1
Query:  142 ILIIFSIKLVITLNVEFSVDENCRIGHVVGNVYSKLN----QLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETC--SMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYIT--ATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVL-ENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS-------NDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGE--------SIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIII------EVLDLNDNAPVFLFPSNNMNF 2202
            +  +F +       V++SV E    G ++GN+ + LN    +L  S R   + + ++  Y S+N  SGDL V   +DRET+C  T+E C   MK  +    H   + +EI DINDN P+F      + I E+   G  + L  AQD D     V++Y ++        N+   +G        KNP+         L + K +DRE+  S   +L A+D G+  +TG+  + ++V D NDN P +++D Y VNI E    G  +L+L A D DD    NG ++Y  S   E+      IF I+     L+  ++  L      R  IT  A DG   ++   V + + D ND+ PVI I N F   + E+   + ++  +++ D D G NG   C + D   L  + I   DN+  YKI +   +  DRE+ S Y + I   D+G P++ + +   + + D+NDN+P F     + +V ENN  G++V  + A+DLD + NG I YSI+++       + + +I S  G + +   FD EK     F V A D+G P L+ ++ V+V I D ND  P       +  +++ G         S K   + ++ A D D G N  + Y L+ V+   I             +     G I +  +L+  + S  +L+V   D G PSLS T T+ +      +VL   +N P+ L  ++N+ F
Sbjct:   10 VFFLFYLYETFAGQVQYSVYEESEQGFIIGNIANDLNMDIEEL--SDREFQIVSQDQKQYISVNLESGDLFVTERIDRETLC-GTEEECFLDMKALMVNPLHIYTVKVEIEDINDNAPIFSKNYFEVGISESALPGARFALGYAQDPDLGSNSVQSYGLST-------NEYFILGERISSDGSKNPE---------LVLEKPLDREKQNSIELMLTASDGGSPRKTGTALIKIVVYDANDNYPVFSQDTYVVNINENAPNGSLVLQLHATDEDD--GSNGEITYSFSHIPENAL---HIFRIDSQTGELS--KVGELDYEVTKRYTITVEAKDGGDLVSHCKVSVQVVDANDNAPVI-IVNSFSSAISEDSPPETVIALIRIYDGDTGENGEIVCQIPD--ILPFQLISLTDNY--YKIVSL--SRLDREQRSAYNITILAKDKGLPSLCNNKTLQVTLTDINDNSPVFDKTNYIAYVPENNHPGTSVLHITALDLDINENGKITYSIISTAIQGIPVSSHVSINSATGVVYALHAFDYEKIRELHFQVMAEDSGSPSLSSNVSVRVCIIDWNDNYP----KILYPSSDAEGAIYEFIPLPSEKGYLVTKVIAVDADSGHNAWLSYHLLQVQEPSI------------FVIGHHTGEIRLARDLEETDSSRQKLVVMVKDSGEPSLSATVTLNLIVAESFQVLPETNNKPIKLDTTSNITF 681          

HSP 2 Score: 77.411 bits (189), Expect = 9.610e-14
Identity = 64/181 (35.36%), Postives = 88/181 (48.62%), Query Frame = 1
Query: 1774 VKVKIQDINDCTPVFEKDYF-FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGA----ISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL 2301
            VKV+I+DIND  P+F K+YF   I+ES   ++   R     A D DLG N    Y        G+  N       R    +S DG+    + +   LDRE+ +SI+L++ A D G P  + T  I I V D NDN PVF   S +   VN++     G  +  +   D D G NG IT+S 
Sbjct:  112 VKVEIEDINDNAPIFSKNYFEVGISES---ALPGARFALGYAQDPDLGSNSVQSY--------GLSTNEYFILGER----ISSDGSKNPELVLEKPLDREKQNSIELMLTASDGGSPRKTGTALIKIVVYDANDNYPVF---SQDTYVVNINENAPNGSLVLQLHATDEDDGSNGEITYSF 274          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 233.032 bits (593), Expect = 2.139e-62
Identity = 204/699 (29.18%), Postives = 315/699 (45.06%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIR--FDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNL--DREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM-KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTN 2499
            F +    + I EN  IG+ +P+P+A D+D+   GV +Y          E Q           Q+      QEE  P L ++ N+DRE + S+   +   D GN  +  S  + V V D NDNAP++ +  Y+  + E    G  ++++ AND D     N  + Y      E   +V ++  ++ N   +T   + G ++R ++   R  + A D     +     V + ++D ND+ P I I         +    + E+  ++  +  VQV D D+G N    C +       L+       D+   Y ++T   T  D EK+  YT+EI  VD GNP +SS     + ++DVNDNAP F   I      ENN  G  V +V A D DS +N  +VYS+     +   F IS   GEI+ K   DRE+ DSYE  V A D G P L  +  V V + D ND  P F    Y F + E+         +  +   D D G+N  V                +L  E  N   V  +G  ++  +L  DRE+ S+    ++A D G P  S    + I VLD NDNAP    PSN  + + ++ +  +G+T+  V  +D+D GIN  +T+S+   N     P+ +   G    A T+ KE         RL++K SD G+ P+   A +++    +L N
Sbjct:    7 FASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASY----------ELQAGPEAQELFGLQVAE---DQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSD--QGANAEIDYTFHQAPE---VVRRLLRLDRNTGLIT---VQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENM---PALSPVGMVTVIDGDKGENARV----------------QLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN-----PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLAN 657          

HSP 2 Score: 101.293 bits (251), Expect = 4.376e-21
Identity = 76/284 (26.76%), Postives = 127/284 (44.72%), Query Frame = 1
Query: 1492 NDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIYGEIQSKIK-------FDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL-----FPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTIT 2292
            NDN P F + +    + EN  IGS      A D D+  NG   Y +     + + F + +  + + K          DRE+ DSY+  +  +D G P    S +++V + D ND  P FE+  Y   ++E+   S     + Q+KA D D G N  + Y       +           +R L+++  + G I+V G +DRE++S+++  V A D G    S    +++ V D+NDNAP          ++     N+S +      +  V+  D D+G N  +T
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSEN---SPIGHSVIQVKANDSDQGANAEIDYTFHQAPEV-----------VRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVT 270          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 232.261 bits (591), Expect = 3.135e-62
Identity = 204/699 (29.18%), Postives = 315/699 (45.06%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIR--FDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNL--DREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM-KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTN 2499
            F +    + I EN  IG+ +P+P+A D+D+   GV +Y          E Q           Q+      QEE  P L ++ N+DRE + S+   +   D GN  +  S  + V V D NDNAP++ +  Y+  + E    G  ++++ AND D     N  + Y      E   +V ++  ++ N   +T   + G ++R ++   R  + A D     +     V + ++D ND+ P I I         +    + E+  ++  +  VQV D D+G N    C +       L+       D+   Y ++T   T  D EK+  YT+EI  VD GNP +SS     + ++DVNDNAP F   I      ENN  G  V +V A D DS +N  +VYS+     +   F IS   GEI+ K   DRE+ DSYE  V A D G P L  +  V V + D ND  P F    Y F + E+         +  +   D D G+N  V                +L  E  N   V  +G  ++  +L  DRE+ S+    ++A D G P  S    + I VLD NDNAP    PSN  + + ++ +  +G+T+  V  +D+D GIN  +T+S+   N     P+ +   G    A T+ KE         RL++K SD G+ P+   A +++    +L N
Sbjct:  146 FASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASY----------ELQAGPEAQELFGLQVAE---DQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSD--QGANAEIDYTFHQAPE---VVRRLLRLDRNTGLIT---VQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPAL---SPVGMVTVIDGDKGENARV----------------QLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN-----PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLAN 796          

HSP 2 Score: 106.686 bits (265), Expect = 9.043e-23
Identity = 88/337 (26.11%), Postives = 147/337 (43.62%), Query Frame = 1
Query: 1375 DTSFDREKIS-----------VYTVEIKCVD---QGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIYGEIQSKIK-------FDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL-----FPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTIT 2292
            +TS DRE +            +   E+   D    G+P +   Q   I + D+NDN P F + +    + EN  IGS      A D D+  NG   Y +     + + F + +  + + K          DRE+ DSY+  +  +D G P    S +++V + D ND  P FE+  Y   ++E+   S     + Q+KA D D G N  + Y       +           +R L+++  + G I+V G +DRE++S+++  V A D G    S    +++ V D+NDNAP          ++     N+S +      +  V+  D D+G N  +T
Sbjct:   90 ETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSEN---SPIGHSVIQVKANDSDQGANAEIDYTFHQAPEV-----------VRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVT 409          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 232.261 bits (591), Expect = 3.135e-62
Identity = 204/699 (29.18%), Postives = 315/699 (45.06%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIR--FDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNL--DREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM-KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTN 2499
            F +    + I EN  IG+ +P+P+A D+D+   GV +Y          E Q           Q+      QEE  P L ++ N+DRE + S+   +   D GN  +  S  + V V D NDNAP++ +  Y+  + E    G  ++++ AND D     N  + Y      E   +V ++  ++ N   +T   + G ++R ++   R  + A D     +     V + ++D ND+ P I I         +    + E+  ++  +  VQV D D+G N    C +       L+       D+   Y ++T   T  D EK+  YT+EI  VD GNP +SS     + ++DVNDNAP F   I      ENN  G  V +V A D DS +N  +VYS+     +   F IS   GEI+ K   DRE+ DSYE  V A D G P L  +  V V + D ND  P F    Y F + E+         +  +   D D G+N  V                +L  E  N   V  +G  ++  +L  DRE+ S+    ++A D G P  S    + I VLD NDNAP    PSN  + + ++ +  +G+T+  V  +D+D GIN  +T+S+   N     P+ +   G    A T+ KE         RL++K SD G+ P+   A +++    +L N
Sbjct:  146 FASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASY----------ELQAGPEAQELFGLQVAE---DQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSD--QGANAEIDYTFHQAPE---VVRRLLRLDRNTGLIT---VQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPAL---SPVGMVTVIDGDKGENARV----------------QLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN-----PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLAN 796          

HSP 2 Score: 106.686 bits (265), Expect = 9.043e-23
Identity = 88/337 (26.11%), Postives = 147/337 (43.62%), Query Frame = 1
Query: 1375 DTSFDREKIS-----------VYTVEIKCVD---QGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIYGEIQSKIK-------FDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL-----FPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTIT 2292
            +TS DRE +            +   E+   D    G+P +   Q   I + D+NDN P F + +    + EN  IGS      A D D+  NG   Y +     + + F + +  + + K          DRE+ DSY+  +  +D G P    S +++V + D ND  P FE+  Y   ++E+   S     + Q+KA D D G N  + Y       +           +R L+++  + G I+V G +DRE++S+++  V A D G    S    +++ V D+NDNAP          ++     N+S +      +  V+  D D+G N  +T
Sbjct:   90 ETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSEN---SPIGHSVIQVKANDSDQGANAEIDYTFHQAPEV-----------VRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVT 409          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdhga10 (protocadherin gamma subfamily A, 10 [Source:MGI Symbol;Acc:MGI:1935227])

HSP 1 Score: 213.386 bits (542), Expect = 2.065e-56
Identity = 200/681 (29.37%), Postives = 316/681 (46.40%), Query Frame = 1
Query:  184 VEFSVDENCRIGHVVGNVYSKLNQLPN--SSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKET-CSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITE-SYGESIKNERLE------QIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLD 2151
            + +SV E    G  VGN+   L   P   + R   + +  +   FSLN   G L+    +DRE +C  +     S  + ++       I IE+ D+NDN P FQ     + I EN+  G  +PLP A D D     +++Y ++               +N  F  +    +K  + YP L + + +DREE      +L+A+D GN  ++G+  +TV V D NDNAP +T   Y+VNI E    G  +L++ A D+D+    NG V+Y        + + +Q+     +K H    +IS  ++   +  Y   I A DG   +    V I +ED ND+ P ++I + F  V E+     ++  + V D D G+NG   CS+  SG L  K  +  DN+  Y++ T    + DRE++  Y + +   D GNP +S+   F++ + D+NDN P F +     ++ ENNP G+++  V A+D DS  N  IVYS+     +   +S Y       G + +   FD E+    +  VTA D+G+P L+ ++ + + + D ND +P  E  Y    T+ S G  +     E      ++ A D+D GQN  + YRL             LKA    L  V    G +     L   +     L+V   D G P LS T T+ + V D
Sbjct:   29 IRYSVPEELEKGSFVGNIAKDLGLEPRQLAERGVRIISRGRSQLFSLNPRGGSLVTAGRIDREELCAQSAPCLVSFNILVEDRVKLFGIEIEVTDVNDNAPKFQAETLDVKINENVAPGMRFPLPEATDPDVGVNSLQSYQLS---------------SNKHFSLVVQSGAKGVK-YPELVLEQALDREEEAIHHLVLVASDGGNPPRSGTVLITVTVFDANDNAPVFTSTEYRVNIPENLPVGTQLLKVTATDKDE--GANGEVTYAFR-----KSLDTQLSKFQLDK-HTGEIKISENLDYEEMSFYEIEIQAEDGGAYLATAKVLITVEDVNDNSPEVTITSLFSPVTEDSPVGTVIALLNVHDLDSGQNGEVACSI--SGNLPFKLEKSIDNY--YRLVT--QRALDREQVPAYNITVTATDGGNPPLSTKADFTLQVADINDNPPTFSHPSYFTYIPENNPRGASIFSVTALDPDSKENAQIVYSLAEDTIEGAPLSSYISINSDTGILYALWSFDYEQFRELQVQVTASDSGKPPLHSNVSLTLFVLDQNDNSP--EILYPTMPTDGSTGVELAPRSAELGYLVTKVVAVDRDSGQNAWLSYRL-------------LKASEPGLFTVGLHTGEVRTARALMERDALKQSLVVAVQDHGQPPLSATVTLTVAVAD 664          

HSP 2 Score: 157.532 bits (397), Expect = 1.191e-38
Identity = 150/572 (26.22%), Postives = 245/572 (42.83%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDILELIANDRDDPNTK-NGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNG--RMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNF----AISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP------SNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNL 2502
            AP++  +   V I E  + G  +     +  DP+   N L SYQLS      K  S +       +      +   ++R    I+   + A+DG    R     + + + D ND+ PV +       + EN      L  V   D+D+G NG    +   S    L   + D +    KI      + D E++S Y +EI+  D G  A  +  K  I + DVNDN+P          V E++P+G+ +  +   DLDS  NG +  SI + N  F    +I  Y  + ++   DRE+  +Y   VTA D G P L+      +++ DIND  P F    YF  I E+   + +   +  + A D D  +N  + Y L +    G P        L + I ++ D G +    + D E+   +Q+ V A D G P L +  ++ + VLD NDN+P  L+P      S  +     S   E+G  +  V   D D G N  +++ L+ +++   F   +   GE+  A  + E     +L   L++   D GQ P +   TL +    S+ ++
Sbjct:  128 APKFQAETLDVKINENVAPG--MRFPLPEATDPDVGVNSLQSYQLSSN----KHFSLVVQSGAKGVKYPELVLEQALDREEEAIHHLVLVASDGGNPPRSGTVLITVTVFDANDNAPVFTSTEYRVNIPENLPVGTQLLKVTATDKDEGANGEVTYAFRKSLDTQLSKFQLDKHTGEIKISE----NLDYEEMSFYEIEIQAEDGG--AYLATAKVLITVEDVNDNSPEVTITSLFSPVTEDSPVGTVIALLNVHDLDSGQNGEVACSI-SGNLPFKLEKSIDNYYRLVTQRALDREQVPAYNITVTATDGGNPPLSTKADFTLQVADINDNPPTFSHPSYFTYIPEN---NPRGASIFSVTALDPDSKENAQIVYSLAEDTIEGAP--------LSSYISINSDTGILYALWSFDYEQFRELQVQVTASDSGKPPLHSNVSLTLFVLDQNDNSPEILYPTMPTDGSTGVELAPRSA--ELGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFTVGLH-TGEVRTARALMERD---ALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPDV 669          

HSP 3 Score: 124.02 bits (310), Expect = 3.626e-28
Identity = 126/471 (26.75%), Postives = 207/471 (43.95%), Query Frame = 1
Query: 1117 RMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNL------KNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN----FAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTP-VFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPF----KIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNP-KNNIA-TLYI 2475
            R+    ++I + D ND+ P         K+ EN    +     +  D D G N +    L+ +   +L      K +++         E   + + DRE+ +++ + +   D GNP  S     ++ + D NDNAP F +     ++ EN P+G+ + +V A D D   NG + Y+   S D     F +  + GEI+     D E+   YE  + A D G   L  + V+ + ++D+ND +P V     F  +TE   +S     +  +   D D GQNG V   +    P       KL+  + N  ++    A      LDRE++ +  + V A D G P LST     ++V D+NDN P F  PS    F  +      G +I +V   D D   N  I +SL   +  E  P      I  +  I+ A    ++  FR L  ++ + ASD G+ P  +N++ TL++
Sbjct:  111 RVKLFGIEIEVTDVNDNAPKFQAETLDVKINENVAPGMRFPLPEATDPDVGVNSLQSYQLSSNKHFSLVVQSGAKGVKYP--------ELVLEQALDREEEAIHHLVLVASDGGNPPRSGTVLITVTVFDANDNAPVFTSTEYRVNIPENLPVGTQLLKVTATDKDEGANGEVTYAFRKSLDTQLSKFQLDKHTGEIKISENLDYEEMSFYEIEIQAEDGGA-YLATAKVL-ITVEDVNDNSPEVTITSLFSPVTE---DSPVGTVIALLNVHDLDSGQNGEVACSISGNLPF------KLEKSIDNYYRLVTQRA------LDREQVPAYNITVTATDGGNPPLSTKADFTLQVADINDNPPTFSHPS---YFTYIPENNPRGASIFSVTALDPDSKENAQIVYSLAE-DTIEGAPLSSYISINSDTGILYALWSFDYEQFREL--QVQVTASDSGKPPLHSNVSLTLFV 550          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdhgb5 (protocadherin gamma subfamily B, 5 [Source:MGI Symbol;Acc:MGI:1935196])

HSP 1 Score: 210.305 bits (534), Expect = 2.079e-55
Identity = 190/686 (27.70%), Postives = 317/686 (46.21%), Query Frame = 1
Query:  169 VITLNVEFSVDENCRIGHVVGNVYSKLN----QLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKL--YLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQ--TGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY---------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDIND-----CTPVFEKD--YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLD 2151
             ++  + + + E    G VVGN+   L     +LP       ++ + +  YFS++  SG+L+V S LDRE IC   K  C+++     +   +   + +E+ DIND+ P F  T   + I E+   GT + L VA+D D     ++ Y ++   G                F + N + +    YP L + K +DRE+   +  +L A D G+   +G+  + + VTD NDN P + ++ YKV + E    G  +L + A D+D+    N  +SY             Q+F +N     +   +           I + A DG G + + +V+I I+D ND+ P I++ +    + EN     ++  +++ D D G NG   C L+D  ++  K I    N   YK+ T  D + DRE    Y V I   D+G P +SS  K ++++ DVNDNAP F     + ++ ENNP G+++ QV A D D  +NGH+ YSI+ S D    S++         G + ++  FD E+  S++  + ARD+G P L+ ++ ++V + D ND       P  E D    F +     +      + ++ A D D G N  + Y ++     G+         LR        G +     L  ++ +  +LLV   D G P LS T T+++   D
Sbjct:   28 ALSEQIRYKIPEEMPTGSVVGNLAKDLGFSVQELPTRK----LRISSEKPYFSVSSESGELLVSSRLDREQIC-GKKLVCALEFEAVAENPLNFYHVSVELEDINDHTPNFTHTFSELQISESAQPGTRFILEVAEDADIALNSLQNYKLSPSPG----------------FSLVNKEKQDGRKYPELVLEKTLDREQQNYYRLVLTALDGGDPPLSGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDE--GVNSEISYSFHR-------AGQVFGLNSKSGEIITQKTLDFEEIKEYSIVVEARDGGGLVAQCTVEINIQDENDNRPEITVRSLLEMIPENAPPGTLIALIKIHDGDSGENGEVNCRLDD--EVPFKIISSSKNS--YKLVT--DRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIAENNPPGASIAQVSASDPDLGSNGHVSYSIIAS-DLEPKSLWSYVTVNAQSGVVFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAQ--PGYLVTKVVAVDADSGHNAWLSYHVLQASDPGL-----FSLGLRT-------GEVRTARALGEKDAARQRLLVGVRDGGQPPLSATATLLLVFAD 662          

HSP 2 Score: 161.77 bits (408), Expect = 6.055e-40
Identity = 139/498 (27.91%), Postives = 224/498 (44.98%), Query Frame = 1
Query: 1072 RNNIRIYITATDGNGR--MNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHI--------VYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITE--SYGESIKNERLEQIKATDKDLGQNGTVKYRLI--DVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPS----NNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNP 2508
            +N  R+ +TA DG        T + I + D ND+PPV +      ++ EN      +  V   D+D+G N     S + +G++      F  N    +I T    + D E+I  Y++ ++  D G   + +     INI D NDN P    +  +  + EN P G+ +  ++  D DS  NG +         + I++S+ N       ++ +    DRE T  Y   +TA D G+P L+ S  V + + D+ND  P+F +  Y   I E    G SI      Q+ A+D DLG NG V Y +I  D++P  +     + A+          G +      D E++ S QL +QA D G P+LS   ++ + V D NDNAP  L+P+     +  F  V    + G  +  V   D D G N  +++ ++ ++    F   ++  GE+  A  + E    R    RL++   D GQ P +  ATL + +  SL    P
Sbjct:  205 QNYYRLVLTALDGGDPPLSGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFHRAGQV------FGLNSKSGEIIT--QKTLDFEEIKEYSIVVEARDGG--GLVAQCTVEINIQDENDNRPEITVRSLLEMIPENAPPGTLIALIKIHDGDSGENGEVNCRLDDEVPFKIISSSKNSY-----KLVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIAENNPPGASIA-----QVSASDPDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQ---------SGVVFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLR-TGEVRTARALGEKDAAR---QRLLVGVRDGGQPPLSATATLLLVFADSLQEALP 669          

HSP 3 Score: 70.8626 bits (172), Expect = 8.193e-12
Identity = 92/325 (28.31%), Postives = 141/325 (43.38%), Query Frame = 1
Query: 1504 PRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY---GEIQSKIKFDREKTDSYEFVVTARDNG--EPQLNDSMVVKVKIQDINDCTPVFEKDYF-FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEI--GKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM-----KEFSNFRSLPDRLIIKASDLG 2439
            P    +I+ + + E  P GS VG + A DL  S        +  S++    S+    GE+    + DRE+    + V         E  LN    V V+++DIND TP F   +   +I+ES   +    R     A D D+  N    Y+L        PG S +  E ++  K      + +   LDRE+ +  +L++ A D G P LS TT + I+V D NDN PVF     N     V +   +  G T+  V   D D+G+N  I++S   + +      K    GEII   T+     KE+S        ++++A D G
Sbjct:   27 PALSEQIR-YKIPEEMPTGSVVGNL-AKDLGFSVQELPTRKLRISSEKPYFSVSSESGELLVSSRLDREQICGKKLVCALEFEAVAENPLN-FYHVSVELEDINDHTPNFTHTFSELQISES---AQPGTRFILEVAEDADIALNSLQNYKLSPS-----PGFSLVNKEKQDGRKYP---ELVLEKTLDREQQNYYRLVLTALDGGDPPLSGTTELRIQVTDANDNPPVF-----NQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFHRAGQVFGLNSK---SGEIITQKTLDFEEIKEYS--------IVVEARDGG 321          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 1.659e-59
Identity = 199/699 (28.47%), Postives = 315/699 (45.06%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIR--FDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNL--DREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM-KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTN 2499
            F +    + I EN  IG+ +P+P+A D+D+   GV +Y          E Q           Q+      QEE  P L ++ N+DRE + S+   +   D G+  +  S  + V V D NDNAP++ + +Y+  + E    G  ++++ AND D     N  + Y      E   +V ++  ++ N   +T   + G ++R ++   R  + A D   N +     V + ++D ND+ P I I         +    + E+  ++  +  VQV D D+G N    C +       L+       D+   Y ++T   T  D EK+  YT+EI  VD GNP +SS     + ++DVNDNAP F   +      ENN  G  + ++ A D DS +N  +VYS+     +   F IS   GEIQ K   DRE+ +SYE  V A D G P L  +  V V + D ND  P F    Y F + E+         +  +   D D G+N  V                +L  E  N   V  +G  ++  +L  DRE+ S+    ++A D G P  S    + I VLD NDNAP    PSN  + + ++ +  +G+T+  V  +D D G+N  + +S+   N     P+ +   G    A T+ KE         RL++K SD G+ P+   A +++    +L N
Sbjct:  168 FASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASY----------ELQAGPEAQELFGLQVAE---DQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSD--QGANAEIEYTFHQAPE---VVRRLLRLDRNTGLIT---VQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENM---PALSPVGMVTVIDGDKGENAQV----------------QLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGN-----PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLAN 818          

HSP 2 Score: 106.686 bits (265), Expect = 6.215e-22
Identity = 88/337 (26.11%), Postives = 148/337 (43.92%), Query Frame = 1
Query: 1375 DTSFDREKIS-----------VYTVEIKCVD---QGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIYGEIQSKIK-------FDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL-----FPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTIT 2292
            +TS DRE +            +   E+   D    G+P +   Q   I + D+NDN P F + +    + EN  IGS      A D D+  NG   Y +     + + F + +  + + K          DRE+ DSY+  +  +D G P    S +++V + D ND  P FE+  Y   ++E+   S     + Q+KA D D G N  ++Y       +           +R L+++  + G I+V G +DRE++S+++  V A D G    S    +++ V D+NDNAP          ++     N+S +      +  V+  D D+G N  +T
Sbjct:  112 ETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSEN---SPIGHSVIQVKANDSDQGANAEIEYTFHQAPEV-----------VRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVT 431          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q5DRB6|PCDG4_PANTR (Protocadherin gamma-A4 OS=Pan troglodytes OX=9598 GN=PCDHGA4 PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.890e-52
Identity = 192/697 (27.55%), Postives = 324/697 (46.48%), Query Frame = 1
Query:  136 LDILIIFSIKLVITL-NVEFSVDENCRIGHVVGNVYSKLNQLPN--SSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCS-MKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNF---AISIYGEIQSKI-------KFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDIND-----CTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLD 2151
            L I ++  + + I    + +SV E    G VVGN+   L   P   + R   + +  +   F+LN  SG L+    +DRE +C+ +    + +++ L+     +++ +EI D+NDN P F T Q+ I + EN   GT +PLP A D D     ++ Y +                N+  +F +          YP L + + +DREE      +L A D G+  ++G+  + +++ D NDNAP +T+  Y V++ E    G +L  + A D D+    NG V+Y      + R  +SQ+F +N     +T   I G ++  +   Y   + A DG G    + V + + D ND+ P +++ +    V E      ++    V D D G NG+  CS+ D+    L+      N+  Y++ T+   + DRE++S Y + +   DQG P +S+    S+ ++D+NDN P F +     +V ENNP G+++  + A D DS +N  I YS+  + D F    +S Y  I S          FD E+    + +VTA D+G+P L+ ++ + + + D ND       P F  D    +  +   +     + ++ A D+D GQN  + YRL+     G+        E+R    +           LDR+ +    L+V   D G P LS T T+ + V D
Sbjct:   14 LHICLLLGVLVEIRAEQIRYSVFEEQEEGSVVGNIAKDLGLAPRELAERGVRIVSRGRTQLFALNPRSGTLVTAGRIDREELCDRSPNCVTNLEILLEDTVKILRVEVEIIDVNDNPPSFGTEQREIKVAENENPGTRFPLPEAFDPDVGVNSLQGYQL----------------NSNGYFSLDVQSGADGIKYPELVLERALDREEEAVHHLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVHENVPVGTLLLTVKATDPDE--GANGDVTYSFR---KVRDKISQLFQLNSLSGDIT---ILGDLDYEDSGFYDIDVEAHDGPGLRARSKVLVTVLDENDNAPEVTVTSLTSSVQETSSPGTVIALFNVHDSDSGGNGLVTCSIPDNLPFTLEKTY--GNY--YRLLTH--RTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNPPTFPHASYSAYVPENNPRGASILSMTAQDPDSGDNARITYSL--AEDTFQGAPLSSYVSINSNTGILYALRSFDYEQFRDLQLLVTASDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTFPTDDSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYRLLKSSEPGLFAVGLHTGEVRTARAL-----------LDRDALKQ-SLVVVVQDHGQPPLSATVTLTVAVAD 666          

HSP 2 Score: 140.198 bits (352), Expect = 2.558e-32
Identity = 160/563 (28.42%), Postives = 234/563 (41.56%), Query Frame = 1
Query:  847 EWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVS----QIFYINGNKLHL-TNNRI--SGLINRN-----NIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-----SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGE-SIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVF-------LFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPF----KIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNP 2448
            E   +  + ++ E Q EG ++  IA D        GL   +L++R    +IVS    Q+F +N     L T  RI    L +R+     N+ I +  T     +    V++ I D ND+PP      R  KV EN+         +  D D G N +    LN +G  +L      D   I   E   + + DRE+ +V+ + +   D G+P  S   +  I ++D NDNAP F        V EN P+G+ +  V+A D D   NG + YS     D  +      S+ G+I      D E +  Y+  V A D   P L     V V + D ND  P   +     +T S  E S     +      D D G NG V   + D  P        L+    N  +      +  +  LDREE+S   + V A D G P LST T I ++V+D+NDN P F         P NN            G +I ++  +D D G N  IT+SL   +  +  P      I     I+ A    ++  FR L  +L++ ASD G  P
Sbjct:   25 EIRAEQIRYSVFEEQEEGSVVGNIAKDL-------GLAPRELAER--GVRIVSRGRTQLFALNPRSGTLVTAGRIDREELCDRSPNCVTNLEILLEDT-----VKILRVEVEIIDVNDNPPSFGTEQREIKVAENENPGTRFPLPEAFDPDVGVNSLQGYQLNSNGYFSLDVQSGAD--GIKYPELVLERALDREEEAVHHLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVHENVPVGTLLLTVKATDPDEGANGDVTYSFRKVRDKISQLFQLNSLSGDITILGDLDYEDSGFYDIDVEAHDG--PGLRARSKVLVTVLDENDNAP---EVTVTSLTSSVQETSSPGTVIALFNVHDSDSGGNGLVTCSIPDNLPF------TLEKTYGNYYR------LLTHRTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNPPTFPHASYSAYVPENNPR----------GASILSMTAQDPDSGDNARITYSLAE-DTFQGAPLSSYVSINSNTGILYALRSFDYEQFRDL--QLLVTASDSGDPP 541          

HSP 3 Score: 134.42 bits (337), Expect = 1.702e-30
Identity = 133/512 (25.98%), Postives = 215/512 (41.99%), Query Frame = 1
Query: 1084 RIYITATDGNG--RMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLND-----SGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI------YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFL---FPSNNMNFVNVSVE-WEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGKKSHSSDNNNFGFRL 2565
             + +TA DG    R     + I + D ND+ PV +       V EN     +L TV+  D D+G NG    S        S    L ++  D    I     Y D+ F       Y ++++  D   P + +  K  + ++D NDNAP          V E +  G+ +      D DS  NG +  SI    DN   ++      Y  + +    DRE+   Y   VTA D G P L+    + +++ DIND  P F    Y   + E+   + +   +  + A D D G N  + Y L +    G P +S +          S  G +    + D E+   +QLLV A D G P LS+  ++ + VLD NDN P  L   FP+++   V ++    + G  +  V   D D G N  +++ L+ S++   F   +   GE+    T +   +  +L   L++   D GQ P +   TL +    S+ ++    +G    S+D ++ G  L
Sbjct:  209 HLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVHENVPVGTLLLTVKATDPDEGANGDVTYSFRKVRDKISQLFQLNSLSGD--ITILGDLDYEDSGF-------YDIDVEAHD--GPGLRARSKVLVTVLDENDNAPEVTVTSLTSSVQETSSPGTVIALFNVHDSDSGGNGLVTCSI---PDNLPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNPPTFPHASYSAYVPEN---NPRGASILSMTAQDPDSGDNARITYSLAEDTFQGAPLSSYVSIN-------SNTGILYALRSFDYEQFRDLQLLVTASDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTFPTDDSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYRLLKSSEPGLFAVGLH-TGEV---RTARALLDRDALKQSLVVVVQDHGQPPLSATVTLTVAVADSIPDVL-ADLGSLKPSADPDDSGLTL 691          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q5DRA6|PCDGI_PANTR (Protocadherin gamma-B6 OS=Pan troglodytes OX=9598 GN=PCDHGB6 PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 3.123e-52
Identity = 194/706 (27.48%), Postives = 320/706 (45.33%), Query Frame = 1
Query:  184 VEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKL--YLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETY-----PDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-------EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTI-------IIEVL-DLNDNAPVFLFPSNNMNF 2202
            + +S+ E    G VVGN+   L        +  ++ + +  +FS++  SGDL+VK+ +DRE IC+  +  C ++L   ++   +   +++ I D+ND+ P F   +  + I E+   GT   L  A D D     +K Y I                N+  +F +    +     YP L + K +DREE  S   IL A D G+  ++ +  + + V D NDN P +++D Y++++ E    G  +L++ A D+D+    N  ++Y      +  K    +F ++     + NN+     +     + + A DG G   +  V I I D ND+ P I I +   ++LEN    +++   + +D D G NG   C           NI  D  F IY    +      D + DRE+   Y V I   D+G P +SS +  ++ + D+NDNAP F     + HV ENNP G+++ QV A D D   NGHI YSI+ S+ +  A+S Y       G + ++  FD E+  ++   + ARD+G P L+ ++ ++V + D ND  P         +   FF +     E      + ++ A D D G N  + Y ++     G+         LR        G +     L   + +  +LLV   D G P LS T T+       + E+L DL+D  PV   P   + F
Sbjct:   33 IRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLRVSAEKLHFSVDAESGDLLVKNRIDREQICKERRR-CELQLEAVVENPLNIFHVIVVIEDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKI----------------NSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEYRISLSENLPPGSPVLQVTATDQDE--GVNAEINYYFRSTAQSTK---HMFSLDEKTGMIKNNQSFDFEDVERYTMEVEAKDGGGLSTQCKVIIEILDENDNSPEIIITSLSDQILENSPPGMVVALFKTRDLDFGGNGEVRC-----------NIETDIPFKIYSSSNHYYKLVTDGALDREQTPEYNVTIVATDRGKPPLSSSRSITLYVADINDNAPVFDQTSYVVHVAENNPPGASIAQVSASDPDLGLNGHISYSIVASDLEPLAVSSYVSVSAQSGVVFAQRAFDHEQLRAFALTLQARDHGSPTLSANVSLRVLVGDRNDNAPRVLYPALGPDGSAFFDMVPRSAE--PGYLVTKVVAVDADSGHNAWLSYHVLQASEPGL-----FSLGLRT-------GEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADNLQEILPDLSDR-PVLSDPQAELQF 690          

HSP 2 Score: 95.1301 bits (235), Expect = 2.257e-18
Identity = 88/297 (29.63%), Postives = 137/297 (46.13%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI--------YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI 2340
            + I DVND+AP+F  K     + E+   G+ +    A D D + N    Y I NSN  F++ +        Y E+  +   DRE+  S+  ++TA D G+P  + +  +++ ++D ND  PVF +D + RI+ S      +  L Q+ ATD+D G N  + Y             S  ++           G I    + D E++    + V+A D G   LST   +IIE+LD NDN+P  +  S +   +  S     G  +   KT+DLD G NG      +  N   + PFKI
Sbjct:  121 VVIEDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKI-NSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEY-RISLSENLPPGSPVL-QVTATDQDEGVNAEINYYF----------RSTAQSTKHMFSLDEKTGMIKNNQSFDFEDVERYTMEVEAKDGG--GLSTQCKVIIEILDENDNSPEIIITSLSDQILENSPP---GMVVALFKTRDLDFGGNGE-----VRCNIETDIPFKI 394          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q5DRA9|PCDGE_PANTR (Protocadherin gamma-B2 OS=Pan troglodytes OX=9598 GN=PCDHGB2 PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 3.793e-52
Identity = 188/679 (27.69%), Postives = 309/679 (45.51%), Query Frame = 1
Query:  169 VITLNVEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXX------XXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-------DNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-------EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTI 2133
             + + + +S+ E      VVGN+   L        +  ++ + +  YF++N  SGDL+V   +DRE IC   +  C     LD DT A          + + DINDN P+F+ T+  + I E+   GTT+PL  A D D     ++ Y++                N+ ++F +   ++     YP L +  ++DREE      +L A D G+  Q+G+  + V VTD NDN P +++D Y+V ++E    G  +L++ A DRD+    N  ++Y   +  E    V   F +N     +T          ++  + I A D        S+ + I D ND  P + + + F  + E+     ++  ++ +D D G NG   C +  + K  LK+     N+  YK+ T  D + DRE+I  Y + I   D G P +SS    +++I DVNDNAP F     M HV ENNP G+++ Q+ A D D   NG + YSI+ S+          ++S   G + ++  FD E+  ++E  + ARD G P L+ ++ ++V + D+ND  P         +    F +     E      + ++ A D D G N  + Y ++     G+         LR        G +     L   + +  +LLV   D G P LS T T+
Sbjct:   28 ALPVQIRYSIPEELAKNSVVGNLAKDLGLSVRDLPARKLRVSAEKEYFTVNPESGDLLVSDRIDREQIC-GKQPLC----VLDFDTVAENPLNIFYIAVIVQDINDNTPLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHL----------------NDNEYFDLAEKQTPDGRKYPELILQHSLDREEHSLHQLVLTAVDGGDPPQSGTTQIRVKVTDANDNPPVFSQDVYRVTLREDVPPGFFVLQVTATDRDE--GVNAEITYSFHNVDEQ---VKHFFNLNEKTGEITTKDDLDFEIASSYTLSIEAKDPGDLAAHCSIQVEILDDNDCAPEVIVTSVFTPLPEDSPPGTVIALIKTRDRDSGENGEVYCQVLGNAKFILKS--SSKNY--YKLVT--DGALDREEIPEYNLTITATDGGKPPLSSSIIVTLHISDVNDNAPVFQQTSYMVHVAENNPPGASIAQISASDPDLGPNGQVSYSIVASDLKPREILSYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVGDLNDNAPRVLYPALGSDGSALFDMVPRAAE--PGYLVTKVVAVDADSGHNAWLSYHVLQASEPGL-----FSLGLRT-------GEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATL 660          

HSP 2 Score: 173.326 bits (438), Expect = 1.039e-42
Identity = 139/491 (28.31%), Postives = 232/491 (47.25%), Query Frame = 1
Query: 1084 RIYITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI----YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITE--SYGESIKNERLEQIKATDKDLGQNGTVKYRLI--DVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPS----NNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNP 2508
            ++ +TA DG    +   T + + + D ND+PPV S       + E+      +  V   D D+G N     S ++  +  +K+  F+ N    +I T  D  F  E  S YT+ I+  D G+  +++     + I+D ND AP  +       + E++P G+ +  ++  D DS  NG +   +L  N  F +      Y ++ +    DRE+   Y   +TA D G+P L+ S++V + I D+ND  PVF++  Y   + E    G SI      QI A+D DLG NG V Y ++  D+KP           E+ + + VS   G +      D E++ + +L +QA D G P+LS   ++ + V DLNDNAP  L+P+     +  F  V    E G  +  V   D D G N  +++ ++ +++   F   ++  GE+  A  + +    R    RL++   D GQ P +  ATL++ +  SL  + P
Sbjct:  209 QLVLTAVDGGDPPQSGTTQIRVKVTDANDNPPVFSQDVYRVTLREDVPPGFFVLQVTATDRDEGVNAEITYSFHNVDE-QVKHF-FNLNEKTGEITTKDDLDF--EIASSYTLSIEAKDPGD--LAAHCSIQVEILDDNDCAPEVIVTSVFTPLPEDSPPGTVIALIKTRDRDSGENGEVYCQVLG-NAKFILKSSSKNYYKLVTDGALDREEIPEYNLTITATDGGKPPLSSSIIVTLHISDVNDNAPVFQQTSYMVHVAENNPPGASIA-----QISASDPDLGPNGQVSYSIVASDLKP----------REILSYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVGDLNDNAPRVLYPALGSDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLR-TGEVRTARALGDRDAARQ---RLLVAVRDGGQPPLSATATLHLIFADSLQEVLP 673          

HSP 3 Score: 152.91 bits (385), Expect = 2.447e-36
Identity = 129/450 (28.67%), Postives = 201/450 (44.67%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT----SFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI-----YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTP-VFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSK--LKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSN--KRENFPF-KIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLG 2439
            + + ++D ND+ P+        K+ E+ K           D D G N +    LND+   +L   +  D         YP+     S DRE+ S++ + +  VD G+P  S   +  + + D NDN P F   +    + E+ P G  V QV A D D   N  I YS  N ++            GEI +K   D E   SY   + A+D G+  L     ++V+I D NDC P V     F  + E   +S     +  IK  D+D G+NG V  +++        GN+K  LK+  +N  K+  DGA      LDREEI    L + A D G P LS++  + + + D+NDNAPVF         V+V+     G +I  +   D D G NG +++S++ S+   RE   +  +  +  ++ A    +    R+    L ++A D G
Sbjct:  119 IAVIVQDINDNTPLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLAEKQTPDG------RKYPELILQHSLDREEHSLHQLVLTAVDGGDPPQSGTTQIRVKVTDANDNPPVFSQDVYRVTLREDVPPGFFVLQVTATDRDEGVNAEITYSFHNVDEQVKHFFNLNEKTGEITTKDDLDFEIASSYTLSIEAKDPGD--LAAHCSIQVEILDDNDCAPEVIVTSVFTPLPE---DSPPGTVIALIKTRDRDSGENGEVYCQVL--------GNAKFILKSSSKNYYKLVTDGA------LDREEIPEYNLTITATDGGKPPLSSSIIVTLHISDVNDNAPVF---QQTSYMVHVAENNPPGASIAQISASDPDLGPNGQVSYSIVASDLKPREILSYVSVSAQSGVVFAQRAFDHEQLRAF--ELTLQARDQG 538          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q9Y5F9|PCDGI_HUMAN (Protocadherin gamma-B6 OS=Homo sapiens OX=9606 GN=PCDHGB6 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 5.149e-52
Identity = 196/708 (27.68%), Postives = 322/708 (45.48%), Query Frame = 1
Query:  184 VEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKL--YLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIY-------KIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-------EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTI-------IIEVL-DLNDNAPVFLFPSNNMNF 2202
            + +S+ E    G VVGN+   L        +  ++ + +  +FS++  SGDL+VK+ +DRE IC+  +  C ++L   ++   +   +++ I D+ND+ P F   +  + I E+   GT   L  A D D     +K Y I                N+  +F +    +     YP L + K +DREE  S   IL A D G+  ++ +  + + V D NDN P +++D Y++++ E    G  +L++ A D+D+    N  ++Y      +  K    +F ++     + NN+     +     + + A DG G   +  V I I D ND+ P I I +   ++LEN    +++   + +D D G NG   C           NI  D  F IY       K+ T  D + DRE+   Y V I   D+G P +SS +  ++ + D+NDNAP F     + HV ENNP G+++ QV A D D   NGHI YSI+ S+ +  A+S Y       G + ++  FD E+  ++   + ARD+G P L+ ++ ++V + D ND  P         +   FF +     E      + ++ A D D G N  + Y ++     G+         LR        G +     L   + +  +LLV   D G P LS T T+       + E+L DL+D  PV   P   + F
Sbjct:   33 IRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLRVSAEKLHFSVDAESGDLLVKNRIDREQICKERRR-CELQLEAVVENPLNIFHVIVVIEDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKI----------------NSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEYRISLSENLPPGSPVLQVTATDQDE--GVNAEINYYFRSTAQSTK---HMFSLDEKTGMIKNNQSFDFEDVERYTMEVEAKDGGGLSTQCKVIIEILDENDNSPEIIITSLSDQILENSPPGMVVALFKTRDLDFGGNGEVRC-----------NIETDIPFKIYSSSNNYYKLVT--DGALDREQTPEYNVTIVATDRGKPPLSSSRSITLYVADINDNAPVFDQTSYVVHVAENNPPGASIAQVSASDPDLGLNGHISYSIVASDLEPLAVSSYVSVSAQSGVVFAQRAFDHEQLRAFALTLQARDHGSPTLSANVSLRVLVGDRNDNAPRVLYPALGPDGSAFFDMVPRSAE--PGYLVTKVVAVDADSGHNAWLSYHVLQASEPGL-----FSLGLRT-------GEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADNLQEILPDLSDR-PVLSDPQAELQF 690          

HSP 2 Score: 94.7449 bits (234), Expect = 2.817e-18
Identity = 88/295 (29.83%), Postives = 136/295 (46.10%), Query Frame = 1
Query: 1480 IIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI--------YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI 2340
            I DVND+AP+F  K     + E+   G+ +    A D D + N    Y I NSN  F++ +        Y E+  +   DRE+  S+  ++TA D G+P  + +  +++ ++D ND  PVF +D + RI+ S      +  L Q+ ATD+D G N  + Y             S  ++           G I    + D E++    + V+A D G   LST   +IIE+LD NDN+P  +  S +   +  S     G  +   KT+DLD G NG      +  N   + PFKI
Sbjct:  123 IEDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKI-NSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEY-RISLSENLPPGSPVL-QVTATDQDEGVNAEINYYF----------RSTAQSTKHMFSLDEKTGMIKNNQSFDFEDVERYTMEVEAKDGG--GLSTQCKVIIEILDENDNSPEIIITSLSDQILENSPP---GMVVALFKTRDLDFGGNGE-----VRCNIETDIPFKI 394          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A4E0S0C6 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_000360 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 1.050e-92
Identity = 255/845 (30.18%), Postives = 398/845 (47.10%), Query Frame = 1
Query:  499 VINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIA-----------------RCQ-GIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFV-SFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWT-----------------------------KDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDR--KIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVL--ENQKQKIILTTVQVKDED--KGRNGMFECSLNDSGKLNLKNI----RFDDN----------------------------FAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIK---------------------MFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN-----------------FAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQ-LNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRL-IDVKPIGIPGNSKLKAEL----RNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYP-SLSTTTTIIIEVLDLNDNAPVFLFP-------------------------------SNNMNF-VNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKREN----------FPFKIQPEGEIIIAHTMKEFSNFRS-----------LPDRLIIKASDLGQNPKNNIATLYIRY 2481
            VI + E  PIGT   LP A D D+ ++GV+ Y                    R Q G+  E+         Q     +P+     + P L  I+ +DRE     F F LIATD   + G   V +LV DVND+APEW                              + +Y  ++ EC ++  ++ L A D+DDP    G ++++LS+ + DR    + +  +++ + L+LT+  + GL  + N+ I + A+DG GR  E    + IEDCNDH P+I I N     +  E+  Q  +++ + V+D D     N  F C LND+  L LK +      DD                             +++Y++ +  + SFDRE  ++YTV  +C+D+G+P++++ +  +I+I D+NDNAP+F+ +                       +F V E+   G  +G VRA+DLDS  N  + Y++L+ ++N                 F ++  GE+    + DRE    YEF+V A D+G+ Q L+ +  V++ + D+NDC PVF  DY F + ESYG S  ++ L  + ATD DLG+NG+V YRL +  +  G+ G SK  ++       L+KVS DG I+VYG +DRE+I+ I + V A D+G P  +ST TT+ I VLDLNDN P F+ P                               S++  + +N+S++  IG  I   +  D D G NGT+T  LI S               F F + P+G +I+ + + EF    +            PD L+I+ SD G  P++ I  + I Y
Sbjct:  208 VITVDEECPIGTMIQLPQATDPDTQEHGVQRYEFHPTSTAVRVREHFDVVQFRHQPGLRCEDVTSVQLEMIQSVAPADPR----PVVPCLRTIRRLDRETAGDQFHFNLIATDTNGKRGEIAVQLLVRDVNDHAPEWATKLELFDSSSRSHWISASPSDPAHGTESRQTHYTFSVPECTTQHKLIRLEAQDKDDPQQDGGKITFRLSEHSPDRLPTTLRRRLFVSNDHLYLTDRGLRGLA-QPNLTIVVVASDGAGRNTEAWFHLRIEDCNDHRPMILIQNTDYITIPEESAGQSHLVSLITVRDFDLVTSPNSQFSCFLNDTTYLELKEVVAGPTADDRDLLHSHSHQGDEITSTGGKEDLSSRRGRWSVYRLGSRSEISFDRETSALYTVMFECIDKGSPSLTASRPITIHIEDINDNAPQFITRCAPLPLSQNTKDIKPNRPCTPQFVFTVSEDAERGILIGSVRAVDLDSGENARVEYTLLSLHNNSTVPDSNESEVFRPETLFTVTPMGELHLLGELDRESQSYYEFLVVATDHGKRQRLSSTATVQITVADVNDCAPVFRGDYVFEVVESYGSSTIHQVLGTLNATDADLGRNGSVHYRLAVHPRESGLSGLSKSMSDSAVPGAQLVKVSHDGQITVYGVVDREQITMIMVDVIAEDNGVPLHMSTMTTVTIHVLDLNDNKPRFVQPEFTAGRLPSSFSNQKPERFNTLGLPPSFEALSSDATYKLNLSLDTSIGTLITKFEAFDPDYGPNGTLTFELIYSGGTMQTRSDPGNSSLFTFTLHPDGRLILTNHL-EFDTVYTGSTRLVPRRYRRPDHLLIRVSDQGSTPEHVITGVQIIY 1046          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A1I8H4K2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.255e-64
Identity = 239/818 (29.22%), Postives = 379/818 (46.33%), Query Frame = 1
Query:  142 ILIIFSIKLVITLN----VEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXX------XXXXXFQTTQK--VINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATD--FGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQS-EGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLN--DSGKLNLKNIRFDDNF-AIYKIETYPDTSFDREKIS--VYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL-NSNDNFAISIYG----EIQSKIKFDREKTDSYEFVVTARDNG-EPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNL----IKVSFDGA-ISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMK---EFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIH 2487
            I  ++ I L ++ +    V F   E   IG+ +GN+ ++ +    S  + L   +E    F L+  +G L   + LDRE +C N    C     ++           I          D  P F+   K   I+I E+    + Y LP A+D DS +Y    Y             +K IG+   +F++   +   + + P LE+ K +DRE   ++   L+ +D        S  + + V D NDN P+W      + I EC      +L+L A D D     N  ++Y +       K V++ FYI+G+KL    +     I +  + I + A D  G   ET V++ + DCNDH P I++     K+LEN + + +L  + V DED+G NG  +C +   +  K  L N   D  +  IYK++     SFDRE  S     V+I C D+G+      ++  I I+D NDNAPR  +K+  F + EN+P  + VG+V A D D   N  + +S+  + + NF I   G    EI S + FDRE+ D Y F VT  D+G + Q   +  V+V I D +D  P F+ ++Y FRI E YG ++    + ++KATD D+G N  + Y +          N + +A L ++    +   F+G+ +   GN DRE+   I L + A + G      +  + I + D+NDNAP            N+S     G  +  V   DLD G NGT+T+ L   ++ E   F I  + G + ++ ++K       F+S   RL I   D G  P ++I   Y  ++H
Sbjct:    9 ISTLWPILLAVSQDSQPTVTFYTKEEIPIGNEIGNLKTRFSYPDGSQFNMLFPDSEIRRLFRLDSRTGALSTIARLDREVLCPNKPLECLRTFNVEVKRGGTGQEEVIVIRLIINDVNDQRPKFEAKHKKFRISIPESDNPPSYYSLPTAEDGDSDRYDHVKY------------DLKMIGDAGMYFKLFLEERGSKRV-PKLELTKALDRETKDNYELQLLVSDEQHPQDQDSADIQIEVLDANDNKPQWRLAKQSITISECDRLHRPLLKLNATDED----LNERITYSIGKAAG--KDVAKSFYISGDKLKQNQSLDYEKIRKKVLYIPLVAEDRGGSTVETYVELRVTDCNDHYPNITVEMIEDKILENDETEKVLARILVVDEDEGNNGTVDCVIGVPNKRKFQLTNRITDGQYKTIYKLKKLAHVSFDREATSGGEVRVDIICTDKGDSPRVGRKEVKIMILDENDNAPRIESKLYTFRIHENSPPNTLVGRVTARDDDIDENARLKFSLHSDGSRNFVIRNQGNNMAEIYSAVSFDREQIDHYRFTVTVADSGLKEQRTSTATVEVTIVDEDDSVPTFQFREYMFRIEEDYGRNLSKRYIGEVKATDADIGANQMIWYEV----------NRQYQASLADVGISGMYFYFNGSHLYGEGNFDREKQEIINLEIFARNRGPAKHKGSARVTITLNDVNDNAPSI---QGLQKVYNLSENSPAGTPVLQVSGTDLDAGENGTLTYIL---DETEANRFTIDGKHGIVTLSGSLKNNQPEDGFQSQTYRLGIGVRDNGNPPLHSIK--YTTFVH 789          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A267GLZ2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017053g2 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.257e-64
Identity = 240/818 (29.34%), Postives = 380/818 (46.45%), Query Frame = 1
Query:  142 ILIIFSIKLVITLN----VEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXX------XXXXXFQTTQK--VINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTG--SCXXXXXXXXXXXXAPEWTKDNYKVNIQECQS-EGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLN--DSGKLNLKNIRFDDNF-AIYKIETYPDTSFDREKISV--YTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL-NSNDNFAISIYG----EIQSKIKFDREKTDSYEFVVTARDNG-EPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNL----IKVSFDGA-ISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMK---EFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIH 2487
            I  ++ I L ++ +    V F   E   IG+ +GN+ ++ +    S  + L   +E    F L+  +G L   + LDRE +C N    C     ++           I          D  P F+   K   I+I E+    + Y LP A+D DS +Y    Y             +K IG+    F++   +   + + P LE+ K +DRE   ++   L+ +D  +Q    S  + + V D NDN P+W      + I EC      +L+L A D D     N  ++Y +       K V++ FYI+G+KL    +     I +  + I + A D  G   ET V++ + DCNDH P I++     K+LEN + + +L  + V DED+G NG  +C +   +  K  L N   D  +  IYK++     SFDRE  S     V+I C D+G+      ++  I I+D NDNAPR  +K+  F + EN+P  + VG+V A D D   N  + +S+  + + NF I   G    EI S + FDRE+ D Y F VT  D+G + Q   +  V+V I D +D  P F+ ++Y FRI E YG ++    + ++KATD D+G N  + Y +          N + +A L ++    +   F+G+ +   GN DRE+   I L + A + G      +  + I + D+NDNAP            N+S     G  +  V   DLD G NGT+T+ L   ++ E   F I  + G + ++ ++K       F+S   RL I   D G  P ++I   Y  ++H
Sbjct:    9 ISTLWPILLAVSQDSQPTVTFYTKEEIPIGNEIGNLKTRFSYPDGSQFNMLFPDSEIRRLFRLDSRTGALSTIARLDREVLCPNKPLECLRTFNVEVKRGGTGQEEVIVIRLIINDVNDQRPKFEAKHKKFRISIPESDNPPSYYSLPTAEDGDSDRYDHVKY------------DLKMIGDAGMHFKLFLEERGSKRV-PKLELTKALDRETKDNYELQLLVSDEQHQQDQDSADIQIEVLDANDNKPQWRLAKQSITISECDRLHRPLLKLNATDED----LNERITYSIGKAAG--KDVAKSFYISGDKLKQNQSLDYEKIRKKVLYIPLVAEDRGGSTVETYVELRVTDCNDHYPNITVEMIEDKILENDETEKVLARILVVDEDEGNNGTVDCVIGVPNKRKFQLTNRITDGQYKTIYKLKKLAHVSFDREATSGGDVRVDIICTDKGDSPRVGRKEVKIMILDENDNAPRIESKLYTFRIHENSPPNTLVGRVTARDDDIDENARLKFSLHGDGSRNFVIRNQGNNMAEIYSAVSFDREQIDHYRFTVTVADSGLKEQRTSTATVEVTIVDEDDSVPTFQFREYMFRIEEDYGRNLSKRYIGEVKATDADIGANQMIWYEV----------NRQYQASLADVGISGMYFYFNGSHLYGEGNFDREKQEIINLEIFARNRGPAKHKGSARVTITLNDVNDNAPSI---QGLQKVYNLSENSPAGTPVLQVSGTDLDAGENGTLTYIL---DETEANRFTIDGKHGIVTLSGSLKNNQPEDGFQSQTYRLGIGVCDNGNPPLHSIK--YTTFVH 789          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A267DHT6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017053g3 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.456e-64
Identity = 240/818 (29.34%), Postives = 378/818 (46.21%), Query Frame = 1
Query:  142 ILIIFSIKLVITLN----VEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXX------XXXXXFQTTQK--VINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATD--FGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQS-EGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLN--DSGKLNLKNIRFDDNF-AIYKIETYPDTSFDREKIS--VYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL-NSNDNFAISIYG----EIQSKIKFDREKTDSYEFVVTARDNG-EPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNL----IKVSFDGA-ISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMK---EFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIH 2487
            I  ++ I L ++ +    V F   E   IG+ +GN+ ++ +    S  + L    E    F L   +G L   + LDRE +C N    C     ++           I          D  P F+   K   I+I E+    + Y LP A+D DS +Y    Y             +K IG+   +F++   +   + + P LE+IK +DRE   ++   L+ +D        S  + + V D NDN P+W      + I EC      +L+L A D D     N  ++Y +       K V++ FYI+G+KL    +     I +  + I + A D  G   ET V++ + DCNDH P I++     K+LEN + + +L  + V DED+G NG  +C +   +  K  L N   D  +  IYK++     SFDRE  S     V+I C D+G+      ++  I I+D NDNAPR  +K+  F + EN+P  + VG+V A D D   N  + +S+  + + NF I   G    EI S + FDRE+ D Y F VT  D+G + Q   +  V+V I D +D  P F+ ++Y FRI E YG ++    + ++KATD D+G N  + Y +          N + +A L ++    +   F+G+ +   GN DRE+   I L + A + G      +  + I + D+NDNAP            N+S     G  +  V   DLD G NGT+T+ L   ++ E   F I  + G + ++ ++K       F+S   RL I   D G  P ++I   Y  ++H
Sbjct:    9 ISTLWPILLAVSQDSQPTVTFYTKEEIPIGNEIGNLKTRFSYPDGSQFNMLFPDPEIRRLFRLESRTGALSTIARLDREVLCPNKPLECLRTFNVEVKRGGTGQEEVIVIRLIINDVNDQRPKFEAKHKKFRISIPESDNPPSYYSLPTAEDGDSDRYDNVKY------------DLKMIGDAGMYFKLFLEERGSKRV-PKLELIKALDRETKDNYELQLLVSDEQHPQDQDSADIQIEVLDANDNKPQWRLAKQSITISECDRLHRPLLKLNATDED----LNERITYSIGKAAG--KDVAKSFYISGDKLKQNQSLDYEKIRKKVLYIPLVAEDRGGSTVETYVELRVTDCNDHYPNITVEMIEDKILENDETEKVLARILVVDEDEGNNGTVDCVIGVPNKRKFQLTNRITDGQYKTIYKLKKLAHVSFDREATSGGEVRVDIICTDKGDSPRVGRKEVKIMILDENDNAPRIESKLYTFRIHENSPPNTLVGRVTARDDDIDENARLKFSLHSDGSRNFVIRNQGNNMAEIYSAVSFDREQIDHYRFTVTVADSGLKEQRTSTATVEVTIVDEDDSVPTFQFREYMFRIEEDYGRNLSKRYIGEVKATDADIGANQMIWYEV----------NRQYQASLADVGISGMYFYFNGSHLYGEGNFDREKQEIINLEIFARNRGPAKHKGSARVTITLNDVNDNAPSI---QGLQKVYNLSENSPAGTPVLQVSGTDLDAGENGTLTYIL---DETEANRFTIDGKHGIVTLSGSLKNNQPEDGFQSQTYRLGIGVRDNGNPPLHSIK--YTTFVH 789          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A267GS00 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017053g1 PE=4 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 2.431e-64
Identity = 236/800 (29.50%), Postives = 371/800 (46.38%), Query Frame = 1
Query:  184 VEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXX------XXXXXFQTTQK--VINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATD--FGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQS-EGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLN--DSGKLNLKNIRFDDNF-AIYKIETYPDTSFDREKIS--VYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL-NSNDNFAISIYG----EIQSKIKFDREKTDSYEFVVTARDNG-EPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNL----IKVSFDGA-ISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMK---EFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIH 2487
            V F   E   IG+ +GN+ ++ +    S  + L   +E    F L+  +G L   + LDRE +C N    C     ++           I          D  P F+   K   I+I E+    + Y LP A+D DS +Y    Y             +K IG+   +F++   +   + + P LE+ K +DRE   ++   L+ +D        S  + + V D NDN P+W      + I EC      +L+L A D D     N  ++Y +       K V++ FYI+G+KL    +     I +  + I + A D  G   ET V++ + DCNDH P I++     K+LEN + + +L  + V DED+G NG  +C +   +  K  L N   D  +  IYK++     SFDRE  S     V+I C D+G+      ++  I I+D NDNAPR  +K+  F + EN+P  + VG+V A D D   N  + +S+  + + NF I   G    EI S + FDRE+ D Y F VT  D+G + Q   +  V+V I D +D  P F+ ++Y FRI E YG ++    + ++KATD D+G N  + Y +          N + +A L ++    +   F+G+ +   GN DRE+   I L + A + G      +  + I + D+NDNAP            N+S     G  +  V   DLD G NGT+T+ L   ++ E   F I  + G + ++ ++K       F+S   RL I   D G  P ++I   Y  ++H
Sbjct:   27 VTFYTKEEIPIGNEIGNLKTRFSYPDGSQFNMLFPDSEIRRLFRLDSRTGALSTIARLDREVLCPNKPLECLRTFNVEVKRGGTGQEEVIVIRLIINDVNDQRPKFEAKHKKFRISIPESDNPPSYYSLPTAEDGDSDRYDHVKY------------DLKMIGDAGMYFKLFLEERGSKRV-PKLELTKALDRETKDNYELQLLVSDEQHPEDQDSADIQIEVLDANDNKPQWRLAKQSITISECDRLHRPLLKLNATDED----LNERITYSIGKAAG--KDVAKSFYISGDKLKQNQSLDYEKIRKKVLYIPLVAEDRGGSTVETYVELRVTDCNDHYPNITVEMIEDKILENDETEKVLARILVVDEDEGNNGTVDCVIGVPNKRKFQLTNRITDGQYKTIYKLKKLAHVSFDREATSGGEVRVDIICTDKGDSPRVGRKEVKIMILDENDNAPRIESKLYTFRIHENSPPNTLVGRVTARDDDIDENARLKFSLHSDGSRNFVIRNQGNNMAEIYSAVSFDREQIDHYRFTVTVADSGLKEQRTSTATVEVTIVDEDDSVPTFQFREYMFRIEEDYGRNLSKRYIGEVKATDADIGANQMIWYEV----------NRQYQASLADVGISGMYFYFNGSHLYGEGNFDREKQEIINLEIFARNRGPAKHKGSARVTITLNDVNDNAPSI---QGLQKVYNLSENSPAGTPVLQVSGTDLDAGENGTLTYIL---DETEANRFTIDGKHGIVTLSGSLKNNQPEDGFQSQTYRLGIGVRDNGNPPLHSIK--YTTFVH 789          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 212.231 bits (539), Expect = 1.357e-55
Identity = 222/785 (28.28%), Postives = 363/785 (46.24%), Query Frame = 1
Query:  256 LPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSF-LDRETI--CENTKETCSMK-------LYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQT--GSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRD-DPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFD--DNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI----SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQP-EGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLN 2505
            LP+S    L K      Y  ++  +G++      +DRET+  C    + C ++       L  +Q    I+  IE+ DINDN P F +    +++QEN  +G T+ +P A D+D+ + GV  Y ++                    F ++    + E++ P L ++ N+DRE   S+   + A D G  +   S  + V++TD NDNAP++ K +Y+  + E    G  +L++ AND D  PN +     +Q SD       V ++  I  +   ++   + G ++R  I   + ++ A D   + + + T V I + D ND+ P + I        ++    + E+      +  VQV D+D+G N +  C +       L+       DN   Y ++T   T  D E+I  Y VEI  VD GNPA+SS     + + D NDN+P F   +      E N  G  V  V A+D DS  N  +VYSI+  +    +       GE++++   DRE  + YEF VTA D G P    +  V +K+ D ND  P F    Y F + E+         +  +   D D G+N  V+   + V+P           ++ N +  +  G I    + DRE+ SS    ++A D G P  S+   + I VLD NDNAPV   PSN+ +F  +S        +  V+ +D+D G N  + +S+   N  E   F I P +GEI +    KE +       RL++K SD G+  ++ IA ++I    +++N++
Sbjct:   84 LPDSGH--LYKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGP------------EASALFSLQMANDRGEKL-PQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP------VPKMLQIERSTGIIS---VKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTT--TPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENM---PPLSPVGMVTVLDMDKGENAQVQ---LSVEP-----------DVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHEL--FYISPSDGEIKLT---KELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETISNVS 819          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 211.075 bits (536), Expect = 1.571e-55
Identity = 222/785 (28.28%), Postives = 363/785 (46.24%), Query Frame = 1
Query:  256 LPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSF-LDRETI--CENTKETCSMK-------LYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQT--GSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRD-DPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNI---RIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFD--DNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI----SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQP-EGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLN 2505
            LP+S    L K      Y  ++  +G++      +DRET+  C    + C ++       L  +Q    I+  IE+ DINDN P F +    +++QEN  +G T+ +P A D+D+ + GV  Y ++                    F ++    + E++ P L ++ N+DRE   S+   + A D G  +   S  + V++TD NDNAP++ K +Y+  + E    G  +L++ AND D  PN +     +Q SD       V ++  I  +   ++   + G ++R  I   + ++ A D   + + + T V I + D ND+ P + I        ++    + E+      +  VQV D+D+G N +  C +       L+       DN   Y ++T   T  D E+I  Y VEI  VD GNPA+SS     + + D NDN+P F   +      E N  G  V  V A+D DS  N  +VYSI+  +    +       GE++++   DRE  + YEF VTA D G P    +  V +K+ D ND  P F    Y F + E+         +  +   D D G+N  V+   + V+P           ++ N +  +  G I    + DRE+ SS    ++A D G P  S+   + I VLD NDNAPV   PSN+ +F  +S        +  V+ +D+D G N  + +S+   N  E   F I P +GEI +    KE +       RL++K SD G+  ++ IA ++I    +++N++
Sbjct:   48 LPDSGH--LYKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGP------------EASALFSLQMANDRGEKL-PQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP------VPKMLQIERSTGIIS---VKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTT--TPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPL---SPVGMVTVLDMDKGENAQVQ---LSVEP-----------DVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHEL--FYISPSDGEIKLT---KELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETISNVS 783          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: ENSAMXT00000037569.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10712701:10726912:1 gene:ENSAMXG00000037804.1 transcript:ENSAMXT00000037569.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.608 bits (527), Expect = 8.721e-55
Identity = 197/706 (27.90%), Postives = 321/706 (45.47%), Query Frame = 1
Query:  190 FSVDENCRIGHVVGNVYSKLN---QLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIP----------------IGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNN---IRIYITATD--GNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYK--IETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN--DNFAIS------IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLE----------QIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDN 2163
            +SV E  + G VVGNV   LN   Q   +    ++ +     YF +N  +G++ V   +DRE +C  + + CS+ L                   + + +F  T  V+++ +N P                 G  YPLP A D D     VKTY ++  +                +F +      ++ I P L + K +DRE+  +   IL A D G  +++G+  +++ V DVNDN P ++K+ YKV++ E    G  +++L A D D     NG + Y L    +++   + IF IN     +T   + G ++R +     ++  A D   + R +   V I + D ND PPVIS+ +    V E+      +  + + D D G+NG     +  +G   L+        A YK       +   DRE +  Y+V I   D+G P +SS    +++I DVNDNAPRF + + +F+V EN+P G+ +  V A D D + N  IVYS++N    D+  +S      + G+I SK  F+ E+  S++F V A D+G P L+ ++ V V I D ND  PV    Y      S   S+  E +           +++A D D G N  + Y + + K     GN        NL ++ S  G I     +   ++ +  L++   D G PSLS T ++ + V +  D+
Sbjct:   35 YSVSEEVKAGTVVGNVAKDLNINVQDLEARMFRIIVSGSNKKYFEVNMKTGEMFVNERIDREELCSES-QACSLHL--------------EAIAQNPLRLFSVTVNVLDVNDNAPSFPYKSYDLNITELAFAGERYPLPKASDADVGVNSVKTYKLSANE----------------YFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVSVLENTLPGTPVIKLNATDLD--AGLNGEIVYSLISHGKEKW--ADIFAINSITGEIT---VKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGPFALQ--------ASYKNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPY------SEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHITEPK-----GN--------NLFRIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSATVSVDVVVAESMDS 675          

HSP 2 Score: 137.117 bits (344), Expect = 2.124e-32
Identity = 149/579 (25.73%), Postives = 253/579 (43.70%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYIN---GNKLHLTNNRI-SGLINRN---NIRIYITATDGNGRMNETSVDIAIE--DCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKI--ETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI----YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDY-FFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP---SNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI-QPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPT 2511
            AP +   +Y +NI E    G+   L  A+D D     N + +Y+LS         ++ F +N   G + +++   +    ++R     +++ +TA DG       ++D++I   D ND+ P  S       VLEN      +  +   D D G NG    SL   GK      ++ D FAI  I  E       DRE  + + +  +  D+G+   +S  K  I ++DVND+ P          V E+   G+ VG +   D D   NG +   +  +   FA+      Y  +      DRE    Y   + A D G P L+ S+V+ V I D+ND  P F      F + E+   S     +  + A D D+ +N  + Y LI+ K         + +   +++ +    G I    + + EE+ S Q  VQA D G P LS+  T+ + ++D NDN PV L P   + ++N  N+    E G  +  V+  D D G N  +++ +  +  + N  F+I    GEI     M + ++ ++ P  L+I   D G+   +   ++ +    S+ ++ P+
Sbjct:  133 APSFPYKSYDLNITELAFAGERYPLPKASDAD--VGVNSVKTYKLS--------ANEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVSVLENTLPGTPVIKLNATDLDAGLNGEIVYSLISHGKE-----KWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGP-FALQASYKNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKEN---SPSGNIIATVTAQDPDVNENAQIVYSLINRK--------NMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHI--TEPKGNNLFRIGSSSGEIRTKRRMSD-NDLKTHP--LVITVCDHGEPSLSATVSVDVVVAESMDSVRPS 679          

HSP 3 Score: 107.071 bits (266), Expect = 4.598e-23
Identity = 88/311 (28.30%), Postives = 148/311 (47.59%), Query Frame = 1
Query: 1447 AMSSMQKFSI--NIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKI--------KFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQ 2343
            A + ++ FS+  N++DVNDNAP F  K    ++ E    G      +A D D   N    Y  L++N+ F++++    +  I          DREK  + + ++TA D G P  + ++ + + + D+ND TP F K+ Y   + E+   ++    + ++ ATD D G NG + Y LI          S  K +  ++  + S  G I+V G LDRE+ ++ +L  QA D G    ++   ++IEVLD+ND+ PV    S       V  +   G  +  +   D D G NG ++  +     +   PF +Q
Sbjct:  113 AQNPLRLFSVTVNVLDVNDNAPSFPYKSYDLNITELAFAGERYPLPKASDADVGVNSVKTYK-LSANEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVSVLEN---TLPGTPVIKLNATDLDAGLNGEIVYSLI----------SHGKEKWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTS---TVREDATTGTAVGLITIADNDIGKNGEVSAKV-----KGTGPFALQ 401          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: ENSAMXT00000037829.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10717406:10726912:1 gene:ENSAMXG00000037804.1 transcript:ENSAMXT00000037829.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.223 bits (526), Expect = 1.130e-54
Identity = 197/706 (27.90%), Postives = 321/706 (45.47%), Query Frame = 1
Query:  190 FSVDENCRIGHVVGNVYSKLN---QLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIP----------------IGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNN---IRIYITATD--GNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYK--IETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN--DNFAIS------IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLE----------QIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDN 2163
            +SV E  + G VVGNV   LN   Q   +    ++ +     YF +N  +G++ V   +DRE +C  + + CS+ L                   + + +F  T  V+++ +N P                 G  YPLP A D D     VKTY ++  +                +F +      ++ I P L + K +DRE+  +   IL A D G  +++G+  +++ V DVNDN P ++K+ YKV++ E    G  +++L A D D     NG + Y L    +++   + IF IN     +T   + G ++R +     ++  A D   + R +   V I + D ND PPVIS+ +    V E+      +  + + D D G+NG     +  +G   L+        A YK       +   DRE +  Y+V I   D+G P +SS    +++I DVNDNAPRF + + +F+V EN+P G+ +  V A D D + N  IVYS++N    D+  +S      + G+I SK  F+ E+  S++F V A D+G P L+ ++ V V I D ND  PV    Y      S   S+  E +           +++A D D G N  + Y + + K     GN        NL ++ S  G I     +   ++ +  L++   D G PSLS T ++ + V +  D+
Sbjct:   45 YSVSEEVKAGTVVGNVAKDLNINVQDLEARMFRIIVSGSNKKYFEVNMKTGEMFVNERIDREELCSES-QACSLHL--------------EAIAQNPLRLFSVTVNVLDVNDNAPSFPYKSYDLNITELAFAGERYPLPKASDADVGVNSVKTYKLSANE----------------YFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVSVLENTLPGTPVIKLNATDLD--AGLNGEIVYSLISHGKEKW--ADIFAINSITGEIT---VKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGPFALQ--------ASYKNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPY------SEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHITEPK-----GN--------NLFRIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSATVSVDVVVAESMDS 685          

HSP 2 Score: 136.346 bits (342), Expect = 3.473e-32
Identity = 149/579 (25.73%), Postives = 253/579 (43.70%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYIN---GNKLHLTNNRI-SGLINRN---NIRIYITATDGNGRMNETSVDIAIE--DCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKI--ETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI----YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDY-FFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP---SNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI-QPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPT 2511
            AP +   +Y +NI E    G+   L  A+D D     N + +Y+LS         ++ F +N   G + +++   +    ++R     +++ +TA DG       ++D++I   D ND+ P  S       VLEN      +  +   D D G NG    SL   GK      ++ D FAI  I  E       DRE  + + +  +  D+G+   +S  K  I ++DVND+ P          V E+   G+ VG +   D D   NG +   +  +   FA+      Y  +      DRE    Y   + A D G P L+ S+V+ V I D+ND  P F      F + E+   S     +  + A D D+ +N  + Y LI+ K         + +   +++ +    G I    + + EE+ S Q  VQA D G P LS+  T+ + ++D NDN PV L P   + ++N  N+    E G  +  V+  D D G N  +++ +  +  + N  F+I    GEI     M + ++ ++ P  L+I   D G+   +   ++ +    S+ ++ P+
Sbjct:  143 APSFPYKSYDLNITELAFAGERYPLPKASDAD--VGVNSVKTYKLS--------ANEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVSVLENTLPGTPVIKLNATDLDAGLNGEIVYSLISHGKE-----KWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGP-FALQASYKNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKEN---SPSGNIIATVTAQDPDVNENAQIVYSLINRK--------NMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHI--TEPKGNNLFRIGSSSGEIRTKRRMSD-NDLKTHP--LVITVCDHGEPSLSATVSVDVVVAESMDSVRPS 689          

HSP 3 Score: 106.686 bits (265), Expect = 6.617e-23
Identity = 88/311 (28.30%), Postives = 148/311 (47.59%), Query Frame = 1
Query: 1447 AMSSMQKFSI--NIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKI--------KFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQ 2343
            A + ++ FS+  N++DVNDNAP F  K    ++ E    G      +A D D   N    Y  L++N+ F++++    +  I          DREK  + + ++TA D G P  + ++ + + + D+ND TP F K+ Y   + E+   ++    + ++ ATD D G NG + Y LI          S  K +  ++  + S  G I+V G LDRE+ ++ +L  QA D G    ++   ++IEVLD+ND+ PV    S       V  +   G  +  +   D D G NG ++  +     +   PF +Q
Sbjct:  123 AQNPLRLFSVTVNVLDVNDNAPSFPYKSYDLNITELAFAGERYPLPKASDADVGVNSVKTYK-LSANEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVSVLEN---TLPGTPVIKLNATDLDAGLNGEIVYSLI----------SHGKEKWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTS---TVREDATTGTAVGLITIADNDIGKNGEVSAKV-----KGTGPFALQ 411          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: ENSAMXT00000054364.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10715673:10726912:1 gene:ENSAMXG00000037804.1 transcript:ENSAMXT00000054364.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.838 bits (525), Expect = 1.357e-54
Identity = 197/706 (27.90%), Postives = 321/706 (45.47%), Query Frame = 1
Query:  190 FSVDENCRIGHVVGNVYSKLN---QLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIP----------------IGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNN---IRIYITATD--GNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYK--IETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN--DNFAIS------IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLE----------QIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDN 2163
            +SV E  + G VVGNV   LN   Q   +    ++ +     YF +N  +G++ V   +DRE +C  + + CS+ L                   + + +F  T  V+++ +N P                 G  YPLP A D D     VKTY ++  +                +F +      ++ I P L + K +DRE+  +   IL A D G  +++G+  +++ V DVNDN P ++K+ YKV++ E    G  +++L A D D     NG + Y L    +++   + IF IN     +T   + G ++R +     ++  A D   + R +   V I + D ND PPVIS+ +    V E+      +  + + D D G+NG     +  +G   L+        A YK       +   DRE +  Y+V I   D+G P +SS    +++I DVNDNAPRF + + +F+V EN+P G+ +  V A D D + N  IVYS++N    D+  +S      + G+I SK  F+ E+  S++F V A D+G P L+ ++ V V I D ND  PV    Y      S   S+  E +           +++A D D G N  + Y + + K     GN        NL ++ S  G I     +   ++ +  L++   D G PSLS T ++ + V +  D+
Sbjct:   40 YSVSEEVKAGTVVGNVAKDLNINVQDLEARMFRIIVSGSNKKYFEVNMKTGEMFVNERIDREELCSES-QACSLHL--------------EAIAQNPLRLFSVTVNVLDVNDNAPSFPYKSYDLNITELAFAGERYPLPKASDADVGVNSVKTYKLSANE----------------YFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVSVLENTLPGTPVIKLNATDLD--AGLNGEIVYSLISHGKEKW--ADIFAINSITGEIT---VKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGPFALQ--------ASYKNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPY------SEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHITEPK-----GN--------NLFRIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSATVSVDVVVAESMDS 680          

HSP 2 Score: 136.346 bits (342), Expect = 4.260e-32
Identity = 149/579 (25.73%), Postives = 253/579 (43.70%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYIN---GNKLHLTNNRI-SGLINRN---NIRIYITATDGNGRMNETSVDIAIE--DCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKI--ETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI----YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDY-FFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP---SNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI-QPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPT 2511
            AP +   +Y +NI E    G+   L  A+D D     N + +Y+LS         ++ F +N   G + +++   +    ++R     +++ +TA DG       ++D++I   D ND+ P  S       VLEN      +  +   D D G NG    SL   GK      ++ D FAI  I  E       DRE  + + +  +  D+G+   +S  K  I ++DVND+ P          V E+   G+ VG +   D D   NG +   +  +   FA+      Y  +      DRE    Y   + A D G P L+ S+V+ V I D+ND  P F      F + E+   S     +  + A D D+ +N  + Y LI+ K         + +   +++ +    G I    + + EE+ S Q  VQA D G P LS+  T+ + ++D NDN PV L P   + ++N  N+    E G  +  V+  D D G N  +++ +  +  + N  F+I    GEI     M + ++ ++ P  L+I   D G+   +   ++ +    S+ ++ P+
Sbjct:  138 APSFPYKSYDLNITELAFAGERYPLPKASDAD--VGVNSVKTYKLS--------ANEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVSVLENTLPGTPVIKLNATDLDAGLNGEIVYSLISHGKE-----KWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGP-FALQASYKNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKEN---SPSGNIIATVTAQDPDVNENAQIVYSLINRK--------NMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHI--TEPKGNNLFRIGSSSGEIRTKRRMSD-NDLKTHP--LVITVCDHGEPSLSATVSVDVVVAESMDSVRPS 684          

HSP 3 Score: 106.301 bits (264), Expect = 7.350e-23
Identity = 88/311 (28.30%), Postives = 148/311 (47.59%), Query Frame = 1
Query: 1447 AMSSMQKFSI--NIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKI--------KFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQ 2343
            A + ++ FS+  N++DVNDNAP F  K    ++ E    G      +A D D   N    Y  L++N+ F++++    +  I          DREK  + + ++TA D G P  + ++ + + + D+ND TP F K+ Y   + E+   ++    + ++ ATD D G NG + Y LI          S  K +  ++  + S  G I+V G LDRE+ ++ +L  QA D G    ++   ++IEVLD+ND+ PV    S       V  +   G  +  +   D D G NG ++  +     +   PF +Q
Sbjct:  118 AQNPLRLFSVTVNVLDVNDNAPSFPYKSYDLNITELAFAGERYPLPKASDADVGVNSVKTYK-LSANEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVSVLEN---TLPGTPVIKLNATDLDAGLNGEIVYSLI----------SHGKEKWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTS---TVREDATTGTAVGLITIADNDIGKNGEVSAKV-----KGTGPFALQ 406          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 5.783e-48
Identity = 173/613 (28.22%), Postives = 287/613 (46.82%), Query Frame = 1
Query:  727 NIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNG--MFECSLNDSGKLNLKNIRFDDNFAIYK-IETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREK------TDSYEFVVTARDNGEPQ-LNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKN-ERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTS 2514
            ++DREE   +   + A D G+        VT+ V D  D  P + +D+Y   + E  + G ++  ++    D N     V+Y +   + D++    I + +G ++   N      I+R     Y   + A  G G   E SV + + D N+H PV   A+    + E++       +V+  D+D G+NG   +E    + G+           F I+   + Y     DRE    Y++ +  +D G   +SS    ++ ++DVNDN P F +   +FH  E   +GS VG V+A D D+ +NG + YS      NF + S  G I S   FDRE         S+ F V A D G P+ L D   V+V +QD+ND  P F K  +     S  ES  N  +L ++ A+D D G NG ++Y + +       GN   K  +      +  G I++ G+LDREE +S  L+V A D G   L+ + T+ ++VLD NDN P F   + ++  V+      +G+ + T+   D D G +G + ++++  N    F    +  G + +A  + +F   R    RL + A D G+ P+++ AT+ + ++    N NP +
Sbjct:  615 SLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNAN---VTYLIV--SGDQRGSFSIEW-SGGRIFTAN-----AIDREEQAFYQLRVVANSG-GVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGE----------KFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVY---QASVSESASNLTQLLRVTASDVDEGVNGALRYAINE-------GNEGGKFTVD-----ASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF---TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAID-RSTGSVFLARRL-DFETQRLY--RLNVSAEDGGRPPRSS-ATILVVHVRDF-NDNPPA 1181          

HSP 2 Score: 159.844 bits (403), Expect = 9.472e-40
Identity = 159/599 (26.54%), Postives = 268/599 (44.74%), Query Frame = 1
Query:  712 LEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQE-CQSEGD-----ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDS---GKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGN--PA-MSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILN-----------SNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASD 2433
            L   + +DREE  S++  + A+D G       ++V V D NDN+P +++  Y  ++ E    +G      I  ++A D D  +   G V+Y L+  +ED       F ++     L   R     +R    +   ATDG G      + + + D ND+ P +   +   +V E+      L  +   D+D+G N   E S++     G+  + N   D   ++ +       + DRE+ S Y + ++  D+    PA +SS  + S+ + DVNDNAP F +        E++P+G+ V  V+A+D DS  N ++ Y++                 FA+ ++ GE++   + DRE   SY   V A D G P L  +  + V + D ND  P F  ++Y   I E   E    E L ++ A D D G NG ++Y +    P G   + +L   L         G ++V   LDRE  +S +L V+A D G P+ S T ++ + + D+ND +P F      ++    +    +   I  V  +D D G +G +T++    N      F + P+G +   H ++           LII A+D
Sbjct: 1572 LRASRRLDREERASYLLTVRASD-GTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDAD--SGPFGEVTYALAP-SEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGN---DGQLSVAR-------ALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL-APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAED--EPPGTEVL-RLSAWDPDEGANGELRYDIASGDPTG---DFRLDPVL---------GTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPV--LILQVVARDDDLGSSGQVTYAAAGGNDGGA--FSVSPDGHV---HLLRSLDREAQPQHVLIITATD 2133          

HSP 3 Score: 147.517 bits (371), Expect = 6.808e-36
Identity = 143/540 (26.48%), Postives = 224/540 (41.48%), Query Frame = 1
Query:  526 IGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNN-------IRIYITATDGNGRMNET-SVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL-NDSGKLNLKNIRFDDNFAIYKI--ETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN--DNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITE-SYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFD 2097
            IGT     +A D DS  +G  TY +A  +  D  +        F    +            +L + + +DRE    +V    ATD G    +  + V V D NDNAP    D+    + E    G  L  I+   DD    N  + + +S    + +      +  GN   L+  R    ++R         +R+   A     R++    V + + D ND+ P  + + R     E+     ++ TVQ  D D GRN   E +L  D  +           FA+  +  E       DRE    Y + +  VD+G P ++S    ++ + D NDNAPRF  +     + E+ P G+ V ++ A D D   NG + Y I + +   +F +  + G +      DRE+T SYE  V ARD G P  +D+  V+V + D+NDC+P F+   Y     E + G  +    + Q+ A D DLG +G V Y             +           VS DG + +  +LDRE      L++ A D
Sbjct: 1641 IGTV----LAGDADSGPFGEVTYALAPSEDSDWAD------GAFGLHPVTG----------ALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGV-NAELEFSISSGDPEGR------FAVGNDGQLSVARA---LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVL---ILQVVARDDDLGSSGQVTY-------------AAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 4 Score: 135.961 bits (341), Expect = 2.566e-32
Identity = 152/564 (26.95%), Postives = 252/564 (44.68%), Query Frame = 1
Query:  730 IDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQS-EGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGR--MNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKI------SVYTVEIKCVDQGNP-AMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFP----FKIQPE-GEIIIA 2367
            IDREE  +F  + +  + G   G  +V+VLV DVN++AP + + +Y+V+I E +        + A D+D  + KNG V Y++ +     K    IF      +    +R +    R    + ++A D       +  +V++ + D ND+ P+ + ++      E Q+   ++  VQ  D D G NG    S           + F+ +    +I +     FDRE +      + ++  +   D G P  +       + + DVNDN P+F   +    V E+    + + +V A D+D   NG + Y+I   N+    ++    G+I      DRE+T SY  VV+A D+G   L  S  V V++ D ND  P F +       ++   +   E L  + A+D+D G +G V+Y ++        GN+     +         G++ +   LD E     +L V A D G P  S+ T +++ V D NDN P FL P +   F ++     IG  + TV  +D D  +NG + +S+        FP    F I PE GEI  A
Sbjct:  719 IDREE-QAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKD--SGKNGEVKYEIGEGNGGEKF--GIFPDGQLYVRYELDRET----REEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEK------PQVNFELDSETGRIASL--RVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLS--VDALESTRVGELLITLTASDEDTGPSGDVRYAIV-------AGNTHATFAIDRST-----GSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFL-PGD--VFASIMENIPIGTRVITVTARDPDADVNGELHYSIA-----RQFPPGAHFTIDPESGEICTA 1243          

HSP 5 Score: 133.65 bits (335), Expect = 1.255e-31
Identity = 135/562 (24.02%), Postives = 240/562 (42.70%), Query Frame = 1
Query:  844 PEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLEN-----QKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIE-----TYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN--DNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGE---PQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRL-IDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYI 2475
            P +     ++ ++E   EG+ I  L A D D    +N LV+Y +   +E        F ++     L  +R      R +  + + A+DG     +  + +A+ D ND+ P  S       V E+     +  + ++ TV   D D G  G    +L  S   +      D  F ++ +      T P    DRE  + Y +  +  D G   +++  +  +N++D NDNAP   N      V E+ P G+++ ++ A D D   N  + +SI + +    FA+   G++      DRE+   Y  VV   D       +L+ ++ V + + D+ND  P F      R   +  +S     +  ++A D D G+N  V+Y L  D +  G    +       N +     G + +   LDRE   S  L V A D G P L++T T+ + V D NDNAP   FP        ++ +   G  +  +   D D+G NG + + + + +   +  F++ P  G + +A   +     R+    L ++A D G   +++ A++ +
Sbjct: 1514 PVFAVPEMELEVEENTGEGEVIFTLSATDAD--QGQNALVTYSVLSGSE------GAFVVDAASGVLRASRRLDREERASYLLTVRASDGT-HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWA----DGAFGLHPVTGALNVTRP---LDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSP---RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVT----GEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAP--RFPRREYE-AAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD--FRLDPVLGTLAVA---RPLDRERTASYELAVRARDGGGPARSDTASVRV 2042          

HSP 6 Score: 127.872 bits (320), Expect = 6.222e-30
Identity = 114/458 (24.89%), Postives = 203/458 (44.32%), Query Frame = 1
Query: 1129 TSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGA-ISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAH-----TMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYI 2475
            TS+ + + D ND PP+ +        +EN    + + +V   D D G NG    + +       + + F  +    K+ T    S DRE++  Y + ++  D+G+P + S  K ++ + D+NDN P F        ++EN P G+ V  V A D D   NG + Y +   +   F + ++ G + +++  DRE+   Y+  VTA D G  +     +V + + D  D  P F + DY F + E+         +  + A+  DL  N  V Y ++               + R    + + G  I     +DREE +  QL V A   G   ++   ++ + V D+N++APVF   S     V+++ +  +     +V+  D D G NG + + +   N  E   F I P+G++ + +     T +E+S        L + A D G  P ++  T+ +
Sbjct:  430 TSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREM-FRLDSLTGKVTTL--KSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVA---PGTLVGSVSASTLDL--NANVTYLIV-------------SGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYE---VSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEK--FGIFPDGQLYVRYELDRETREEYS--------LTVSAMDTGVEPLSSSVTVNV 850          

HSP 7 Score: 119.398 bits (298), Expect = 2.695e-27
Identity = 107/404 (26.49%), Postives = 175/404 (43.32%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVEN-NPIGST----VGQVRAMDLDSSNNGHIVYSILNSNDN------FAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDG-YPS--LSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL 2301
            V+I++ED ND+PPV ++     +V EN  +  ++ T+   D D+G+N +   S+    +        D    + +         DRE+ + Y + ++  D  +   ++  + S+ + D NDN+PRF      F V E+  P G T    +G V A D DS   G + Y++  S D+      F +  + G +      DRE    Y     A D G   L  +  + V + D ND  P  + D      E   ++     L +I ATD D G N  +++ +    P G                V  DG +SV   LDRE  S   L+V+  D   +P   LS+   + + + D+NDNAP F  P + +       +  +G  + TV+  D D G N  + ++L
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSE---GAFVVDAASGVLRAS----RRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSL--AAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEG-------------RFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL----APEDSPVGAVVATVQAVDPDSGRNSYVEYAL 1874          

HSP 8 Score: 107.842 bits (268), Expect = 8.713e-24
Identity = 100/360 (27.78%), Postives = 165/360 (45.83%), Query Frame = 1
Query: 1444 PAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI--SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNER--LEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM-KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLN 2505
            P MSS  +  I++ DVNDN P F        V EN   G  +  + A D D   N  + YS+L+ ++   +  +  G +++  + DRE+  SY   V A D       D+  + V ++D ND +P F +  Y F + E      K  R  +  + A D D G  G V Y L   +      +S        L  V+  GA++V   LDRE  +   L  +A D G   L+ T  + + VLD NDNAP      N+     V  +   G ++  +   D D+G+N  +  S I+S   E   F +  +G++ +A  + +E  +F +    L+++ SD  ++P   +++  +R    LT++N
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGT--HATDAR-LSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSE------DSDWADGAFGLHPVT--GALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSV---QNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFS-ISSGDPEGR-FAVGNDGQLSVARALDRERQSFYN----LVVRVSDRARHPPARLSSA-VRVSLILTDVN 1830          

HSP 9 Score: 93.2041 bits (230), Expect = 2.436e-19
Identity = 151/571 (26.44%), Postives = 238/571 (41.68%), Query Frame = 1
Query:  331 GDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFV------SFVFILIATDFGNQ---TGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSE-GDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNGRMNETSVDIAIE--DCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISV-------------YTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISI-YGEIQSKIKFDREKTDS-YEFVVTARDNGEPQLNDSMVVK---VKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKY 1935
            G L V+  LDRET  E +    +M   ++  + ++ + + + D+NDN P+F ++  V +  E   +G+      A D D+   G  TY   + Q             NF+        S+   I  SL +    DRE  +      SF F ++ATD G         TV V V DVNDN P++ K  Y+ ++ E  S    +L + A+D D+    NG + Y +++  E  K     F ++ +   +T   + G ++R     Y   ++ATD        S  +A++  D ND+PP  + +      LE+ +   +L T+   DED G +G                   D  +AI    T+   + DR   SV             Y + +   D G P  SS     +++ D NDN P F+       ++EN PIG+ V  V A D D+  NG + YSI        +F I    GEI +  + DRE T   +E  V A D   P       +K   V + D ND  P F       +      +     +  ++A+D D  +N  V+Y
Sbjct:  812 GQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQ------------VNFEL------DSETGRIA-SLRVF---DREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDE--GVNGALRYAINEGNEGGK-----FTVDASTGQIT---LLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSG-------------------DVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGL--RAAAGSVVGTLQASDPDEAENAAVRY 1329          

HSP 10 Score: 90.8929 bits (224), Expect = 1.391e-18
Identity = 84/300 (28.00%), Postives = 124/300 (41.33%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKM-FHVVENNPIGSTVGQVRAMDLDSSNNG--HIVYSILNSNDNFAI--------SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAP----VFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            + + DVNDNAP F     M     E+  +G  V    A+D D   NG  H  Y I++ N+   +          +  + +    DRE   SY   V A D G P+    + V V +QD ND  P FEK        +Y  S+  +    + A  +DL   G          P+ +P + K              G +S    LD E      L ++A D G P LS   T +I++LD+NDN P    V+L P+     V+ S        + TV   D     NG ++ S++  N+R +F
Sbjct:   11 VVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEK-------PAYRASVAED--SPVGAALRDLLHRGR--------GPLAVPFDPKT-------------GMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDAD-SPTANGELSVSIVGGNERGHF 279          

HSP 11 Score: 81.2629 bits (199), Expect = 1.059e-15
Identity = 99/419 (23.63%), Postives = 161/419 (38.42%), Query Frame = 1
Query: 1129 TSVDIAIEDCNDHPP------VISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFE-----CSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYG--ESIKNERLEQ-IKATDKD-LGQNGTVKYRLID--------VKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYP-SLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSN 2313
            T V + + D ND+ P      V+ +A  F +     +Q ++ T V   D D G NG+        S N+ G+L          F ++   T P    DRE    Y + ++  D G+P      + ++ + D NDN P F        V E++P+G+ +      DL     G +                G + ++   D E    Y   + A D G P L+      +++ D+ND  P     Y      S    ES     +   +  TD D    NG +   ++         +   G+PG   LK                V   LDRE I    L + A D+G P + S T ++++ V D+ND+AP F   +        +     G  +  V   D D G+N  + +S+++ N
Sbjct:    7 TEVRVVVGDVNDNAPSFPEPGVMEVA--FKEDAAVGRQVLLDTAV---DRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAF-LHLATTGP---LDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----RDLLHRGRGPLAVPFDPKT--------GMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLK----------------VASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGA---PAGSYVKDVTAMDADSGLNAKLRYSIVSGN 384          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 175.252 bits (443), Expect = 5.809e-45
Identity = 201/736 (27.31%), Postives = 312/736 (42.39%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVS---QIFYINGNKLHLTNNRISGLINRNN---IRIYITATDGNGRMNET--------------SVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL-NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI-LNSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYF-FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIG-------KKSHSSDNNNFGFRLKNDNK 2580
            F      +++ EN P G  +P+  A D DS   GV+ Y +           + +       F++   ++   E  P L + K++DREE   +   L A D G+   +GS  + + VTD NDN+P + +    V I E    G  +++L A+DRD     N  V Y+L   T          ++F ++ N   +T   ++GL+NR      RI I ATD                      S  I I D      +++  N    + E     + +  + V D D G NG   C + N      LK + + + + +   ET      D E  + Y V+IK  D G  ++S     +I ++D NDNAP F        V ENN IG  +  V A D D   N  +VY +  ++   F +    G I    + DREK  +Y F + A+D G P L  +  V V + D+ND  P F    F F + E+     K+  +  +   D D G+NG V+              S L  + R L  +  + G I      DRE+     L VQA D G P  S+T  ++I V+D+NDN+P+ L P +N  +  V      G  +  V   D D  IN  + + ++  N   N  F I P  G I +   + E  +      RL+++ SD+G   +++   L   +++  T  N T I        +    +D   FG R + DNK
Sbjct:  153 FAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYEL-----------LPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRD--AGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVT---VNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRD------IVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRET-----LDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVP---KHSTVGMVTVADSDEGENGRVRL-------------SILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPH-NL-FHIDPVIGNITLMEPLTETHHGLH---RLVVRVSDIGIAVQHHAVALVHVFVNE-TLENATYIEWLIAGSLQTPLDTDVAGFGRREQEDNK 839          

HSP 2 Score: 95.9005 bits (237), Expect = 2.783e-20
Identity = 113/430 (26.28%), Postives = 181/430 (42.09%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGM--FECSLNDSGKLNLKNIRFDDNFAIYKIE-TYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY-----------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDY------FFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEII 2361
            V I +ED ND+ P  +       V EN             D D   NG+  +E   +D   ++   +   +     K+       S DRE+  +Y + ++ VD G+P  S      IN+ D NDN+P F        + EN+P+G+ V Q+ A D D+ +N  +VY +  S                    G +      +RE++  Y  ++ A D G   +  +  V V + D+ND +P  E +D          I+E+   S  N  +  I  +D D+G NG V   +          N ++  +L+ L   +    +     LD E  +   + ++A D G  SLS T ++ I++LD NDNAPVF  P+  ++    +V   IGK + TV   D D   N  + + L          F + PE  II
Sbjct:  139 VRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEA---SHVNLPVALITVSDPDIGANGAVTCYIY---------NPEVPFQLKKLTYPN-QYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNV---IGKHLITVSATDRDMDKNAEMVYFL---GPDAPTMFHMDPETGII 549          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.088 bits (427), Expect = 5.364e-43
Identity = 207/815 (25.40%), Postives = 339/815 (41.60%), Query Frame = 1
Query:  190 FSVDENCRIGHVVGNVYSKLNQL-----PNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXX-------------XXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGID-QENQVKTIGNNFQFFQIKNPKSKQEEI--YPSLEIIKNIDREEFVSFVFILIATDFGNQ--TGSCXXXXXXXXXXXXAPEWTKDNYK-VNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQI-FYINGNKLHLTNNRISGLINRNNI---RIYITATDGNGRMNETSVDIAIE--DCNDHPPVISIANRFG--------KVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNK------IKMFHVV--ENNPIGSTVGQVRAMDLDSSNNGHIVYSI--LNSNDN----FAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-------DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLI-DVKP--IGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTI-CTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLG 2439
            + VDE   +G+V+G++    N L     P +   S +  +   S   +N  SG+L V   LDRE +C    + C    ++     A     + +                   P F+     ++I E+  +G   PLP A D D+    ++ Y I+   G   Q      + ++               +     LE+ + +DRE   S+  +L   D GN   +GS  +T++V D NDNAP +     + V I E    G  +++L A D D     NG ++Y     T+   + +Q   +++G    L   R +  ++R  +   R+ + A DG       SV + +E  D ND+ PV  +    G        K++EN      +  + V D D G +G  +  L       L +     N   + ++T      D E+   Y V +   D+G P +S +    I+++D+NDN P F+N       + ++ V   EN P G+ V  + A D DS  NG I +++  L   ++    F++++  G++      DREK   YE  V A D G PQ     +V+V + D ND  P F          Y F + E   E+     +  +  +D D G N  V   L+ +  P  IG  G++               G +     LDRE+    +L V+A D G P+LS +  + I V D NDNAPV   P+ N  + +V      G  +  +V   D+D G NG   + +I  N +  F       G + +A T+           RL+++  D G
Sbjct:   31 YEVDEEVLVGYVIGDLRQS-NLLCVCFFPPAPHVSPLPLHTP-SLCIVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPD--AGPNGAIAYSF--HTKLTSLATQAALHVDGTT-GLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELAS----PNKVQFLLKTT--RLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEE---ETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTP-------------GGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNAD-SGALSLARTVSSLDEGLH---RLVVRVRDRG 812          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 5.574e-36
Identity = 131/473 (27.70%), Postives = 202/473 (42.71%), Query Frame = 1
Query: 1012 FYINGNKLHLTNNRISGLI---------NRNNIRIYITATDGN---GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL---NSNDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTM 2376
            + + G   H + N  +G I          R +  + +TA DG    G  +  ++ +A+ D NDH P    A        +      +  V  +D D G NG    SL+ S          D    +  I         R+ +   T+ ++  D G P  S++   ++   D  +  PRF    + F   E+ P G+T+  V A    S   G + Y +    N  D FA+    GE+      D E    YE VV ARD+G P  +  + ++V + DIND  P F    F+       E+     +  + A DKD G NG V Y +ID       GN      + N+ +V+ + G I     LDRE ++S +L V+A D G P+   T  ++I V D NDN+P F      +   +V  +  +G  +  V T D D+G N  IT SL++     + PF I P  GEI ++  +
Sbjct:   63 YRLRGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFS---VDPRRGV--IHAARALQGPRDDL---TLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARS--SRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVP---ENTPPRTIVVLTAVDKDSGINGQVDYSIID-------GN------IGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF----TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD----PSLPFSIHPSTGEITVSRRL 500          

HSP 2 Score: 123.635 bits (309), Expect = 1.402e-28
Identity = 122/452 (26.99%), Postives = 191/452 (42.26%), Query Frame = 1
Query: 1108 GNGRMNET-SVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQG-NPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS-NDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE---KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQP-EGEIIIAHTMKEFSNFRSLPDRLIIKASDLG 2439
            G  R+  T +V + +ED ND+ P    A     V E+      +  V   D D G N +       S +L   +  F  N +  +I T    S DRE    Y +E+  +D G  P +SS     + + DVND+ PRF+N   + +   + P G+ V  V A D D+  NG + +S+  S +  F++     +    +  +   D     V   D G P  +    V V+ +D  +  P F    + + FR  +  G +I        +       + G V Y L                 L ++  V    G +SV+  LD E     +L+V+A D G+P  S    + ++VLD+NDNAP F    ++  F     E    +TI  +   D D GING + +S+I+ N      F++ P  GEI    T+    N  S    L +KA+D G
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAII------SYRLRGGDGHFSVNPSTGQIIT--TASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSSR-------RAGPVSYHLAS------------GGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEF----SSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNV--FRVNPNSGEIRSVSTLDR-ENVASY--ELTVKATDRG 416          

HSP 3 Score: 123.635 bits (309), Expect = 1.462e-28
Identity = 157/639 (24.57%), Postives = 264/639 (41.31%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXX--XXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNGRMNETSVD--IAIEDCNDHPPVISIANRFGKVL-----ENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI-YGEIQS--KIKF-DREKTDS------YEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIK-NERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            F    +  + +E+ P GTT  + V   + S + G  +Y++A            + GN    F + +P+S +  ++      + +D E    +  ++ A D G    S  + + V  ++  DNAPE++   +   + E      I+ L A D+D  +  NG V Y + D       +  +F +N N   +   R    ++R N+  Y   + ATD        +V   I++ D ND+ P      RF ++      E+      +  V   D D+G N     SL D       ++ F  + +  +I        +RE  S Y V+++  D   PA +     +I + DVNDNAPRF          E +   + V +V A D D   NG + + + +  +NF +    GEI S   +++ D     S      Y FVVTA D G P L+    V + I   N   P F ++   R +     +++   R+  + A D D   NG + Y ++        GN+  +        V   G + +  +L  +  S   + V+A D G P LS+  T II V + N  AP F  P   ++          G ++  V   D D G+NG I +S+ + +    F
Sbjct:  232 FAPGPRSFSFREDQPPGTT--ITVVAARSSRRAGPVSYHLA------------SGGNLGDVFAV-DPQSGEVSVH------RALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKD--SGINGQVDYSIIDGN-----IGNVFRVNPNSGEI---RSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSP------RFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD------PSLPFSIHPSTGEITV--SRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRE---RYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVG-------GNASRR------FDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPE---NHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLF 803          

HSP 4 Score: 113.62 bits (283), Expect = 1.633e-25
Identity = 136/563 (24.16%), Postives = 232/563 (41.21%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQL--NDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGIN-GTITHSLINSNKRENFPFKIQPEGEIIIAHTM-----KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYI 2475
            AP +     ++++ E    G  L  + A D D     NG + Y ++  + D   +  I   +G+ L      + G ++    ++Y   + A DG    +   + V I++ D ND+PP+++ ++ +  + EN      +  +   D D   N +   SL+D G+ +L     +    +   + +     D E    Y + ++  +  +    S  +  + I  VN+  PRFV +   F V E+ P+G+ VG V A D D+  +G + Y +   + +   S+    GEI    + DRE+  S    V A++ G  +    D ++V V I D ND  PVF    Y  R++E+   +     +  + A D D          LI        GN+      R     +  G I V   LDRE +    L V A D G P  + TT +++ + D+NDN P  L  S       V+     G T+  ++  D D   N G  T  L+ S+      F +   G +  A  +      EF         L +  +D G  P  +  TL++
Sbjct:  752 APRFAHPPLELSLPENHPAGSSLARVTATDTD--AGVNGAIVYSIA--SGDGSGLFDISRASGDVL------LVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDD-GEADL--FVLNQKTGVLTTQGF----LDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEA---ASVGTHVVGVSAHDFDSPPGWRTFSFLIQS------GNAG-----RAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSS-----AKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEF--------HLPVAIADAGSPPLTSTVTLHL 1269          

HSP 5 Score: 112.464 bits (280), Expect = 3.527e-25
Identity = 138/538 (25.65%), Postives = 229/538 (42.57%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDIL--ELIANDRDDPNTKNGLVSYQLSDRTEDRKI---VSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETS-----VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVK---------DEDKGRNGMFECSLNDSGKLNLKNIRFD-DNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAIS-IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSL--STTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM 2376
            AP + +  Y +   E  SEG+ L   + A+D DD    NG V + +  +TE+ ++     +I  +   +        SG  N N     +TA D  GR   +S     ++I + + N        A RF   L  +    +  TV+           D D+  NG    S+         + RFD D      +      S   +  S+++V ++  D+G P +SS     I++ + N  APRF +      + EN+P GS++ +V A D D+  NG IVYSI + + +  F IS   G++    + D E    Y   V A D G     +   V + + D+ND  P+    DY+  I E+   +     +  + A D D   N    Y L D       G + L       +     G ++  G LD E   + +L V+AF+  YP     +T  + +++  +N+  P F+      NFV VS    +G  + +V   D D GI+GT+ + L   ++ + F    +  GEII++  +
Sbjct:  536 APRFGQTAYYIEFPE-PSEGEALVARVSASDADD--GANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSG-ANLNKYSFVVTAMD-RGRPPLSSDATVTINIVVPNAN--------APRF---LRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNA----SRRFDVDAGGFLHLRA----SLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPEN---APSGTTVLVMDAVDADSPSNAVTMYSLDD-------GEADL------FVLNQKTGVLTTQGFLDYETKQTYELTVRAFN--YPDTFHYSTAQVHVQITGVNEYFPRFV--QREYNFV-VSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVN-EHTGEIIVSSQL 1027          

HSP 6 Score: 82.0333 bits (201), Expect = 6.755e-16
Identity = 80/277 (28.88%), Postives = 120/277 (43.32%), Query Frame = 1
Query: 1378 TSFDREKISVYTVEIKCVDQGNPAMSSMQKFSIN-------IIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL----NSNDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITE--SYGESIKNERLEQIKATDKDLGQN-GTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDN 2163
            +  DRE+ +  T+ +   + G     S++ F ++       I D ND  P F + +    V E   +G+ V  V A D DS   G   +S L    N+   F+I+ + G I      DRE    Y   V A D GEP    + VV V ++D+ND  P F      ++TE    G ++ N     ++A D DL  N G   ++L+   P             R    +S  G +     +DRE+     L V   D G P L++T T+ + VLD NDN
Sbjct: 1025 SQLDREREASATLRVIAKNAG-----SIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPP-GWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGP-FLLTSSAKVTENQPAGMTVLN-----LEAGDPDLPPNKGPYTFQLLGSDPA-----------WRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          

HSP 7 Score: 80.4925 bits (197), Expect = 2.298e-15
Identity = 71/249 (28.51%), Postives = 108/249 (43.37%), Query Frame = 1
Query: 1744 GEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDG-YPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSV-EWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPD-RLIIKASDLGQNPKNNIATLYIRY 2481
            GEP+L  +  V V ++D ND  P F      R        I ++ +  + ATD D G N  + YRL      G  G+  +      +I  +         +LDRE   S  L V A D G  P LS++ T+++ V D+ND+ P FL    N  +V  +      G  +  V  +D D G NG +  SL  S       F + P   +I  H  +     R   D  L ++ SD G  P++ + T+ +R+
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAEL-RAAVPEDAPIGSD-VALVNATDADAGLNAIISYRL-----RGGDGHFSVNPSTGQIITTA---------SLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFL----NAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAG---FSVDPRRGVI--HAARALQGPRD--DLTLTVRVSDGGAPPRSAVTTVTVRF 223          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.517 bits (371), Expect = 7.423e-36
Identity = 131/473 (27.70%), Postives = 202/473 (42.71%), Query Frame = 1
Query: 1012 FYINGNKLHLTNNRISGLI---------NRNNIRIYITATDGN---GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL---NSNDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTM 2376
            + + G   H + N  +G I          R +  + +TA DG    G  +  ++ +A+ D NDH P    A        +      +  V  +D D G NG    SL+ S          D    +  I         R+ +   T+ ++  D G P  S++   ++   D  +  PRF    + F   E+ P G+T+  V A    S   G + Y +    N  D FA+    GE+      D E    YE VV ARD+G P  +  + ++V + DIND  P F    F+       E+     +  + A DKD G NG V Y +ID       GN      + N+ +V+ + G I     LDRE ++S +L V+A D G P+   T  ++I V D NDN+P F      +   +V  +  +G  +  V T D D+G N  IT SL++     + PF I P  GEI ++  +
Sbjct:   63 YRLRGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFS---VDPRRGV--IHAARALQGPRDDL---TLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARS--SRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVP---ENTPPRTIVVLTAVDKDSGINGQVDYSIID-------GN------IGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF----TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD----PSLPFSIHPSTGEITVSRRL 500          

HSP 2 Score: 123.25 bits (308), Expect = 1.700e-28
Identity = 122/452 (26.99%), Postives = 191/452 (42.26%), Query Frame = 1
Query: 1108 GNGRMNET-SVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQG-NPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS-NDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE---KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQP-EGEIIIAHTMKEFSNFRSLPDRLIIKASDLG 2439
            G  R+  T +V + +ED ND+ P    A     V E+      +  V   D D G N +       S +L   +  F  N +  +I T    S DRE    Y +E+  +D G  P +SS     + + DVND+ PRF+N   + +   + P G+ V  V A D D+  NG + +S+  S +  F++     +    +  +   D     V   D G P  +    V V+ +D  +  P F    + + FR  +  G +I        +       + G V Y L                 L ++  V    G +SV+  LD E     +L+V+A D G+P  S    + ++VLD+NDNAP F    ++  F     E    +TI  +   D D GING + +S+I+ N      F++ P  GEI    T+    N  S    L +KA+D G
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAII------SYRLRGGDGHFSVNPSTGQIIT--TASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSSR-------RAGPVSYHLAS------------GGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEF----SSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNV--FRVNPNSGEIRSVSTLDR-ENVASY--ELTVKATDRG 416          

HSP 3 Score: 123.25 bits (308), Expect = 1.729e-28
Identity = 157/639 (24.57%), Postives = 264/639 (41.31%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXX--XXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNGRMNETSVD--IAIEDCNDHPPVISIANRFGKVL-----ENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI-YGEIQS--KIKF-DREKTDS------YEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIK-NERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            F    +  + +E+ P GTT  + V   + S + G  +Y++A            + GN    F + +P+S +  ++      + +D E    +  ++ A D G    S  + + V  ++  DNAPE++   +   + E      I+ L A D+D  +  NG V Y + D       +  +F +N N   +   R    ++R N+  Y   + ATD        +V   I++ D ND+ P      RF ++      E+      +  V   D D+G N     SL D       ++ F  + +  +I        +RE  S Y V+++  D   PA +     +I + DVNDNAPRF          E +   + V +V A D D   NG + + + +  +NF +    GEI S   +++ D     S      Y FVVTA D G P L+    V + I   N   P F ++   R +     +++   R+  + A D D   NG + Y ++        GN+  +        V   G + +  +L  +  S   + V+A D G P LS+  T II V + N  AP F  P   ++          G ++  V   D D G+NG I +S+ + +    F
Sbjct:  232 FAPGPRSFSFREDQPPGTT--ITVVAARSSRRAGPVSYHLA------------SGGNLGDVFAV-DPQSGEVSVH------RALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKD--SGINGQVDYSIIDGN-----IGNVFRVNPNSGEI---RSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSP------RFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD------PSLPFSIHPSTGEITV--SRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRE---RYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVG-------GNASRR------FDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPE---NHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLF 803          

HSP 4 Score: 113.235 bits (282), Expect = 2.306e-25
Identity = 136/563 (24.16%), Postives = 232/563 (41.21%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQL--NDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGIN-GTITHSLINSNKRENFPFKIQPEGEIIIAHTM-----KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYI 2475
            AP +     ++++ E    G  L  + A D D     NG + Y ++  + D   +  I   +G+ L      + G ++    ++Y   + A DG    +   + V I++ D ND+PP+++ ++ +  + EN      +  +   D D   N +   SL+D G+ +L     +    +   + +     D E    Y + ++  +  +    S  +  + I  VN+  PRFV +   F V E+ P+G+ VG V A D D+  +G + Y +   + +   S+    GEI    + DRE+  S    V A++ G  +    D ++V V I D ND  PVF    Y  R++E+   +     +  + A D D          LI        GN+      R     +  G I V   LDRE +    L V A D G P  + TT +++ + D+NDN P  L  S       V+     G T+  ++  D D   N G  T  L+ S+      F +   G +  A  +      EF         L +  +D G  P  +  TL++
Sbjct:  752 APRFAHPPLELSLPENHPAGSSLARVTATDTD--AGVNGAIVYSIA--SGDGSGLFDISRASGDVL------LVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDD-GEADL--FVLNQKTGVLTTQGF----LDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEA---ASVGTHVVGVSAHDFDSPPGWRTFSFLIQS------GNAG-----RAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSS-----AKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEF--------HLPVAIADAGSPPLTSTVTLHL 1269          

HSP 5 Score: 112.464 bits (280), Expect = 4.205e-25
Identity = 138/538 (25.65%), Postives = 229/538 (42.57%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDIL--ELIANDRDDPNTKNGLVSYQLSDRTEDRKI---VSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETS-----VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVK---------DEDKGRNGMFECSLNDSGKLNLKNIRFD-DNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAIS-IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSL--STTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM 2376
            AP + +  Y +   E  SEG+ L   + A+D DD    NG V + +  +TE+ ++     +I  +   +        SG  N N     +TA D  GR   +S     ++I + + N        A RF   L  +    +  TV+           D D+  NG    S+         + RFD D      +      S   +  S+++V ++  D+G P +SS     I++ + N  APRF +      + EN+P GS++ +V A D D+  NG IVYSI + + +  F IS   G++    + D E    Y   V A D G     +   V + + D+ND  P+    DY+  I E+   +     +  + A D D   N    Y L D       G + L       +     G ++  G LD E   + +L V+AF+  YP     +T  + +++  +N+  P F+      NFV VS    +G  + +V   D D GI+GT+ + L   ++ + F    +  GEII++  +
Sbjct:  536 APRFGQTAYYIEFPE-PSEGEALVARVSASDADD--GANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSG-ANLNKYSFVVTAMD-RGRPPLSSDATVTINIVVPNAN--------APRF---LRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNA----SRRFDVDAGGFLHLRA----SLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPEN---APSGTTVLVMDAVDADSPSNAVTMYSLDD-------GEADL------FVLNQKTGVLTTQGFLDYETKQTYELTVRAFN--YPDTFHYSTAQVHVQITGVNEYFPRFV--QREYNFV-VSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVN-EHTGEIIVSSQL 1027          

HSP 6 Score: 82.0333 bits (201), Expect = 7.530e-16
Identity = 80/275 (29.09%), Postives = 118/275 (42.91%), Query Frame = 1
Query: 1378 TSFDREKISVYTVEIKCVDQGNPAMSSMQKFSIN-------IIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL----NSNDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQN-GTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDN 2163
            +  DRE+ +  T+ +   + G     S++ F ++       I D ND  P F + +    V E   +G+ V  V A D DS   G   +S L    N+   F+I+ + G I      DRE    Y   V A D GEP    + VV V ++D+ND  P F      ++TE+    +    LE   A D DL  N G   ++L+   P             R    +S  G +     +DRE+     L V   D G P L++T T+ + VLD NDN
Sbjct: 1025 SQLDREREASATLRVIAKNAG-----SIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPP-GWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGP-FLLTSSAKVTENQPAGMTVLNLE---AGDPDLPPNKGPYTFQLLGSDPA-----------WRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          

HSP 7 Score: 80.1073 bits (196), Expect = 2.787e-15
Identity = 71/249 (28.51%), Postives = 108/249 (43.37%), Query Frame = 1
Query: 1744 GEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDG-YPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSV-EWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPD-RLIIKASDLGQNPKNNIATLYIRY 2481
            GEP+L  +  V V ++D ND  P F      R        I ++ +  + ATD D G N  + YRL      G  G+  +      +I  +         +LDRE   S  L V A D G  P LS++ T+++ V D+ND+ P FL    N  +V  +      G  +  V  +D D G NG +  SL  S       F + P   +I  H  +     R   D  L ++ SD G  P++ + T+ +R+
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAEL-RAAVPEDAPIGSD-VALVNATDADAGLNAIISYRL-----RGGDGHFSVNPSTGQIITTA---------SLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFL----NAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAG---FSVDPRRGVI--HAARALQGPRD--DLTLTVRVSDGGAPPRSAVTTVTVRF 223          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 182.185 bits (461), Expect = 2.469e-46
Identity = 174/566 (30.74%), Postives = 255/566 (45.05%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNGRMNETS--VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPD-----TSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVF---LFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIH 2487
            +P ++  NY   I E    G  ++ + A D D  +   G + Y+L         V   F I+ N   +   R+S  ++R     Y   + A DG      +S  V IA++D ND+ P+      F +V E+      +  V   D D   NG    +L+D             N  ++ I T        T  D EK + Y V +   D G P+ SS+    + + DVNDN P+F   +    V EN   G  V  V A D DS  NG I YSIL+ N+N A ++    GEI +++  DRE   SY   + A D    +   +  V + I D ND  P F     F I+E   +S    R+ Q+ ATD+D+G NG V Y +I     G  GNS  + + R+       G +SV   LDRE I S  L+V+A D G P  S T +I + VLD+NDNAP F   LF         +  +  +  T+  VK +D D+G NG IT SL +    +N  F I   G  +++ T  ++    +   +L + A D G   K+  A + I  I+
Sbjct:  475 SPVFSPSNYSKQIPESTVIGSTVVTVTATDLD--SGPRGRLEYRLISGN-----VKGAFNIDANSGSI---RVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVF-RVSESSSPGHQIGQVAATDADDSSNGDVRYALSD-------------NTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISE---DSPTGTRVGQLTATDRDIGPNGAVTYAIIS----GNQGNS-FQLDPRS-------GILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSG------EIREDASVHSTVLQVKVEDKDEGSNGAITLSL-SGEGSDN--FTIDSTG-FVLSKTPLDYETTAAY--QLTVTARDGGSPSKSATAQVKITIIN 989          

HSP 2 Score: 172.555 bits (436), Expect = 2.222e-43
Identity = 205/734 (27.93%), Postives = 330/734 (44.96%), Query Frame = 1
Query:  277 SLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQS-EGDILELIANDRDDPNTKNGLVSYQLSDRTEDR-KIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRF--VNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI-LNSNDNFAIS-IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPD-RLIIKASDLG 2439
            S++  NE +  F+++R +G++  +  LDRETI   +    +    L +   A  + I I D NDN P F T     NI E+ P GT      A D+D    G  TY I         NQ    GN+FQ     +P+S        L +   +DRE   S+  ++ A+D G+  Q+ + ++ V V DVNDNAP + K  +   I+E  S    +L++   D+D+ +  NG ++  LS    D   I S  F ++   L                ++ +TA DG    +     V I I + ND+ P      +   + E+      +  +   D D G    F+    ++G     + + D +  +  +        DRE  + YT+ ++  + G+   S     +I ++DVNDNAP F   +  K  H  EN PIG TV +V A D D   N  + Y + +     F ++   G + +K   DRE   SY   VTA D+G+P  +    + + I D+ND +P F +  Y   +TE+   +     + ++ A+D D G NG V Y +I        GN        N  ++ S  G I+V G +DRE ++S  L + A D G P   +T  + I V D NDN+P+F   ++N     +     IG  +  V   D D+G N  + +S++   + +   F I     ++   T+K+  N  ++P   L I+ASD G
Sbjct:  723 SILSGNE-NMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF-TGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISG------NQ----GNSFQL----DPRSGI------LSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGS--NGAITLSLSGEGSDNFTIDSTGFVLSKTPLDYETTAA--------YQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD-GTPLTFDIVEGNAG----SSFKIDQSSGLISVAKR----LDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLH--ENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTEN---TANGSNILRVLASDPDAGANGRVTYSIIS-------GNHG------NAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIF---ASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIV---RGDTSAFAINAMNGVL---TVKKEINRETVPTYTLTIRASDRG 1388          

HSP 3 Score: 159.458 bits (402), Expect = 2.092e-39
Identity = 147/502 (29.28%), Postives = 232/502 (46.22%), Query Frame = 1
Query:  844 PEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNK-LHLTNNRISGLI------NRNNIRIY---ITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILN-SNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGT-VKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVE-WEIGKTICTVKTKDLDQGINGTITHSL 2301
            P++ K  Y   + E  + G  +  + A D D  +  NG +SY +               ++GN+ +    +R +G I      +R  I  Y   I A DG+    M  T+V+I+I D ND+ P  +  +RF  + E+      +  +   D D G NG    ++    + N  + + D    I  + +    + DRE I  YT+ +K  D G+P  S      ++++DVNDNAPRF   +    + E+  + STV QV+  D D  +NG I  S+    +DNF I   G + SK   D E T +Y+  VTARD G P  + +  VK+ I ++ND  P F      ++T    +   N  + ++ ATD D    GT + + +++       GN+    ++         G ISV   LDRE  ++  L+V+A + G    S      I VLD+NDNAPVF    N  ++     E   IG+T+  V   D D+G N  +T+ L
Sbjct:  683 PQFAKSLYTCTVGENLAAGVAVCYVTATDAD--SGANGKISYSI---------------LSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRF-NISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGN--SFQLDPRSGILSVRS----TLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPA--QVTSIPEDVAINTHVVKLNATDSD----GTPLTFDIVE-------GNAGSSFKIDQ-----SSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVF----NPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL 1138          

HSP 4 Score: 154.451 bits (389), Expect = 8.255e-38
Identity = 138/514 (26.85%), Postives = 227/514 (44.16%), Query Frame = 1
Query: 1081 IRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNG--MFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI---SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYG--ESIK-NERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKT-ICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYI------------RYIHSLTNLNPTSIG-KKSHSSDNNNFG 2556
            +R   T + G    N  +  I + D ND+ PV +  +    + EN      +  V   D D+G N    +E S+ D+ K       F+ N A   + T      DRE  + Y++ +  +D G P+ S++   ++ I D+NDN+P+F        V EN   GS + +V A D D+  NG + YSI++ N   A    S  G I      DRE   SY   ++A+D+G P    +  V + + D ND +P+F  +       SYG  E +    R+  + ATD+D G N  V Y ++             + +       + +G ++V   ++RE + +  L ++A D G P +++   + + V D+NDN PVF    N+ +++    E     T + TV   D D G N  + +S+I+ N  +   FKI     +I+  T  +F         L + A+D     K N+    I             Y  S+   +PTS    K  +SD ++FG
Sbjct: 1069 VRATETGSQGESVYNNAT--IRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK-------FEVNPATGLVTT--KRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASN-----ETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIV-------------RGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVF----NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR--FKINSTSGVIMTTTPLDFEEKSQY--GLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFG 1545          

HSP 5 Score: 145.206 bits (365), Expect = 5.528e-35
Identity = 157/554 (28.34%), Postives = 244/554 (44.04%), Query Frame = 1
Query:  724 KNIDREEFVSFVFILIATDFGNQT--GSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLI---------NRNNIRIYITATDGNGRMNETSVD-IAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI---SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGA---ISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            +  DRE    +   ++A D  N+   G   V + V D NDNAPE+  ++Y  NI+E      +  + A DRD  +  N  ++Y L              +   NK  +  N  +G I          +++  + I+A DG    + T V  I ++D ND+ P  +++     V E+     I+  +   D D G N     SL  SG  +   +   D+  + + +     +FDRE  + Y V ++  D G+P+ S      I I+DVNDN P F +      V E+  IG+ +  V A D D+ NN  + YS  + N N A    ++ G +      D E+  SY   ++  D G P L D+  + + + DIND  PVF    Y  R+ E+           Q+ ATD+D   NG + + +I     G+                + DG+   IS+  + D E  +   L VQA D G P    T  + I + D+ND++PVF  PSN    +  S    IG T+ TV   DLD G  G + + LI+ N +  F
Sbjct:   26 RKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRD--SGTNAAITYSL--------------FSGENKFMM--NSKTGEIRTVTPLDHETKDSYTMRISAFDGK---HTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLV-SGDTSYFTV---DSQGVIRTKG----AFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT------QVSATDRDSSTNGALVFGIIKGNDDGV---------------FTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF-SPSNYSKQIPEST--VIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAF 526          

HSP 6 Score: 140.198 bits (352), Expect = 1.824e-33
Identity = 197/752 (26.20%), Postives = 339/752 (45.08%), Query Frame = 1
Query:  304 SYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEII---KNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGN-----KLHLTNNRIS--GLINRNNIRIY---ITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDN-FAIYKIETYPDT--SFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSND--NFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYI 2484
            S F ++++SG + V   LDRET    T    + +     ++      I + D+NDN PVF       ++ EN+PIG T     A D+D  +    TY ++             +G+  +F           E+ P+  ++   + +DRE+  S+   + A D G  +Q+    +T+ + D+NDN+P++++  Y + + E  + G +IL ++A+D D     NG V+Y +               I+GN     ++  T  RI+  G+++R  +  Y   I+A D      ++   V I + D ND+ P+ +       + E       +  V   D D+G N     S+          +R D + FAI  +          +RE +  YT+ I+  D+G+P M+S ++ ++ + DVNDN P F ++  +  V EN+   ++V  V A D D   N  + YSI++ ND   F I S  G I +    D E+   Y   VTA D+   +      V +++ ++ND TP F +++Y   + E+   S  +  + ++ A+D+D    G++ Y +     +G   + K   + R+       G IS    LDRE +S   + V+  D G P LS  T + I++LD NDN+P F   S + + +  S        +      D D+G N  IT++L       N  F I     +I      +  N +S  D L I+A D G  P+ +  T+ +  I
Sbjct: 1040 SSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELS-------------VGDTSKF-----------EVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPD--AGANGRVTYSI---------------ISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSI----------VRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVREN---SPTSTSVVKVSASDRD--SFGSLSYSI-----VGGKDSDKFSIDQRS-------GIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAAT---DADEGTNARITYNL-----SRNDAFMIGASSGVITLAQPLDREN-KSTYD-LAIQARDHGTPPQASSITIRVTVI 1710          

HSP 7 Score: 134.035 bits (336), Expect = 1.465e-31
Identity = 141/527 (26.76%), Postives = 233/527 (44.21%), Query Frame = 1
Query:  712 LEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLE----QIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLD 2268
            L + K I+RE   ++   + A+D G+   T    +TV+V DVNDN P +   +Y  +++E  ++   +  +A D  D    N ++ Y +    ++++     F IN     +          ++   + +TATD      +T+V I + + ND  P  +  N    V EN      +  V   D    R+     S +  G  +      D    I           DRE +S+Y ++++  D GNP +S++   +I I+D NDN+P+F +      ++EN+   S   ++ A D D   N  I Y+ L+ ND F I    G I      DRE   +Y+  + ARD+G P    S+ ++V + DIND  P+             G   +N+  E    +I A+D D G N  + + L             L  E +++  + +  G IS    LDRE+ +   L +   D G PSLS+   +II+V+D +DN P F     N   V +S     G +I  V  +D+D
Sbjct: 1364 LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVG-ANAVLRYSIISGNDEKR-----FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSK-YTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASD----RDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADV----LDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYN-LSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSL------RGSVRENQPKETHVMRILASDADTGLNAELTFSL-------------LSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYN---VTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 180.644 bits (457), Expect = 7.662e-46
Identity = 152/480 (31.67%), Postives = 231/480 (48.12%), Query Frame = 1
Query: 1162 DHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT--SFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIYGEIQSKI----KFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIK-NERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVS-FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVE-WEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI-QPEGEIIIAHTMKEFSNFRSLPD-RLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGKKSHS---SDNNNFG 2556
            ++PP  S       V E+ +   ++ TV   D D G NGM   S++ S     +N+     F+I +I     T    DRE +  +   +K  D G P++      +IN++DVNDN P F   I    + E+  IG  V  VRA D DS +NG + Y ILNS+ DN A SI GE+   +    K DREK  +Y   V A+D G P  + ++ VK+ + D+NDCTP F K  +   + +  E +  N+ +  ++ATD D G NG V + ++        GN        N   ++  +G + V   LD E I    LLV A D G P L   TT+ I ++D+NDNAP F+    + +F  +  E + +G+    V+  D D G NG IT S +    + + PF I +  G I    ++KE  +   +P     IKA D G   K   A + I  +    N NP    ++ +    ++N+ +G
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPS-----QNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSI-GEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVY---SATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVS-------GNDM------NFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFV----SSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFM----QNDLPFSINENTGGI----SIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLD--INDNPPKFSQEEYHTSIAENSRWG 458          

HSP 2 Score: 169.088 bits (427), Expect = 2.731e-42
Identity = 145/526 (27.57%), Postives = 247/526 (46.96%), Query Frame = 1
Query:  844 PEWTKDNYKVNIQECQSEGDILELIANDRDDPNT-KNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGL----INRNNIRIYITATDGNGRMNETSVDIAIE--DCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFE-CSLNDSGKLNLKNIRFDDNFAIYKIETYPDT--SFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAIS-IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYF-FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLI-DVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM 2376
            P++++     ++ E    G ++  ++    DP++  NG++ Y +S       + +  F I+     +T  R  GL    ++R+  R+   A DG     E  +D+ I   D ND+ P+         + E++     +  V+  D D G NG  + C LN  G         +  F+I ++          DREK+  YT++++  DQGNP  S+     I ++DVND  P+F  K+    + E+ P+   V  VRA D D  +NG + + I++ ND   F+I+ I GE++ K K D E    +  +VTA+D G+P L +   V + + D+ND  P F   +F   I E+Y      +   +++A DKD G NG + +  + +  P  I  N+               G IS+   LDRE++      ++A D G P    T  I I +LD+NDN P F   S      +++     G ++  VK  D D G    + +S+++S+  +   F+I P+G I ++ T+
Sbjct:   18 PQFSRLQEDASVSEDAEVGTVVATVS--ASDPDSGSNGMIRYSMSP--SQNLMSATYFSIDQITGVITTKR--GLDREFLDRHFFRV--KAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGD--------NSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYA---VGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENT---------------GGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKF---SQEEYHTSIAENSRWGTSVLQVKAIDPDSGPT-NVVYSIVSSSGHDRC-FRINPQGLITLSCTL 504          

HSP 3 Score: 153.295 bits (386), Expect = 2.237e-37
Identity = 212/800 (26.50%), Postives = 344/800 (43.00%), Query Frame = 1
Query:  178 LNVEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDS-------YFSLNRTSGDLIVKSFLDRETI--------CENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDR--DDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTN-NRISGLINRNN---------IRIYITATDGNGRM--NETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN---FAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNER-----LEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD---GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPD-RLIIKASDLGQNP 2448
            L  + SV E+  +G VV  V +     P+S  + +++ +   S       YFS+++ +G +  K  LDRE +         E+  E  S++ Y+D   +         D+NDN P+F+      +I E+  IG       A D DS   G   Y I    G   +N   +IG                E+  ++ ++K +DRE+  ++   + A D GN  ++ + TV + + DVND  P+++K  Y   I+E   +  + +L+   R  D     NG V +++               ++GN ++  + NRI+G +               + +TA D       N+T+VDIA+ D ND+ P    ++    + EN         VQ  D+D G NG    S       N      ++N     I+       DREK+  +T  IK  D+G P      + +I ++D+NDN P+F  +     + EN+  G++V QV+A+D DS    ++VYSI++S+ +   F I+  G I      +      Y F V+A D     L+ + +V V + D N   P F++        SY   +K +      +  + ATD+D G N  + Y +  + P                 + S D   G I   G+LDRE++ + +  V A D G P L   + + I + D+NDN PVFL PS       V  +   G  +  V   D D G N  I +S   SN      F I     II   T+K      ++P+  L + A+D G  P
Sbjct:   23 LQEDASVSEDAEVGTVVATVSA---SDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEP-SLEGYMDLTINV-------LDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDG---DNSAFSIG----------------EVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIRE---DVPVNQLVTTVRATDCDQGSNGEVFFEI---------------VSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQ----NDLPFSINENTGGISIK----EELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPT-NVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKR-------RSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVP-----------------EFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYE---AKVREDIRPGGRVIEVSASDADIGKNAQIIYSFA-SNGDGQGTFTIDSTQGII--RTLKPLDR-ETIPEYELTVVATDQGTPP 731          

HSP 4 Score: 129.028 bits (323), Expect = 6.341e-30
Identity = 175/638 (27.43%), Postives = 263/638 (41.22%), Query Frame = 1
Query:  307 YFSLNRTSGDLIVKSFLDRETI-----CENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYI-TATDGNGRMNETS-VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN---FAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVF 2175
            +FS+NR +G++ VK  LD E I         ++     LY         I +  N        FQT      I EN  +G  +    A DKD    G  T                     F F Q   P S  E     + I + +DRE+   F F + A D G   + G+  +T+ + D+NDN P+++++ Y  +I E    G  +L++ A D D   T   +V   +S    DR      F IN   L      +S  +N N   +Y+ + +  +G ++ T+ V + + D N H P     +   +V E+      + TV   D D G N     S+       +     D+   + K       S DREK+  Y  E+   D G P + +     I+I DVNDN P F+       V E+   G  V +V A D D   N  I+YS  ++ D    F I S  G I++    DRE    YE  V A D G P    S+ VKV ++D+ D  P+FEK  Y   + E   ++     +  +KA  +DL     + Y ++        GNS    ++         GAI     LD E  S  +L V+A         T TT+++ + D+NDN PV 
Sbjct:  281 FFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTM-----IPENYAVGQEFYRVQAYDKDHGTNGEIT---------------------FSFMQNDLPFSINENT-GGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTN--VVYSIVSSSGHDR-----CFRINPQGLI----TLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATL----VPEFSVDETTGVIKTA----GSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPE---DTPPRSPVITVKAKSQDLSPETGMMYSIVR-------GNSPQVFDIN-----PNTGAIQTLMKLDYETQSEYRLTVRA---TLSPFFTETTVMVYLKDINDNTPVL 854          

HSP 5 Score: 116.316 bits (290), Expect = 4.628e-26
Identity = 177/707 (25.04%), Postives = 291/707 (41.16%), Query Frame = 1
Query:  271 RSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTI-GNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG-----NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATDGNGRMNETSVDIAIE--DCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYK---IETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNE-----RLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            +  ++ ++  +S FS+   SG + V   LDRE +   T +  +        +  + + I + D+ND  P F        I+E++P+        A D D              QG + E   + + GN+  FF I         I   + + + +D E    F  ++ A D G     NQT   TV + + DVNDNAP++   +++  I E  + G +   + A D+D  +  NG +++               F IN N   ++   I   ++R  +  +   I A D      E +  I I   D ND+PP  S       + EN +    +  V+  D D G   +    ++ SG         D  F I     I      +++ + + V++V        +  +SS     +N+ D N +AP F  +     V E+  +G++V  V A D D+ +N  I YSI      F++    G I++    DREK D+Y F VTA D+G PQL     V + I D+ND  PVF K        SY   ++ +     R+ ++ A+D D+G+N  + Y           G      +       S  G I     LDRE I   +L V A D G P    +  + + + D+ D+ P+F  P   +  V V  +      + TVK K  D      + +S++  N  + F
Sbjct:  164 KYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCD--------------QGSNGEVFFEIVSGNDMNFFSIN-------RINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQT---TVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKD--HGTNGEITFSFMQN-------DLPFSINENTGGIS---IKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGH--------DRCFRINPQGLITLSCTLNYNTKHVYVFSVS-----ASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLK-------PSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFAS----NGDGQGTFTID-------STQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKP---LYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVF 800          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 160.614 bits (405), Expect = 1.115e-39
Identity = 141/495 (28.48%), Postives = 211/495 (42.63%), Query Frame = 1
Query: 1075 NNIRIY---ITATDGNG--RMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLN---DSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGY-PSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSL----PDRLIIK--ASDLGQNPKNNIATLYIRYIHSLTNLNPT 2511
            N+ R Y   + A DG    R +   +++ + D ND+ PV    +    VLE       +  V   D D G NG    + +   D+ K  L+N            + +  +  DRE I  Y +++  +D G P  SS     + + DVNDN P F      F V EN P+ + +G V A D D  +NGH+ Y        F +    G+I +    DRE   SY F + A D G     D   V V ++D+NDC+P F K+  + +T +    + +  L  I   D   G N  + Y ++          +  KA   N +     G +++   LDRE      L V A D G   SL T T I I VLD+NDN PVF+   N   F  V  +  IG  +  V   D DQG NG + + ++N N           +G   I  T    S  R+L     +R +++  A+D+G+  +     L   Y+    +  PT
Sbjct:  873 NSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRN----------GGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNK-YSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIV----------AGPKAFSLNQVT----GVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFI---NETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNT----------DGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPT 1329          

HSP 2 Score: 148.673 bits (374), Expect = 6.260e-36
Identity = 150/540 (27.78%), Postives = 250/540 (46.30%), Query Frame = 1
Query:  724 KNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGR--MNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNF--------AISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRL---IDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWE-IGKTICTVKTKDLDQGINGTITH 2295
            + +D E   S+ F + ATD G ++ + TV V +TD+NDN P +   +Y V   E    G  I +L A DRD P  K  +  + +     D     ++F ++G+ L +T  ++     ++N  + + A DG G+  +N+  V+I + D ND PP+ S A     + E+ +   ++  V     DKG N     S++   K N  NI   ++        Y  +  D EKI    + ++  D+G P +      +I +ID+NDN+P+F +   +  + E+ PIG T   V   D DS   G + +S+L++            A+S+     +K+        SY   V A+D G P  + + ++++K+ D+ND +PVF    Y   + E+   +  +  + ++ ATD D G+NG + Y     +D    G          LRN       G I +   LDRE+I    L V A D G P  S++  + + V D+NDN P F       ++     E E +   +  V   D D+G NG +T+
Sbjct:  557 RTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSP--KFAITRFIIEQGNAD-----EVFSVDGSGL-ITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSIS---KGNTDNIVLINSTGTL----YLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSL-----TKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLET---TPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFG----------LRN------GGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHF----QQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTY 1053          

HSP 3 Score: 132.109 bits (331), Expect = 6.900e-31
Identity = 190/699 (27.18%), Postives = 305/699 (43.63%), Query Frame = 1
Query:  304 SYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLI-----------NRNNIRIYITATDGNGRMNE-TSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT--SFDREKISVYTVEIKCVDQGNPAM-SSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI--LNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNG---EPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            S F L R  G + +KS LDRE I E   +  ++     + + +  + + ++D+NDN P FQ       ++EN P+ T      A D D    G  TY          + QV       QF        KQ     + +++   DRE   S+VF ++ATD G+  +     VTV+V DVND +P+++K+ Y V + E    G  +L LIA D DD    N  ++Y +               + G K   + N+++G++           +R+ + +  +   GN  +   T ++I + D ND+ PV      F  V E      ++  V   D D+G NG          +  + N   D  F I +      T  + D E  + Y + +   D G     +S Q  +I + D NDN P F     +  + EN PI + V  ++A D DS  N  I Y+I   +   +F I S  G IQ+    DRE+   Y   V A D     + +L ++  +K+ IQD+ND  P F       + E   +   N ++  I A D D GQ G V+YR++       P   K   +L+        G + + G+LD E++    L + A D G P L++     + V+D+NDN P F   + ++    VS     G ++  V   D D G N  +T+S+ +  + + F
Sbjct:  958 SKFGL-RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRF--------DTQVA------QFI-----VDKQTGKITTSQVL---DREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATD-DDQQGPNSDITYMI---------------VAGPKA-FSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKV--------RYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVME---DEPFNFQVTSITALDPDTGQGGNVEYRIVS------PDTGKFSLDLKT-------GVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEF---TRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKF 1589          

HSP 4 Score: 123.635 bits (309), Expect = 2.783e-28
Identity = 152/559 (27.19%), Postives = 249/559 (44.54%), Query Frame = 1
Query:  727 NIDREEFVSFVFILIATDFGNQTGS--CXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQ-LSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFA-ISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISV-----YGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKT-ICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIII 2364
            ++DRE+    V  ++  D G+   S  C+V V +TD NDN P + + +Y  ++ E    G  +++L+A D D    +N L+ Y  L+  T         F+++  K  +TN+R      +++    + ATDG GR    +V +++ D ND+ PV   ++   +  EN +    +  ++  D D  +  +    +       + ++       + K+        DRE    Y + +K VD G     +    +I ++DVND  P F      F + E++   S +G V A+  D   N  +VYSI   N DN   I+  G +  + + D EK  S    V A+D G P L     V + + DIND +P F       R+ E   ++        +   D D G  G V + L     +  PG       L NL   S  GA+S+     YGN  R    S  L VQA D G P  S+T  + ++V+D+ND +PVF     N ++    +E     + I  V   D+D G NG I+++    +K +   F ++  G+I I
Sbjct:  455 DLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPD--IGENSLILYSILTPNTP--------FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKL-------LDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPE---DTPIGHTFYTVSVFDADSGVLGRVSFSL-----LSNPGT------LFNLD--SNTGALSLTKLIDYGNSAR----SYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVF----GNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAF--DSKVDTSKFGLRNGGKIFI 970          

HSP 5 Score: 122.865 bits (307), Expect = 4.360e-28
Identity = 149/525 (28.38%), Postives = 227/525 (43.24%), Query Frame = 1
Query:  985 EDRKIVSQIFYI---NGNKLHLTNNRISGLI------NRNNIRIY---ITATDG----NGRM-NETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL--NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS--NDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAH-----TMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIR 2478
            +D  + S+I+Y       + H   N  +GLI      +R  I  Y   + ATD       R+ N  ++ I I+D ND+ P   ++     V+E++     +T++   D D G+ G  E  +   D+GK +L     D    + K+      S D E +  YT+ I   D G+P ++S Q F++ ++DVNDN P F   + +  V EN P G++V +V A D DS +N  + YSI +    D F+I  + G I +    DREK D+Y   V A     P    S  V++ + D ND  P F       +T    E+     +  +   D D G N  V Y ++     G     +   EL    K            LDRE  +S QL VQA D   P  +    I I + D NDN PVF     ++    +S     G +I  +   D D G NG I ++L N        + I     I+ +      ++K+  NF  +       A D GQ+PK  I  + I+
Sbjct: 1357 DDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKF-VSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSL-----DLKTGVLKLIG----SLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPV---VTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTK------------LDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVF---QQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGV---YSIDSRTGIVYSAARFETSIKQEYNFFCI-------AKDQGQDPKMAIVPVRIK 1843          

HSP 6 Score: 115.161 bits (287), Expect = 9.587e-26
Identity = 102/343 (29.74%), Postives = 156/343 (45.48%), Query Frame = 1
Query: 1387 DREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI----SIYGEIQSKIKFDREKTDSYEFVVTARDNGEP-QLNDSMVVKVKIQDINDCTPVFEKDYF----FRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWE---IGKTICTVKTKDLDQGINGTITHSLINSNKRENF--PFKIQPEGEIIIAHT 2373
            DRE++  Y + I   D GNPA     + SI + D NDN P F N      + EN  +G+++ QV A D D   N  I YSI   +D  AI       G I + ++ D E   SY  VV A D G   QL+ S +V++++ D+ND  PV    Y     +++TE+   +    ++ ++  +D D G+NG V   L      G  G   +K ++ N      +  I+V  +LDRE      L     D G P  +T  +  I V D+ND AP F     + +     V WE   +   +  V   D D G N  + +++ N+ +  ++   F I P   +I   T
Sbjct:  131 DRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTEN---ATIGTQVARVSVSDADSGKNGEVNVTL-----EGGDGYFSMKFDVLN-----DESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKF-----DRHTYETRV-WENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTAT 454          

HSP 7 Score: 112.464 bits (280), Expect = 6.117e-25
Identity = 125/493 (25.35%), Postives = 206/493 (41.78%), Query Frame = 1
Query:  844 PEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYING-NKLHLTNNRISGLINRNNIRIYITATDG-NGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDED--KGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIET-----YPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKM-FHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI-----YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQ 2271
            P + +  Y   I E    G  IL L A+D+D  +  NG + Y LS+ T        ++ I+    +  +  R    I +      I    G + +M    V I IED N+H P  +       +  N     ++T V   D D  K  NG     L+DS     KN     + +++ +E+          F       + + I   D G+P +       I I ++ D+ PRF+N+      + EN+ +GS +  VRA    +S++  + YSI++ N   A  +        + S    D E T ++   + A   G   LN  M++ + + D ND +P F   +   ++ E  G + K   + ++ ATD D G NG V Y +      G+                S  G I+    LDRE  +S  L+++  D G P  ST   + + V DLNDN P+F    + ++ VN+  +   G  + +V   D D+
Sbjct: 1748 PVFQQSLYSSTISELTPPGTSILNLTASDKD--SGSNGNIVYTLSNDTY------GVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDS-----KN-----STSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTG-AFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV------------FTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF----DPLSEVNIREDTRTGAVVTSVVATDTDK 2202          

HSP 8 Score: 111.309 bits (277), Expect = 1.717e-24
Identity = 193/719 (26.84%), Postives = 297/719 (41.31%), Query Frame = 1
Query:  277 SLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIR--IYITATD-GNGRMNETS-VDIAIEDCNDHPP-VISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGST--VGQVRAMDLDSSNNGHIVYSILNSNDN--FAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITES-----------YGESIKNERLE--------------QIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLD-REEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGIN-GTITHSLINSN 2313
            S+M  N  D  F++ R++G+L   + LDRET         +  +     T    I I I D NDN PVFQ +     I E  P GT+     A DKDS   G               N V T+ N+   + + +  S+   +Y +     +I +E    + F  IA D G   +     V + + D N++AP++TK  Y+V+I    S   ++ ++ A D D   + NG V+Y+L    +D K  + +F +  N   +  +  +G  N    R  +YI A D G+  +     V I I +  D PP  ++       + EN K    +TTV+ +     +      S N           + D F    I      + D E    + + +    QG  +++      IN+ID NDN+P F     +  + E+        V +V A D+DS  NG + YSI   N+   F I S  GEI +    DRE T S++ V+   D+G P  + +  VKV + D+ND  P+F+      I E              ++ K  RL               ++ ATD+D G N  +KY      PI        K +          G IS    +D R   S IQ+ VQA D G P       + I +       P F  PS    F  V     +G ++ TV+  D   G+  G I++++ NSN
Sbjct: 1683 SIMSGN-TDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNG---------------NIVYTLSND--TYGVYSIDSRTGIVYSAARFETSIKQE----YNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRL----DDSKNSTSLFVVESNTGSVRTS--AGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAF------YVDPFTGV-ISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSF----PITNSDQIDYKIDADT-------GVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPS---YFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSN 2348          

HSP 9 Score: 105.145 bits (261), Expect = 1.241e-22
Identity = 109/403 (27.05%), Postives = 164/403 (40.69%), Query Frame = 1
Query: 1117 RMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNG--MFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY-GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIK-NERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSN 2313
            R  E S  I + D ND  P         +V EN     ++  V   D+D G N   ++  +     +  L     D +  +    T      DRE+I    + +   D+G+P +S      +N+ D NDN P F        + EN+P GS V Q+ A D D   N  I+YSIL  N  F +    G + +    D E   SY F V A D G    N    V V + D+ND  PVF+   +   +  Y E+ +  + + Q+KA D+D  +    ++ +         GN+        +  V   G I++   LDRE   +  L V+A D G         + I VLD+ND  P+F     N      S    +   I  V     D+G N  + +S+   N
Sbjct:  369 RTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTAT----DLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCN--ATVHVSLTDLNDNQPVFDPSSY---SVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQ-------GNAD------EVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSV---IGHVHAISRDKGTNAEVVYSISKGN 746          

HSP 10 Score: 98.5969 bits (244), Expect = 1.032e-20
Identity = 75/277 (27.08%), Postives = 129/277 (46.57%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL---NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRF-VNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAISIY-GEIQSKIKFDREKTDSYEFVVT--ARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKY 1935
            V I + D ND  PV   +    +  E      I+  V   D+D G NG    ++   +D G   +     D    + + +     + D E I  + V ++  D+G+P M +    +I ++D+NDN P F V       V+EN P+ S + ++ A D DS  N  + ++++       F I  + G + + I FD E T  Y++ +T  A D G P L+ ++ + V + D ++  P F + DY F +    G +   + + Q+ ATD+D G  G V +
Sbjct: 2393 VYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAI-----DRKTGVIRTQ----RALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVP---GNAKIGDFVGQVTATDRDSGDQGRVFF 2657          

HSP 11 Score: 95.1301 bits (235), Expect = 1.325e-19
Identity = 130/545 (23.85%), Postives = 211/545 (38.72%), Query Frame = 1
Query:  904 ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRN-------------GMFECSLNDSGKLNLKNIRFDDNFAI-------YKIETYPDTSFDREKISV------YTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNN-GHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIK-NERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNP 2448
            ++++ A D D  +  NG V+Y +    E     + +F I+     +T  ++       +  + I  TD     +     V + + D ND+PP+    +    + E+ +   ++T+V   D DK                 +   S  D    +   I++  +F I       YKI+        R  I V        + ++ +DQG P   ++    I I       P+F        V EN  +G++V  VR  D  +    G I Y+I NSN        G I      D E    +  VV+A D+  P     + V + + D+ND  PVF +  +      + E I     +  + A DKD G NG V + +         G+ K    +         G I     LD E I +  + V+A D+G P + T  ++ I VLDLNDN PVF  P  N   V V     +   +  +   D D G N  ++ ++I    +    F I      +  +   ++ N       L IKA+D G  P
Sbjct: 2088 VVKVTATDVD--SGTNGKVTYSIWTGNE-----AGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEV-NIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKY--SFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYM---AQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQS-------GDDKGSFAIDRKT-----GVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPND--VQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQG--LFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPP 2599          

HSP 12 Score: 85.8853 bits (211), Expect = 9.474e-17
Identity = 105/379 (27.70%), Postives = 163/379 (43.01%), Query Frame = 1
Query: 1378 TSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN--DNFAI--------SIYGEI---QSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITES--YGESIKNERLEQIKATDKDLGQNGTVKYRL-IDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYP-SLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEII-IAHTMKEFSNFRSLPDRLIIKAS--DLGQNPK 2451
            T  DREK+S Y + I  V+   P  S      + + D+NDN+P FV       VV  N       ++ A+D D  +N    Y+I++ N  + F +         +Y ++    S I  DRE+ DSY   ++A D G P  +  + + + ++D ND  P F    Y   I E+   G SI      Q+ A+DKD+G N  ++Y +     P  I G       + N ++            LD E   S  ++V+A D G    LS++  + IEVLD+NDN PV            V+    IG  +  V   D D G NG +  +L   +   +  F +  +  II +  ++      R   D   +KA   D G  P+
Sbjct:   18 TVLDREKVSAYNLTI--VEFSTPPKS--YTVLVYVQDLNDNSPSFVRGTSAKLVVFEND-KDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSIL-----QVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVR------------LDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLD-----RETHDHFFLKAVCIDKGDPPR 369          

HSP 13 Score: 69.707 bits (169), Expect = 8.006e-12
Identity = 61/195 (31.28%), Postives = 86/195 (44.10%), Query Frame = 1
Query: 1084 RIYITATD-GNGRMN-ETSVDIAIEDCNDHPPVISIANRFG-KVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDT--SFDREKISVY--TVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN 1647
             + + ATD G+  M+ + SV I + D ND+PPV  +      +VLEN      L  +   D D G N     ++       L        F I K   +  T  +FD E  +VY  ++ IK  D GNP +SS     +N+ D ++  P F      F V  N  IG  VGQV A D DS + G + +   N   N
Sbjct: 2479 HVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGL--------FLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSN 2665          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 159.844 bits (403), Expect = 1.597e-39
Identity = 160/566 (28.27%), Postives = 253/566 (44.70%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNG--RMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNG--MFECSLNDSGKLNLKNIRFDDNFAIYKIET-----YPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSIL--NSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPD------RLIIKASDLGQNPKNNIATLYI 2475
            +P +T + Y  NI E    G  +L+L A D D+ +  NG VSY ++   +        F ++     +T  +       +++ I ITA D     +   T+V + I D ND+ P    ++  G + E       +  V   D D G NG   +E S +D+ ++N           ++++ T     +  +  DRE  S+Y+  +   D G+P + S  K  + I D+NDNAP F        ++EN P G  + QV A D D   N  I Y I+  N+N NF+I S  G I +    D E  + +  +++A+D G      + VV V + +  D  PVF  + Y F + E+     K   + ++ AT KD  +NG++ Y ++   P              NL  V S  G I + G++DREE +   L V A       LS   T+ IEVLD NDNAP F   S +   V++   W +G+ +      DLD G NG + + L ++            EG + I  T       R L D       + + ASD G  P+++  T++I
Sbjct:  422 SPAFTSNAYTANISELAQNGSYVLQLNATDPDEGD--NGTVSYSITGGND-----LGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDA-QVN----------GLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL-QVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVP---KGTLVGRVYATTKD--KNGSISYAIVSGDP-------------TNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQF---STSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSN-----------AEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHI 936          

HSP 2 Score: 158.303 bits (399), Expect = 4.565e-39
Identity = 207/753 (27.49%), Postives = 322/753 (42.76%), Query Frame = 1
Query:  310 FSLNRTSGDLIVKSFLDRETICENTKETCSMKL-YLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEII--KNIDREEFVSFVFILIATDFGNQT--GSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGN--GRMNETSVDIAIEDCNDHPPVISI----------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNL 2502
            F  N  +G +   + +DRET  +      S++L  L+     I + ++++DINDN P F T    + I+E++ + TT P+  A D D+   G   Y IA              G+N   F +            +L +I  K +DRE    +   + ATD G     G C + + + D ND+AP +T+++Y  +I E    G  IL + A DRD  +  NG + Y +     D    + IF ++ +   +   +      +N+    + A+DG    + +  +V I + D ND+ P + I          A R    L N     IL    V D+D   N   E  + +        + F      Y I+       DRE +  Y + +   D+G P+ S++    I++ DVNDN+P F +     ++ E    GS V Q+ A D D  +NG + YSI   ND     +    G + +    DRE+  S    +TA+D+G      S  V V I D ND  P F K   ++ T S G SI    L Q+ ATD D G NG + Y +           S   A++  L +++   G +     LDRE  S     V A D G P L ++  + + + D+NDNAPVF +P   + +    +E E    +  V   D D+G N  I++ +I  N   NF           +A    E   F S    LII A D G       A + +  ++   NL
Sbjct:   42 FGFNSNTGVISTTARIDRETTTQ-----ISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIAS-------------GDNTATFSLGTTACPTGS---TLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRD--SGSNGDIKYAID---WDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYIL----VTDKDSNTNSQTELKITNGDDEGCFKVEF---LGFYFIQL--QKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSS-YKGTISEGASIGATVL-QVSATDVDSGDNGRITYEI-----------SSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YP---VEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFS----LIISAKDGGNKYAAKTAVVNVTVLNKADNL 738          

HSP 3 Score: 154.836 bits (390), Expect = 6.060e-38
Identity = 125/408 (30.64%), Postives = 184/408 (45.10%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS----NDNFAISI-YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNE---RLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMN-FVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            V I + D ND+ P  +       + E  +    +  +   D D+G NG    S+     L    + F                 DRE++S  T+ I   D G+   +     ++ IID NDN PRF+       + E   IG+TV QV A D+DS +NG I Y I +S    N  F ++   G + +K + DRE    Y F V A+D+G+PQL  S+ V++ I DIND  PVF   +YF  I E       NE   +L Q+ ATD D G N  + Y +I        GN+       N    S  G IS   +LD E      L++ A D G    + T  + + VL+  DN PVFL+   N   + NV     +G+   T K K      NG+I++++++ +    F
Sbjct:  411 VLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTA------KPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIME-------NEPPGKLLQVTATDADEGTNAVISYDIIG-------GNNN-----GNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK------NGSISYAIVSGDPTNLF 787          

HSP 4 Score: 146.362 bits (368), Expect = 2.512e-35
Identity = 162/597 (27.14%), Postives = 258/597 (43.22%), Query Frame = 1
Query:  712 LEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXX-------APEWTKDNYKVNIQECQSEGDIL-ELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNK--LHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY-GEIQSKIKFDREK----TDSYEFVVTARD--NGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNP 2448
            ++I  ++DREE   ++  +IA     + G+         VN         AP+++  +  V+I      G ++    A D D    KNGLV YQL+   E       + +IN     + L      G  +     + + A+D       +++ I I    +HPP  ++++    VL +Q        V   D+D G+NG    S+    +  L  I       I K       S  +     Y + ++  D G P+ S+    +I I D ND+   FVN    F V EN+  G+ VG + A  LD S    IVYS+++S  +FA+ +  G+I ++++ DRE+    T S  +++ A    N      D  +V V + D+ND  PVF +  Y   ++E    S+    + +IKA D D G N    Y L+                +      S  G + +   LDRE  SS  L+V+A D    +L +T  I I V D ND  PV  FP ++   VN++ +  IG  +  +   D D G NG I +S+ N N    F  +    G +I+A ++ +F   +     L I A D G  P
Sbjct:  796 IKINGDMDREEKAQYLLAVIA-----RVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLD--AGKNGLVRYQLTSNAEG------LLWINSTSGVIKLARKLTDG--DETQYTVQVLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRK-------SLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSE---LSLPGSPVFRIKAMDADEGDNAKFFYSLVS------------GTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPV--FPESDYT-VNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVE-SATGRLIVAKSL-DFETTQLY--ELTITAQDHGLIP 1348          

HSP 5 Score: 140.969 bits (354), Expect = 1.102e-33
Identity = 190/737 (25.78%), Postives = 320/737 (43.42%), Query Frame = 1
Query:  190 FSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYI-ARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYI-NGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAI--EDCNDHPPVISIANRFG-KVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAI----YKIETYPDTSFDREKI------SVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN--DNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKV-SFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFV---NVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            F+V EN   G +VG VY+      N S S  + + +  + F ++ T G + +   +DRE   +      +    +   +    + IE+ D NDN P F T+  +++I     +G       A D D+ K G+  Y + +  +G+   N    +                      +++ + +   +   +   ++A+D G+     T+T+ +T   ++ P++T  +Y  ++   Q        ++A D+D  + KNG + Y +    E+      +F I  G KL++  + +  L  + +  + + ATDG       SV + I  +D NDH  +  + N F   V EN     ++ T+     D  R      SL          I  + +FA+     +I T      DRE++      +VY ++ + +              + + D+NDNAP F   +    V E +  GS V +++AMD D  +N    YS+++    D F I S  GE+      DRE T SY  VV A D     L  +  +++ + D ND  PVF E DY   ITE   +++    +  + A+DKD+GQNG +KY +          N  L A    +  V S  G + V  +LD E     +L + A D G   LS+T  + + VLD+NDNAP  LFP+  +      NV+  + +G+  CT    D D G N  I  S+ +    + F
Sbjct:  748 FTVYENVPKGTLVGRVYATTKD-KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGV----------------------IKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQD--SGKNGQLFYSIPQGNEE-----GLFGIFPGGKLYIRKSLLQAL--KGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLF-VNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSL----------ISSESHFAVDVRSGQITTR--VRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITE---DALIGSLVINLNASDKDIGQNGLIKYSI---------SNGNLAA----MFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP--LFPTQPVTLTVRENVNTGFPVGR--CTA--SDRDTGTNAHIAFSMYSQTPSKTF 1417          

HSP 6 Score: 128.642 bits (322), Expect = 5.726e-30
Identity = 126/445 (28.31%), Postives = 196/445 (44.04%), Query Frame = 1
Query: 1135 VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAI--YKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAI-----SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNE-RLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPE-GEIIIAHTMKEFSNFRSLPDRLIIKASDLGQ 2442
            V + + D ND+ PV S A     V E       +  ++  D D+G N  F  SL     +        D F I     E +   + DRE  S Y + +K  D  N  + S  K  I + D ND  P F       ++ E+  IGS V  + A D D   NG I YSI  SN N A      S  G +      D E T  YE  +TA+D+G   L+ ++ V V + D+ND  P+F       +T +  E++     + +  A+D+D G N  + + +    P      +    E+  +  +  +   ++    D     S QL+V A D G P LST  +I ++V D NDN+P F+ P       +++V         T+  +D D+  NG +T+S+I+ N   N  F + P  G++ + H + +         +L I+ASD GQ
Sbjct: 1145 VIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGM--------DKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSI--SNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQ---PVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLE---TMPAGRD-----SFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNV--------MTITAEDPDRNSNGKVTYSIISGN---NGYFNLHPSTGQLQMIHQIPDNPTIY----QLTIQASDGGQ 1553          

HSP 7 Score: 109.768 bits (273), Expect = 4.237e-24
Identity = 132/512 (25.78%), Postives = 217/512 (42.38%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGD-ILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGN--KLHLTNNRISGLINRNNIRIY---ITATDG-NGRMNETS-VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYG---EIQSKIKFDREKT----DSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEI-GKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            AP +++  Y + + E    G  +  + A D D+ +  N    Y L   T   K     F+IN +  +LHL     S  ++R     Y   + ATD  N  +  T+ ++I + D ND  PV   ++    + E+     ++  +   D+D G+NG+ + S+++    NL  + FD   A  ++      S D E   +Y + I   D G   +SS    ++N++DVNDNAP F  +     V EN   G  VG+  A D D+  N HI +S+ +   +   S+     EI +    D E      DS++ VV A D G P+L+    + V++ D ND +P F       ++     +  +  +  I A D D   NG V Y +I     G  G   L      L          ++   D   I   QL +QA D G PS  T T + +         P F    ++ ++     E ++ G ++ TV        +NG I + L + + +  F
Sbjct: 1156 APVFSRAVYAITVSELSLPGSPVFRIKAMDADEGD--NAKFFYSLVSGTGMDK-----FFINSSTGELHL-----SKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNG---NLAAM-FDVESATGRLIVA--KSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF-------VSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIIS----GNNGYFNLHPSTGQLQM--------IHQIPDNPTI--YQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTF----SSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGF 1624          

HSP 8 Score: 53.9138 bits (128), Expect = 4.101e-7
Identity = 130/531 (24.48%), Postives = 218/531 (41.05%), Query Frame = 1
Query:  277 SLMKANEKDSYFSLNRTSGDLIVKSFLDRET-----ICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFG--NQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGL----INRNNIRIYITATD-GNGRMN-ETSVDIAIEDCNDHPP--VISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL--NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY---GEIQSKIKFDREKTD-SYEFVVTARDNGEPQL-NDSMVVKVKIQDIN 1800
            SL+     D +F +N ++G+L +   LDRET     +     +  +  LY        +I I + D ND  PVF  +   +NI E+  IG+      A DKD  + G+  Y I+              GN    F +++   +       L + K++D E    +   + A D G    + +  VTV V DVNDNAP +      + ++E  + G  +    A+DRD     N  +++ +  +T      S+ F +N     +T      L      R++ ++ + ATD G+ +++   S+ + + D ND+ P  V   A   G  L        + T+  +D D+  NG    S+   ++G  NL          +  I   PD        ++Y + I+  D G P+  +    S+         P F +      V EN   G++V  V A    SS NG+I Y + + +      +    G +++    DRE    S+  VV A D   P     S  V + +QD+N
Sbjct: 1197 SLVSGTGMDKFF-INSSTGELHLSKTLDRETTSSYNLVVKATDASNANLY-----STAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISN-------------GNLAAMFDVESATGR-------LIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRD--TGTNAHIAFSMYSQTP-----SKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN-------VMTITAEDPDRNSNGKVTYSIISGNNGYFNLH----PSTGQLQMIHQIPDNP------TIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO25673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVT6])

HSP 1 Score: 143.665 bits (361), Expect = 2.320e-37
Identity = 119/372 (31.99%), Postives = 179/372 (48.12%), Query Frame = 1
Query: 1369 YPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILN-SNDNFAIS-IYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMV-VKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLI---DVKPIGIPGNSKL-KAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYP-SLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKI-QPEGEIIIAHTM--KEFSNFRSLPDRLIIKASDLGQNP 2448
            Y   +FDRE    Y++ +   D GNP+ SS     + + D NDN+P+F     +F + E+  +G+++G V A D D   N  + YSI++     F+++ + GEI    + DRE  + Y   VTA DNG    ND+ V V + + D+ND  P FE   Y   I+ES   + K   +  +KA DKD G NG VKY LI   D     I GN  +  AE+                 LDRE+ S+  L V+A D      L   T ++I V D+ND  P F   S      +VS    +G  + TV   D D+G NG + +SL         PF +   +G + ++ +M  ++ +N+      + + A+DLG  P
Sbjct:    6 YTTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPEKATFSMNPVTGEITVGQRLDREGVEHYLLNVTATDNGRLNTNDASVDVYINVLDVNDNAPQFEAAVYHGEISES---ADKLTPIVTVKAIDKDSGSNGIVKYSLISGNDGDAFTILGNGTIVNAEV-----------------LDREKKSTYNLEVRAVDQATSGGLEGVTRVVINVTDVNDQPPEFTSAS----VAHVSENSRVGDVVLTVIAVDADEGSNGDVVYSL---GLDIGAPFSLGSKDGVLRVSGSMDREKKANY-----SIRVTATDLGTPP 345          

HSP 2 Score: 110.538 bits (275), Expect = 3.872e-26
Identity = 114/364 (31.32%), Postives = 176/364 (48.35%), Query Frame = 1
Query:  733 DREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLI------NRNNIRIY---ITATDGNGRMN--ETSVDIAIE--DCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSL---NDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQG-NPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI-LNSNDNFAI-SIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLN 1761
            DRE    +   + A+D GN  ++ +C V V V D NDN+P++   +Y  +I E  + G  +              G VS   +D  E+ ++   I  ++  K   + N ++G I      +R  +  Y   +TATD NGR+N  + SVD+ I   D ND+ P    A   G++ E+  +   + TV+  D+D G NG+ + SL   ND     +       N  I   E       DREK S Y +E++ VDQ  +  +  + +  IN+ DVND  P F +   + HV EN+ +G  V  V A+D D  +NG +VYS+ L+    F++ S  G ++     DREK  +Y   VTA D G P L+
Sbjct:   12 DRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASI--------------GTVSASDADIGENARLTYSI--VSPEKATFSMNPVTGEITVGQRLDREGVEHYLLNVTATD-NGRLNTNDASVDVYINVLDVNDNAPQFEAAVYHGEISESADKLTPIVTVKAIDKDSGSNGIVKYSLISGNDGDAFTILG-----NGTIVNAEV-----LDREKKSTYNLEVRAVDQATSGGLEGVTRVVINVTDVNDQPPEFTSA-SVAHVSENSRVGDVVLTVIAVDADEGSNGDVVYSLGLDIGAPFSLGSKDGVLRVSGSMDREKKANYSIRVTATDLGTPPLS 347          

HSP 3 Score: 98.9821 bits (245), Expect = 3.863e-22
Identity = 102/357 (28.57%), Postives = 162/357 (45.38%), Query Frame = 1
Query: 1072 RNNIRIYITATD-GNGRMNETSVD-IAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQG--NPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYG--EIQSKIKFDREKTDSYEFVVTARDNG-EPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRL-IDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLS 2118
            +++  I +TA+D GN   + T V  + + D ND+ P     +    + E+      + TV   D D G N     S+     ++ +   F  N    +I        DRE +  Y + +   D G  N   +S+  + IN++DVNDNAP+F   +    + E+    + +  V+A+D DS +NG + YS+++ ND  A +I G   I +    DREK  +Y   V A D      L     V + + D+ND  P F       ++E+   S   + +  + A D D G NG V Y L +D   IG P +   K           DG + V G++DRE+ ++  + V A D G P LS
Sbjct:   16 KDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSI-----VSPEKATFSMNPVTGEITV--GQRLDREGVEHYLLNVTATDNGRLNTNDASVDVY-INVLDVNDNAPQFEAAVYHGEISESADKLTPIVTVKAIDKDSGSNGIVKYSLISGNDGDAFTILGNGTIVNAEVLDREKKSTYNLEVRAVDQATSGGLEGVTRVVINVTDVNDQPPEFTSASVAHVSEN---SRVGDVVLTVIAVDADEGSNGDVVYSLGLD---IGAPFSLGSK-----------DGVLRVSGSMDREKKANYSIRVTATDLGTPPLS 347          

HSP 4 Score: 87.4261 bits (215), Expect = 2.820e-18
Identity = 82/261 (31.42%), Postives = 124/261 (47.51%), Query Frame = 1
Query: 1666 GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEK-DYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLS-TTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTM-KEFSNFRSLPDRLIIKASDLG 2439
            G I +   FDRE  D Y   VTA D+G P  + + VV V + D ND +P F    Y F I E   ++     +  + A+D D+G+N  + Y ++          S  KA   ++  V+  G I+V   LDRE +    L V A D+G  + +  +  + I VLD+NDNAP F      +    +S   +    I TVK  D D G NG + +SLI+ N  +   F I   G I+ A  + +E  +  +L  R + +A+  G
Sbjct:    3 GRIYTTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAE---DAAVGASIGTVSASDADIGENARLTYSIV----------SPEKATF-SMNPVT--GEITVGQRLDREGVEHYLLNVTATDNGRLNTNDASVDVYINVLDVNDNAPQF---EAAVYHGEISESADKLTPIVTVKAIDKDSGSNGIVKYSLISGNDGD--AFTILGNGTIVNAEVLDREKKSTYNLEVRAVDQATSGG 242          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: PCDH17 (protocadherin-17 [Source:NCBI gene;Acc:101168002])

HSP 1 Score: 211.846 bits (538), Expect = 1.336e-55
Identity = 212/718 (29.53%), Postives = 330/718 (45.96%), Query Frame = 1
Query:  124 MLIELDILIIFSIKLVITLNVEFSVDENCRIGHVVGNV-----YSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICE-NTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDIL-ELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNN---IRIYITATD--GNGRMNETSVDIAIEDCNDHPPVIS-IANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRF-----DDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY---------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNER-------LEQIKATDKDLGQNGTVKY--------RLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEV 2145
            M + + I  +  +K +   N+ +SV E    G V+GN+     Y  + +   S+   L   N       ++  SG +  K  +DRET+C  N K   SM+++ + D     I I+I DINDN P F +    I+I EN   GT +PL +A D DS + G+KTY + R              +++  F +         IYP L + + +DRE+      +L A D G   ++GS  + V VTD NDN+P + K +Y + I E    G IL +L A D+D+    NG V Y  +    +R  +  +F I+ N   +   ++ G I+      I   + A D   N       + + ++D ND+ PVI+ ++ R G + E      ++  V+V D+D GRNG  +C +       L N+ F     +DNF  Y + T  D   DRE    Y V I   D G P++++ + F++ I+D NDNAPRF   + +  V ENN  G  +G + A D D   NG + YSIL S+    +S+Y         G I +   F+ E+T S+EF V A+D G P +  +  V+V I D+ND  PV        + ++    I   R       +  +KA D D G +G + Y         L ++ P+G                    G +     L  E    ++L+V+  D G P LS    +II+V
Sbjct:    1 MRLSVPIFFLLWVKALSLKNLNYSVPEEQGPGTVIGNIAKDAGYGTIERGKKSNFRVL--ENSAPHLVDVDPESGLIFTKQRIDRETLCRRNPKCQLSMEVFAN-DKEICMIKIDIQDINDNSPSFPSDHVNIDISENAAAGTRFPLTIAHDLDSGENGIKTYQVTR--------------DDYNTFSLDLKVRGDGTIYPELVVQRPLDREDQSHHTLLLTAIDGGEYPRSGSMQINVRVTDSNDNSPVFEKSSYVIEIPENLPPGKILIDLNATDQDE--GSNGQVVYSFTGYASER--IQDLFSIDPNTGVI---KVQGEIDFEENPIIEFDVQAKDLGPNPIPGHCKITVKVQDKNDNSPVITFVSVRQGAISEAAPPDSVIALVRVTDKDSGRNGQLQCRV-------LGNVPFRLQENNDNF--YTLLT--DRPLDRETRDEYNVTIVARDNGIPSLNNTRSFTVKILDENDNAPRFTKSLYVLQVPENNIPGEYLGSILAHDPDVGRNGTVTYSILPSHIG-DVSVYTYVSVNPTNGAIYASRSFNYEQTKSFEFKVQAKDGGSPHMESTSTVRVNILDVNDNLPVI----ILPLLQNDTAEIPVPRNVGIGYIVATVKAVDHDHGDSGHLTYEITEGNDDHLFEIDPVG--------------------GEVRTAHALWEEIAPVVELVVRVTDHGKPPLSAVAKLIIKV 658          

HSP 2 Score: 176.407 bits (446), Expect = 2.151e-44
Identity = 161/588 (27.38%), Postives = 275/588 (46.77%), Query Frame = 1
Query:  841 APEWTKDNYKVNIQECQSEGDILEL-IANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKL---HLTNNRISGLINRNNIRIYITATDGN--GRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNI-RFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAP--RFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS--------NDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVS-FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP--SNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQP-EGEIIIAHTM-KEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRY-IHSLTNLNPTSIGKKSH 2532
            +P +  D+  ++I E  + G    L IA+D D  + +NG+ +YQ++   +D    S    + G+      L   R     ++++  + +TA DG    R     +++ + D ND+ PV   ++   ++ EN     IL  +   D+D+G NG    S        ++++   D N  + K++       D E+  +   +++  D G   +    K ++ + D NDN+P   FV+ ++   + E  P  S +  VR  D DS  NG +   +L +        NDNF       + +    DRE  D Y   + ARDNG P LN++    VKI D ND  P F K  Y  ++ E+   +I  E L  I A D D+G+NGTV Y ++    IG          +   + V+  +GAI    + + E+  S +  VQA D G P + +T+T+ + +LD+NDN PV + P   N+   + V     IG  + TVK  D D G +G +T+ +   N  ++  F+I P  GE+  AH + +E +        L+++ +D G+ P + +A L I+    +      ++ G+K H
Sbjct:  120 SPSFPSDHVNIDISENAAAGTRFPLTIAHDLD--SGENGIKTYQVT--RDDYNTFSLDLKVRGDGTIYPELVVQRPLDREDQSHHTLLLTAIDGGEYPRSGSMQINVRVTDSNDNSPVFEKSSYVIEIPENLPPGKILIDLNATDQDEGSNGQVVYSFTGYASERIQDLFSIDPNTGVIKVQG----EIDFEENPIIEFDVQAKDLGPNPIPGHCKITVKVQDKNDNSPVITFVS-VRQGAISEAAPPDSVIALVRVTDKDSGRNGQLQCRVLGNVPFRLQENNDNFYT-----LLTDRPLDRETRDEYNVTIVARDNGIPSLNNTRSFTVKILDENDNAPRFTKSLYVLQVPEN---NIPGEYLGSILAHDPDVGRNGTVTYSILPSH-IG-------DVSVYTYVSVNPTNGAIYASRSFNYEQTKSFEFKVQAKDGGSPHMESTSTVRVNILDVNDNLPVIILPLLQNDTAEIPVPRNVGIGYIVATVKAVDHDHGDSGHLTYEITEGN--DDHLFEIDPVGGEVRTAHALWEEIAPVV----ELVVRVTDHGKPPLSAVAKLIIKVNTETAVGGGSSASGEKQH 676          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 210.305 bits (534), Expect = 2.909e-55
Identity = 200/696 (28.74%), Postives = 320/696 (45.98%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINR---NNIRIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTN 2499
            F +    ++I EN   GT + +PVA D+DS   GV  Y  A   G D            Q F ++  +   E+I P + +I N+DRE+  S+   +   D G   +  S  + + VTD NDNAP++ K+ Y+  + E    G  +L++ AND D     NG + Y L   ++    V ++  I+ +   +    + GL++R   N ++ Y+ A D   N + ++  V I+I+D ND+ P I I         N    + E+      +  VQV D D+G N +  C +       L+      N    K      T  D E+I  Y +EI  VD GNPA+SS     + + D+NDN P F   +   +  E+N  G  V  V A D DS  N  +VYSI+ S+   A S++      GEI+ + + DRE  + YEF V A D G P    + +V + ++D ND  P F    Y F + E+         +  +  +D D G+N  V   +        P N K        I  +  G I    + DRE+ S+    ++A D G P  S+   + I VLD NDNAP    P+N+ ++ ++         +  VK +D+D G+N  + +++   N    F       GEI +A   + F+       RL+++ SD G+ P++  A +++ Y++  TN
Sbjct:  151 FSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEY--ALSAGPDAN----------QLFGLQVAEDVDEKI-PQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDAD--TGANGDIDYSLHQASD---TVQRLLRIDRSTGII---YVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESS---AASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPL---NPVGVVTVSDADKGENSQVTLFV-------EPDNGK-------FIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANS-SYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQIS-HNSGEIKLA---QGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHV-YVNETTN 799          

HSP 2 Score: 130.954 bits (328), Expect = 2.532e-30
Identity = 117/410 (28.54%), Postives = 188/410 (45.85%), Query Frame = 1
Query: 1141 IAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLN---DSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY-----GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNER-----LEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            I + D ND+ P  S       + EN     + +     D D G NG+ E +L+   D+ +L    +  D +  I ++      + DREK   Y + I+ VD G P  +S     I + D NDNAP+F        + EN+P G +V QVRA D D+  NG I YS+  ++D     +      G I  K   DRE+ +  +F V ARD G    +    V + I+D ND  P  E +     I +++  +I  +      +  ++ +D+D G+N  V      V    +P   +  +E  N  K  +   +     LD E I   ++ + A D G P+LS+T ++ ++V D+NDN P F   S  +  VN + + + G  +  V   D D G+N  + +S+I S+    F
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVI--GNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTC----VVAGDVPFQLRPASESANDRKRKY--FLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSF---SPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLF 537          

HSP 3 Score: 119.398 bits (298), Expect = 8.032e-27
Identity = 97/334 (29.04%), Postives = 155/334 (46.41%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIYGEIQSKIK-------FDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNM----NFV-NVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIK 2424
            I ++D+NDN P+F + I    + EN   G+      A+D DS +NG   Y++    ++N  F + +  ++  KI         DREK DSY+  +   D G+P    S ++++ + D ND  P FEK+ Y   + E+   S     + Q++A D D G NG + Y L            +    ++ L+++    G I V G +DREE + ++  V A D G  S S+   + I + D NDNAP        +    NFV N+S +  IG  +  V+  D D+G N  +T  +       + PF+++P  E       K F    +L D   IK
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPEN---SPPGHSVLQVRANDADTGANGDIDYSL-----------HQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAG-----DVPFQLRPASESANDRKRKYFLQTTTLLDYERIK 453          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: ENSORLT00000041785.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 210.305 bits (534), Expect = 3.511e-55
Identity = 210/697 (30.13%), Postives = 331/697 (47.49%), Query Frame = 1
Query:  154 FSIKLVITLNVEFSVDENCRIGHVVGNVYSKLN-QLPNSSRSSLMKANEK-DSYFSLNRTSGDLIVKSFLDRETICENTKETC--SMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDI-LELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIY---ITATD-GNGRM-NETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN-DNFAISIY-------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLE----------QIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVS-FDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLD 2151
            F +   I     +S+ E  + G VVGN+   L   L   S  +L  A+E  + YFS++   G+L+V   +DRE +C  +  +C  ++++ +D+     ++ +EI DINDN PVF +++K + I E+   GT +PL  A D D     V++Y +++              +++    +K+    ++   P L + K +DRE+  +    + A D GN  ++G   + + V D NDN P + K+ YKV + E   +  I L+L A D DD    NG V Y    +T D   V  +F IN +   +   R+ G ++      Y   ++ATD G  +M    SV I + D ND+ P I + ++   V EN     ++  +  +D D G NG     +  S    LK   F DN+A+         + DRE  S Y+VEI   D G+P +S+ +  S+ I DVNDN P F  +    ++ EN   GS +  V A DLDSS N  I YSIL+S   + ++S Y       G I S   FD EK   +E  V A+D G P L+ +  V V I D ND  P       +  + + G S+ ++R+           ++ A D D G N  + YRL +             A   +L  VS + G +     +  ++ SS +L+++  DDG P  S T T+ I + D
Sbjct:   39 FLLWSTIDAQTRYSIPEEVKHGSVVGNLAKDLGLTLTEISERALRVASESGEQYFSVDAGRGELLVNDRIDREALCRQSA-SCVLTLQVVIDKPLQLFKVEVEIIDINDNSPVFPSSEKNLQIAESTAAGTRFPLDTALDLDVGVNSVRSYTLSK--------------DDYFSLNVKDMAGGRKN--PELVLSKTLDREKMPTHQLTITAVDGGNPNKSGISQINIYVLDNNDNFPVFEKNVYKVTLSENSEKSSIVLKLAAKDSDD--GVNGEVEYSFGPQTPD--AVLSVFGINKDSGEI---RLIGNLDFETTSSYEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPNSVPENAPSGTVVALISARDLDSGDNGKVTLQVPKSSPFKLK-ASFSDNYALIT-----SRALDRETFSEYSVEITATDLGSPPLSNKKMISVTITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSSENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAV----IYPSSAALG-SLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAE-------------ATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKDDGEPLQSATVTVSILLED 687          

HSP 2 Score: 152.14 bits (383), Expect = 6.239e-37
Identity = 138/484 (28.51%), Postives = 222/484 (45.87%), Query Frame = 1
Query: 1084 RIYITATDGNGRMNETSV---DIAIEDCNDHPPVISIANRFGKVL-ENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYK--IETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSN---------DNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVF-EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSN----NMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYI 2475
            ++ ITA DG G  N++ +   +I + D ND+ PV    N +   L EN ++  I+  +  KD D G NG  E S        + ++     F I K   E     + D E  S Y +++   D+G P M       I ++DVNDNAP      +   V EN P G+ V  + A DLDS +NG +   +  S+         DN+A+     I S+   DRE    Y   +TA D G P L++  ++ V I D+ND  PVF ++ Y   + E+    +    L  + A+D D  +N  + Y ++D K   +  +S +     N       G+I    + D E++   ++ VQA D G PSLS+  T+ + +LD NDNAP  ++PS+    +++   +    + G  +  V   D D G N  I++ L  +     F   +   GE+    T +  S       RLI++  D G+  ++   T+ I
Sbjct:  227 QLTITAVDG-GNPNKSGISQINIYVLDNNDNFPVFE-KNVYKVTLSENSEKSSIVLKLAAKDSDDGVNGEVEYSFGPQTPDAVLSV-----FGINKDSGEIRLIGNLDFETTSSYEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPNSVPENAPSGTVVALISARDLDSGDNGKVTLQVPKSSPFKLKASFSDNYAL-----ITSR-ALDRETFSEYSVEITATDLGSPPLSNKKMISVTITDVNDNPPVFTQRSYNVYLKEN---GVPGSILFSVSASDLDSSENAKISYSILDSKVQDVSVSSYVYMNSEN-------GSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEATDASLFTVSLY-TGEV---RTKRAVSEQDDSSQRLILEIKDDGEPLQSATVTVSI 683          

HSP 3 Score: 61.2326 bits (147), Expect = 5.845e-9
Identity = 56/179 (31.28%), Postives = 84/179 (46.93%), Query Frame = 1
Query: 1774 VKVKIQDINDCTPVF---EKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL 2301
            V+V+I DIND +PVF   EK+   +I ES   +    R     A D D+G N    Y L          +      ++++     +  + +   LDRE++ + QL + A D G P+ S  + I I VLD NDN PVF     N+  V +S   E    +  +  KD D G+NG + +S 
Sbjct:  137 VEVEIIDINDNSPVFPSSEKN--LQIAES---TAAGTRFPLDTALDLDVGVNSVRSYTLSK--------DDYFSLNVKDMAGGRKNPELVLSKTLDREKMPTHQLTITAVDGGNPNKSGISQINIYVLDNNDNFPVF---EKNVYKVTLSENSEKSSIVLKLAAKDSDDGVNGEVEYSF 299          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 209.92 bits (533), Expect = 8.219e-55
Identity = 200/696 (28.74%), Postives = 320/696 (45.98%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINR---NNIRIYITATD--GNGRMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTN 2499
            F +    ++I EN   GT + +PVA D+DS   GV  Y  A   G D            Q F ++  +   E+I P + +I N+DRE+  S+   +   D G   +  S  + + VTD NDNAP++ K+ Y+  + E    G  +L++ AND D     NG + Y L   ++    V ++  I+ +   +    + GL++R   N ++ Y+ A D   N + ++  V I+I+D ND+ P I I         N    + E+      +  VQV D D+G N +  C +       L+      N    K      T  D E+I  Y +EI  VD GNPA+SS     + + D+NDN P F   +   +  E+N  G  V  V A D DS  N  +VYSI+ S+   A S++      GEI+ + + DRE  + YEF V A D G P    + +V + ++D ND  P F    Y F + E+         +  +  +D D G+N  V   +        P N K        I  +  G I    + DRE+ S+    ++A D G P  S+   + I VLD NDNAP    P+N+ ++ ++         +  VK +D+D G+N  + +++   N    F       GEI +A   + F+       RL+++ SD G+ P++  A +++ Y++  TN
Sbjct:  151 FSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEY--ALSAGPDAN----------QLFGLQVAEDVDEKI-PQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDAD--TGANGDIDYSLHQASD---TVQRLLRIDRSTGII---YVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESS---AASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPL---NPVGVVTVSDADKGENSQVTLFV-------EPDNGK-------FIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANS-SYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHN-SGEIKLA---QGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHV-YVNETTN 799          

HSP 2 Score: 130.568 bits (327), Expect = 3.343e-30
Identity = 117/410 (28.54%), Postives = 188/410 (45.85%), Query Frame = 1
Query: 1141 IAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLN---DSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY-----GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNER-----LEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENF 2328
            I + D ND+ P  S       + EN     + +     D D G NG+ E +L+   D+ +L    +  D +  I ++      + DREK   Y + I+ VD G P  +S     I + D NDNAP+F        + EN+P G +V QVRA D D+  NG I YS+  ++D     +      G I  K   DRE+ +  +F V ARD G    +    V + I+D ND  P  E +     I +++  +I  +      +  ++ +D+D G+N  V      V    +P   +  +E  N  K  +   +     LD E I   ++ + A D G P+LS+T ++ ++V D+NDN P F   S  +  VN + + + G  +  V   D D G+N  + +S+I S+    F
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVI--GNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTC----VVAGDVPFQLRPASESANDRKRKY--FLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSF---SPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLF 537          

HSP 3 Score: 120.168 bits (300), Expect = 6.017e-27
Identity = 97/334 (29.04%), Postives = 155/334 (46.41%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI---LNSNDNFAISIYGEIQSKIK-------FDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKD-YFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFD-GAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNM----NFV-NVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIK 2424
            I ++D+NDN P+F + I    + EN   G+      A+D DS +NG   Y++    ++N  F + +  ++  KI         DREK DSY+  +   D G+P    S ++++ + D ND  P FEK+ Y   + E+   S     + Q++A D D G NG + Y L            +    ++ L+++    G I V G +DREE + ++  V A D G  S S+   + I + D NDNAP        +    NFV N+S +  IG  +  V+  D D+G N  +T  +       + PF+++P  E       K F    +L D   IK
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPEN---SPPGHSVLQVRANDADTGANGDIDYSL-----------HQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAG-----DVPFQLRPASESANDRKRKYFLQTTTLLDYERIK 453          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 206.068 bits (523), Expect = 5.759e-54
Identity = 200/706 (28.33%), Postives = 318/706 (45.04%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGN--QTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEG-DILELIANDRDDPNTKNGLVSYQLSDRTE--------DRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNG--RMNETSVDIAIEDCNDHPPVISI--------ANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIR--FDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY------GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE-KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQP-EGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLN 2505
            F  +   I++ EN  +G  + +P+A D+DS + GV  Y  A   G D              F ++    +  ++ P L ++ N+DRE   S+   + A D GN  +     + V+VTD NDN+P++   +Y+  + E    G  +L++ A+D D     NG + Y L    +        DR   + I Y+ G    L    I      N++  Y+ A D     + ++T V I + D ND+ P + I        +     + E+      +  VQV D+D+G N +  C +       L+       DN   Y ++T   T  D E++  Y VEI  VD GNPA+SS     + + DVNDN+P F   I      E N  G T+  V A D DS  N  + Y+I+   D++   ++      GE++++   DRE  + YEF VTA D G P    +  V +K+ D ND  P F    Y F + E+         +  +   D D G+N  V    + V+P G              +  +  G I    + DRE+ SS    ++A D G P  S+   + I VLD NDN PV   PSN+ +F  +S        +  V+ +DLD G N  +  S+   N  +   F+I P  GEI +A   KE +       RL+++ SD G+ P++  A ++I    +++N++
Sbjct:  132 FPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADY--ALTAGPDAAT----------LFGLQVADDRGGKL-PQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSD--MGPNGEIEYSLHQAVDPVPKLLRIDR--TTGIIYVKGP---LDREEI------NSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTT--TPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIV--GDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPL---SPVGMVTVLDMDKGENAHVH---LSVEPDG-----------GKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNS-SFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQL--FRISPSSGEITLA---KEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVS 784          

HSP 2 Score: 140.198 bits (352), Expect = 3.412e-33
Identity = 128/468 (27.35%), Postives = 206/468 (44.02%), Query Frame = 1
Query: 1141 IAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLN---DSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIY-----GEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERL------EQIKATDKDLGQNGTVKYRLIDVKPIGI-PGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHT-----MKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYI 2484
            I ++D ND+ P   ++     V EN     + +     D D  RNG+ + +L    D+  L    +  D    + ++      + DRE    Y + IK VD GNP   S     + + D NDN+P+F +      V EN+P+G +V QV+A D D   NG I YS+  + D     +      G I  K   DRE+ +S  F V ARD G    +    V +++ D ND  P  E      +T S G +  +E +        ++ +DKD G+N  V   +    P  + P +       R          +     LD E +   ++ + A D G P+LS+T ++ ++V D+NDN+PVF   S  +  V+ + E + G+TI  V   D D G N  + ++++  +  +   F+I P    + A T      KE   FR       + A+D G       AT+ I+ +
Sbjct:  120 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVL--GNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYF-------LQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVF---SPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGL-FEIDPNTGEVKARTPLDREHKERYEFR-------VTAADKGSPVHKGTATVVIKVL 567          

HSP 3 Score: 71.2478 bits (173), Expect = 4.740e-12
Identity = 83/278 (29.86%), Postives = 120/278 (43.17%), Query Frame = 1
Query: 1528 MFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEI-QSKIKFDRE-----------KTDSYEFVVTARD---NGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIK-ATDKDLGQNGTVKYRLI---DVKPI-GIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSL 2301
            ++ V E  P  + +G + A D    ++GH+    + +         G+I  ++I  DRE           K    EF V+  D   N  P+L +    ++++QDIND TP F       +T S  E+     L  I  ATD+D  +NG   Y L    D   + G+        +L  LI         V GNLDRE   S  L ++A D G P   +   + + V D NDN+P F  PS       VS    +G ++  VK  D D G NG I +SL
Sbjct:   25 LYRVQEEQPPNTLIGSL-AADHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEG---RIEVQDINDNTPQFP---LSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLI---------VLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYE---AEVSENSPVGHSVLQVKADDSDMGPNGEIEYSL 283          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000066775.1 (SMESG000066775.1)

HSP 1 Score: 2056.57 bits (5327), Expect = 0.000e+0
Identity = 1059/1065 (99.44%), Postives = 1061/1065 (99.62%), Query Frame = 1
Query:  124 MLIELDILIIFSIKLVITLNVEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGKKSHSSDNNNFGFRLKNDNKNPISTKNFNPNLSDSMMVLYSLAAXXXXXXXXXXXXXXXXYWSKHYSVNDRYSKKIYKAGNVQLDLDTNLKEMKNVTKSIRSNRDCETSGNEDASAVCFIGDDGSSYTHLMMLSNSKYTPMLHNPGSPGSLRQIVNNKNFHQSSVENNLINYSENLINPSSYMPPISCPSKARMKGFSTSISYNSDKEGENYSTLKDKINVDFNALNIDRNVHTISIASHNNPQENPDFCQKPRDFNSPYVTSSFV 3318
            M IELDILIIFSIKLVITLNVEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAIQIVIEINDINDNVPVFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIA DFGNQTGSCTVTVLVTDVNDNAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAIS+YGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQ EGEIIIAH+MKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTN NPTSIGKKSHSSDNNNFGFRLKNDNKNPISTKNFNPNLSDSMMVLYSLAAILFFIFLIVLFVLVFIYWSKHYSVNDRYSKKIYKAGNVQLDLDTNLKEMKNVTKSIRSNRDCETSGNEDASAVCFIGDDGSSYTHLMMLSNSKYTPMLHNPGSPGSLRQIVNNKNFHQSSVENNLINYSENLINPSSYMPPISCPSKARMKGFSTSISYNSDKEGENYSTLKDKINVDFNALNIDRNVHTISIASHNNPQENPDFCQKPRDFNSPYVTSSFV
Sbjct:    1 MFIELDILIIFSIKLVITLNVEFSVDENCRIGHVVGNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAIQIVIEINDINDNVPVFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIAADFGNQTGSCTVTVLVTDVNDNAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISIYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQSEGEIIIAHSMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNSNPTSIGKKSHSSDNNNFGFRLKNDNKNPISTKNFNPNLSDSMMVLYSLAAILFFIFLIVLFVLVFIYWSKHYSVNDRYSKKIYKAGNVQLDLDTNLKEMKNVTKSIRSNRDCETSGNEDASAVCFIGDDGSSYTHLMMLSNSKYTPMLHNPGSPGSLRQIVNNKNFHQSSVENNLINYSENLINPSSYMPPISCPSKARMKGFSTSISYNSDKEGENYSTLKDKINVDFNALNIDRNVHTISIASHNNPQENPDFCQKPRDFNSPYVTSSFV 1065          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000007877.1 (SMESG000007877.1)

HSP 1 Score: 543.117 bits (1398), Expect = 1.784e-174
Identity = 372/953 (39.03%), Postives = 565/953 (59.29%), Query Frame = 1
Query:  175 TLNVEFSVDENCRIGHVVGNV--YSKLNQLP-NSSRSSLMKANEKD--SYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIA--RCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSG-----KLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRE-NFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYI-HSLTNLN---PTSIGKKSHSSDNNNFGFRLKNDNKNPISTKNFNPNLSDSMMVLYSLAAXXXXXXXXXXXXXXXXYWSKHYSVNDRYSKKIYKAGNVQLDLDTNLKEMKNVTKSIRSNRDCE------TSGNED-----ASAVCFIGDDGSSYTHLMMLSNSKYTPM 2943
            T  ++  + EN   G  + N+  Y  +++LP NSS +  + +NE D  +YF L   SG L  ++ +DRET+C++  + C   + +  +   ++++++IND NDN+P F    K ++IQEN  IG+   LP A D DS    +  Y+I     + I + NQ +      ++F I      + +I P L++IK IDREE   F  ILIA D G Q GSCT+TV + DVNDN+P+W   N    ++EC  +G ++EL A DRDD +T NG + Y++SD +  +++++++FYI G+ L L++  +  +  +  I  +ITA DG GR N T+V I IEDCNDH P I+I      + EN +  ++LT+V V D+DKG N  F C LND+      K ++ N        +Y I+  PDT FDRE +S Y+V I+C+D G P +   + F++ IID NDNAP+F +    F + ENN IG+ +G VRA D DS+ NG + Y ILN+++N  F I+I G+I++K KFDRE  D Y   + A+DNGEP LND+  V ++I D+NDC PVF++ YF++ITE  G +  +  L ++ A DKDLG+NGTV Y    ++      N +    L NL+K++ +G +++YG +DRE++ SIQ  + A+D+G P LS    +I++VLD+NDN P F +P N MNF+N+S + ++GK +   + +D D+G NGTIT+S+I+    E N P+++Q +G +I+   ++E    R LPDRLII+ASD G  PK  + T+ IRYI ++LT  N   P  I KKS+  D N F     ++ ++  ST        D+M +LY L  ILF +F+IVL VLV+ Y+S  +S             + QLDL T+ KE+ N       N +C+       S +ED       ++     D ++YTHLM ++ +KYTP+
Sbjct:    6 TFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHA-DVCQKIILISINGQVLEVMVDINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQA----SRYFTIFIKTMNRMKI-PYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAGSSLFLSSQGLQLMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKEDVYNQSNGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKFDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYA---IRQKYDHSNRQNNIGL-NLLKINLEGILNIYGVVDREQMVSIQAEIIAYDNGKPQLSAVANVIVDVLDVNDNKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKYLREREGIR-LPDRLIIRASDNGIPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSN--DKNRFSGGNVDNYRDSDST--------DNMTLLYILVGILFVVFIIVLLVLVYTYFSGRFS------------RSRQLDL-THEKELNNYCTDGTGNYECDLLNANAASCHEDFNKMAMGSISSPATDKNNYTHLMRMNEAKYTPI 924          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000007877.1 (SMESG000007877.1)

HSP 1 Score: 526.939 bits (1356), Expect = 3.742e-169
Identity = 339/846 (40.07%), Postives = 503/846 (59.46%), Query Frame = 1
Query:  481 FQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIA--RCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSG-----KLNLKNIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRE-NFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYI-HSLTNLN---PTSIGKKSHSSDNNNFGFRLKNDNKNPISTKNFNPNLSDSMMVLYSLAAXXXXXXXXXXXXXXXXYWSKHYSVNDRYSKKIYKAGNVQLDLDTNLKEMKNVTKSIRSNRDCE------TSGNED-----ASAVCFIGDDGSSYTHLMMLSNSKYTPM 2943
            F    K ++IQEN  IG+   LP A D DS    +  Y+I     + I + NQ +      ++F I      + +I P L++IK IDREE   F  ILIA D G Q GSCT+TV + DVNDN+P+W   N    ++EC  +G ++EL A DRDD +T NG + Y++SD +  +++++++FYI G+ L L++  +  +  +  I  +ITA DG GR N T+V I IEDCNDH P I+I      + EN +  ++LT+V V D+DKG N  F C LND+      K ++ N        +Y I+  PDT FDRE +S Y+V I+C+D G P +   + F++ IID NDNAP+F +    F + ENN IG+ +G VRA D DS+ NG + Y ILN+++N  F I+I G+I++K KFDRE  D Y   + A+DNGEP LND+  V ++I D+NDC PVF++ YF++ITE  G +  +  L ++ A DKDLG+NGTV Y    ++      N +    L NL+K++ +G +++YG +DRE++ SIQ  + A+D+G P LS    +I++VLD+NDN P F +P N MNF+N+S + ++GK +   + +D D+G NGTIT+S+I+    E N P+++Q +G +I+   ++E    R LPDRLII+ASD G  PK  + T+ IRYI ++LT  N   P  I KKS+  D N F     ++ ++  ST        D+M +LY L  ILF +F+IVL VLV+ Y+S  +S             + QLDL T+ KE+ N       N +C+       S +ED       ++     D ++YTHLM ++ +KYTP+
Sbjct:   37 FSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQA----SRYFTIFIKTMNRMKI-PYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAGSSLFLSSQGLQLMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKEDVYNQSNGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKFDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYA---IRQKYDHSNRQNNIGL-NLLKINLEGILNIYGVVDREQMVSIQAEIIAYDNGKPQLSAVANVIVDVLDVNDNKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKYLREREGIR-LPDRLIIRASDNGIPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSN--DKNRFSGGNVDNYRDSDST--------DNMTLLYILVGILFVVFIIVLLVLVYTYFSGRFS------------RSRQLDL-THEKELNNYCTDGTGNYECDLLNANAASCHEDFNKMAMGSISSPATDKNNYTHLMRMNEAKYTPI 849          

HSP 2 Score: 71.633 bits (174), Expect = 3.220e-12
Identity = 76/256 (29.69%), Postives = 118/256 (46.09%), Query Frame = 1
Query: 1474 INIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI--LNSND-----NFAISIYGEI------QSKIKF-------DREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQ--NGTVKYRLIDVKPIGIPGNSKLKAELRN-LIKVSFDGAISVYGNLDREEISS-IQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAP 2169
            ++I D NDN P+F  + K   + EN+ IGS +    A DLDS  N  I Y I  ++S D      F  S Y  I      + KI +       DRE+ D +E ++ A D+G+ Q   S  + V I D+ND +P +       I+++  E  +   L +++A D+D     NG +KY++ D  P         K EL N L  ++          L   ++ + I   + A D G      +T + IE+ D ND+AP
Sbjct:   25 VDINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTMNRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPT---VNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSP---------KKELINRLFYIAGSSLFLSSQGLQLMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAP 264          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000059440.1 (SMESG000059440.1)

HSP 1 Score: 441.81 bits (1135), Expect = 1.052e-136
Identity = 297/800 (37.12%), Postives = 444/800 (55.50%), Query Frame = 1
Query:  154 FSIKLVITLNVEFSVDENCRIGHVVGNVYSKLNQLPNSS-----RSSLMKANEKDSY----FSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLD----QDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTI--GNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFD-----DNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS---NDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP-SNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRY 2481
            FS+KL +      SV+EN +    +GN+   +     S+     +S  +++ + ++Y     S+++  GD+ V S +DRE IC+   + C    +L+     D    ++ IEI DINDN P FQ  +K I I EN+   + + LPVA+D+DS KYGVK YY+        EN  + I  GNN               I P L +I ++DRE   SF F L A+D G   G C + V +TDVNDN P+W    Y+  I EC +E  +L+L A D+DDP T  G + +++S+ +++ +++ +IFYI  + L+L    +      N   I + A DG GR NET++++ I+DCNDH PVI + +   K+ EN+K KI++T + V DED+G N  F CSLND+  ++L ++            I+++ + P   FDREK S Y+VE+ C D G P MSS +  +I I D NDN P F  + K F + E+  IG  +G V A D DSS N  I YSI+      + F I+  G+I      DRE  D YEF V A+DNGEP LNDS  +++ + D+ND  P     Y F+I ES+    K+  + ++ A+D+D+GQNGT ++R   V+    P +          I+V  +G I  +GN+DRE++  I +LV   D+G P  + TTT+ IEVLD+NDN P F +P  N  N++N++ +   G  +  VK  D D G+NG+I ++L N N  ++  F IQ +G+II+    K+       PDRL+++A D G    +   TLYIRY
Sbjct:   19 FSVKLYL------SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISK-CLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKYYLKSISSSIYENYFELIDHGNN---------------INPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSF-KENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFR---VRSRSTPID----------IQVYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDL-FSIQSDGQIILK---KKLDTKIKNPDRLVVEARDQGTPSLSATTTLYIRY 778          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000059440.1 (SMESG000059440.1)

HSP 1 Score: 441.81 bits (1135), Expect = 2.079e-136
Identity = 297/800 (37.12%), Postives = 444/800 (55.50%), Query Frame = 1
Query:  154 FSIKLVITLNVEFSVDENCRIGHVVGNVYSKLNQLPNSS-----RSSLMKANEKDSY----FSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLD----QDTHAXXXXXXXXXXXXXXXXFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTI--GNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIATDFGNQTGSCXXXXXXXXXXXXAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFD-----DNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS---NDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP-SNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHTMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRY 2481
            FS+KL +      SV+EN +    +GN+   +     S+     +S  +++ + ++Y     S+++  GD+ V S +DRE IC+   + C    +L+     D    ++ IEI DINDN P FQ  +K I I EN+   + + LPVA+D+DS KYGVK YY+        EN  + I  GNN               I P L +I ++DRE   SF F L A+D G   G C + V +TDVNDN P+W    Y+  I EC +E  +L+L A D+DDP T  G + +++S+ +++ +++ +IFYI  + L+L    +      N   I + A DG GR NET++++ I+DCNDH PVI + +   K+ EN+K KI++T + V DED+G N  F CSLND+  ++L ++            I+++ + P   FDREK S Y+VE+ C D G P MSS +  +I I D NDN P F  + K F + E+  IG  +G V A D DSS N  I YSI+      + F I+  G+I      DRE  D YEF V A+DNGEP LNDS  +++ + D+ND  P     Y F+I ES+    K+  + ++ A+D+D+GQNGT ++R   V+    P +          I+V  +G I  +GN+DRE++  I +LV   D+G P  + TTT+ IEVLD+NDN P F +P  N  N++N++ +   G  +  VK  D D G+NG+I ++L N N  ++  F IQ +G+II+    K+       PDRL+++A D G    +   TLYIRY
Sbjct:   16 FSVKLYL------SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISK-CLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKYYLKSISSSIYENYFELIDHGNN---------------INPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSF-KENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFR---VRSRSTPID----------IQVYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDL-FSIQSDGQIILK---KKLDTKIKNPDRLVVEARDQGTPSLSATTTLYIRY 775          
The following BLAST results are available for this feature:
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH12.926e-6028.47protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH13.454e-6028.47protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDHGB65.947e-5327.68protocadherin gamma subfamily B, 6 [Source:HGNC Sy... [more]
PCDHGB61.072e-5227.68protocadherin gamma subfamily B, 6 [Source:HGNC Sy... [more]
PCDHGB56.259e-5227.44protocadherin gamma subfamily B, 5 [Source:HGNC Sy... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.078e-3930.00FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.222e-3631.11FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-48.436e-3023.94Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-13.271e-2631.83CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-38.258e-2127.71Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kug1.349e-3829.48gene:FBgn0261574 transcript:FBtr0346077[more]
kug1.349e-3829.48gene:FBgn0261574 transcript:FBtr0332721[more]
kug1.408e-3828.98gene:FBgn0261574 transcript:FBtr0332722[more]
ft1.708e-3726.86gene:FBgn0001075 transcript:FBtr0077478[more]
ds3.919e-3729.30gene:FBgn0284247 transcript:FBtr0078045[more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.472e-5829.11protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a2.551e-5829.11protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh175.856e-5529.99protocadherin 17 [Source:ZFIN;Acc:ZDB-GENE-090608-... [more]
si:ch73-233f7.72.761e-5230.22si:ch73-233f7.7 [Source:ZFIN;Acc:ZDB-GENE-141215-5... [more]
CT030123.12.947e-5228.29protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000027070.14.202e-5928.28pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
ENSXETT00000027042.11.139e-5628.79pep primary_assembly:Xenopus_tropicalis_v9.1:3:191... [more]
vat1l4.971e-5328.91vesicle amine transport 1-like [Source:Xenbase;Acc... [more]
ENSXETT00000027771.16.105e-5327.06pep primary_assembly:Xenopus_tropicalis_v9.1:3:182... [more]
ap4b11.055e-5229.54adaptor related protein complex 4 subunit beta 1 [... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh12.139e-6229.18protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh13.135e-6229.18protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh13.135e-6229.18protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdhga102.065e-5629.37protocadherin gamma subfamily A, 10 [Source:MGI Sy... [more]
Pcdhgb52.079e-5527.70protocadherin gamma subfamily B, 5 [Source:MGI Sym... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN1.659e-5928.47Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q5DRB6|PCDG4_PANTR1.890e-5227.55Protocadherin gamma-A4 OS=Pan troglodytes OX=9598 ... [more]
sp|Q5DRA6|PCDGI_PANTR3.123e-5227.48Protocadherin gamma-B6 OS=Pan troglodytes OX=9598 ... [more]
sp|Q5DRA9|PCDGE_PANTR3.793e-5227.69Protocadherin gamma-B2 OS=Pan troglodytes OX=9598 ... [more]
sp|Q9Y5F9|PCDGI_HUMAN5.149e-5227.68Protocadherin gamma-B6 OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0S0C61.050e-9230.18Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A1I8H4K21.255e-6429.22Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GLZ21.257e-6429.34Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DHT61.456e-6429.34Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GS002.431e-6429.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.357e-5528.28protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.571e-5528.28protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
ENSAMXT00000037569.18.721e-5527.90pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
ENSAMXT00000037829.11.130e-5427.90pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
ENSAMXT00000054364.11.357e-5427.90pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008517.15.783e-4828.22pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
pcdh115.809e-4527.31protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.15.364e-4325.40pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000004042.15.574e-3627.70pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004043.17.423e-3627.70pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461892.469e-4630.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482377.662e-4631.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404701.115e-3928.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.597e-3928.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO256732.320e-3731.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH171.336e-5529.53protocadherin-17 [Source:NCBI gene;Acc:101168002][more]
pcdh1b2.909e-5528.74protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
ENSORLT00000041785.13.511e-5530.13protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
pcdh1b8.219e-5528.74protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1a5.759e-5428.33protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
back to top
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066775.10.000e+099.44SMESG000066775.1[more]
SMESG000007877.11.784e-17439.03SMESG000007877.1[more]
SMESG000007877.13.742e-16940.07SMESG000007877.1[more]
SMESG000059440.11.052e-13637.13SMESG000059440.1[more]
SMESG000059440.12.079e-13637.13SMESG000059440.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004358 ID=SMED30004358|Name=Protocadherin-11 X-linked|organism=Schmidtea mediterranea sexual|type=transcript|length=3447bp
ATCGAATTGATTCTTATAGCCAATCAAATCAATTCATTTCTCAATACAAT
CAATTGAATTTAAACAACATTTTTCAAAGTTAATTTTGTAAATAATTTCT
TTCAATAAATCTTATTTTTCAGAATGTTAATCGAATTGGATATTTTAATA
ATATTTTCCATTAAACTTGTCATAACTCTCAATGTTGAATTTTCAGTGGA
TGAAAACTGCCGAATCGGCCATGTTGTCGGAAATGTATATTCTAAGCTAA
ATCAATTGCCAAACAGTTCAAGAAGCAGCCTAATGAAAGCAAATGAAAAA
GACAGCTATTTCTCTTTGAACAGGACCAGTGGAGATTTAATTGTCAAATC
CTTTCTTGATCGAGAAACGATATGCGAAAATACGAAGGAAACATGTTCAA
TGAAGTTATACCTGGACCAAGATACCCACGCCATCCAAATCGTGATTGAA
ATAAACGACATCAATGATAATGTTCCTGTGTTTCAAACAACTCAGAAAGT
GATAAATATTCAGGAAAATATTCCAATAGGAACGACATATCCGTTGCCCG
TTGCTCAAGATAAGGACAGTTATAAGTACGGAGTGAAAACGTATTACATT
GCCAGATGCCAAGGAATTGATCAAGAAAACCAAGTGAAAACCATTGGAAA
CAATTTTCAATTCTTTCAAATCAAAAACCCTAAAAGTAAACAGGAAGAGA
TTTACCCTTCTTTGGAGATTATTAAAAACATTGATAGAGAAGAATTTGTT
TCCTTTGTATTTATTCTGATCGCTACTGATTTTGGTAACCAAACCGGATC
CTGTACCGTCACCGTATTGGTCACAGATGTCAATGACAATGCTCCAGAAT
GGACTAAAGACAACTATAAAGTCAACATTCAAGAATGTCAATCAGAAGGC
GACATCCTCGAACTGATCGCGAATGATCGCGATGATCCGAACACAAAAAA
CGGATTGGTCAGCTACCAATTGAGCGATAGAACAGAAGACCGAAAAATCG
TGTCGCAAATCTTTTACATCAACGGAAACAAACTCCATTTAACGAACAAT
CGGATTTCCGGATTGATAAATAGAAACAATATCAGAATTTATATAACGGC
CACTGATGGAAACGGTCGAATGAATGAAACATCAGTCGACATAGCGATTG
AAGACTGCAATGATCATCCGCCAGTTATTTCCATTGCTAATAGGTTTGGA
AAGGTTCTCGAGAATCAAAAACAGAAAATAATTCTAACAACCGTCCAAGT
GAAAGACGAAGATAAAGGTCGAAATGGAATGTTTGAGTGTAGTCTCAATG
ATTCGGGAAAATTGAATTTGAAAAATATAAGATTTGATGATAATTTTGCA
ATTTATAAGATTGAAACGTATCCCGATACGTCATTTGATAGGGAGAAAAT
CAGCGTTTATACTGTGGAAATCAAATGCGTCGATCAAGGAAACCCGGCAA
TGAGTAGCATGCAAAAGTTTTCAATAAATATCATTGACGTGAACGATAAC
GCACCAAGATTTGTTAATAAAATCAAAATGTTTCATGTTGTGGAAAACAA
CCCCATCGGTTCGACAGTTGGCCAAGTCCGGGCCATGGATTTGGATAGCA
GCAACAACGGTCATATTGTGTATTCGATTCTCAACAGCAATGACAACTTT
GCTATTAGTATTTATGGAGAAATCCAGTCGAAAATCAAATTTGATAGAGA
AAAAACGGATTCGTATGAGTTTGTTGTTACGGCAAGAGACAACGGAGAAC
CCCAGCTCAATGATTCAATGGTGGTGAAAGTAAAGATCCAAGATATCAAT
GATTGTACACCGGTATTTGAAAAAGACTATTTTTTCAGGATTACCGAAAG
TTATGGAGAATCAATTAAAAATGAAAGACTCGAGCAAATTAAAGCCACCG
ACAAAGATCTCGGTCAAAATGGAACTGTGAAATATCGCTTGATAGATGTA
AAACCCATCGGAATACCCGGAAATTCAAAACTCAAAGCCGAATTACGAAA
CCTGATTAAAGTGAGCTTCGATGGCGCGATTTCCGTTTATGGGAATTTAG
ATCGAGAAGAAATCTCTTCAATTCAATTGCTCGTCCAAGCCTTCGACGAC
GGATATCCGAGTTTGTCCACAACGACAACAATTATTATAGAAGTTCTAGA
TCTGAATGACAATGCTCCAGTATTTTTGTTTCCAAGTAACAATATGAATT
TTGTCAATGTCAGTGTTGAATGGGAAATCGGGAAAACGATTTGTACCGTT
AAAACAAAAGATCTCGACCAAGGAATAAATGGCACGATTACACATTCGTT
AATCAATTCAAACAAGCGCGAAAATTTCCCGTTTAAAATTCAACCGGAAG
GTGAAATAATAATCGCCCATACTATGAAAGAATTCAGCAATTTTCGAAGC
CTACCTGACAGATTAATTATTAAAGCATCGGATCTTGGTCAGAATCCAAA
GAACAATATTGCCACTCTCTATATTCGCTATATCCATTCTTTGACTAATT
TGAATCCGACTTCAATAGGGAAAAAGTCTCACAGCTCCGACAATAACAAT
TTTGGTTTTCGATTAAAAAATGACAACAAAAATCCCATTTCCACTAAAAA
TTTCAATCCAAATTTATCAGATAGTATGATGGTCCTTTATTCTCTTGCTG
CCATTTTGTTTTTTATATTCCTCATTGTCCTATTTGTGCTGGTCTTCATC
TACTGGTCAAAACATTACTCTGTGAATGACAGATATTCTAAGAAAATCTA
CAAAGCAGGAAATGTTCAACTAGATTTAGACACAAATCTAAAGGAAATGA
AAAATGTTACAAAATCCATTAGAAGTAATCGAGATTGTGAAACATCTGGA
AACGAAGATGCTTCGGCAGTATGCTTTATTGGAGATGACGGTTCAAGTTA
TACACATCTGATGATGCTGAGCAATTCCAAATATACTCCAATGCTACACA
ATCCGGGATCTCCGGGAAGCTTGCGCCAAATTGTAAACAATAAAAATTTT
CACCAATCATCTGTGGAAAACAATCTCATCAATTACTCTGAGAATTTAAT
CAACCCCTCTTCCTACATGCCCCCTATATCATGCCCATCAAAGGCTCGAA
TGAAAGGTTTTTCAACATCGATAAGTTACAATTCTGATAAAGAAGGAGAA
AATTATTCGACTTTAAAAGACAAAATCAACGTCGACTTTAACGCATTAAA
CATTGATAGAAATGTGCATACGATTTCCATTGCTAGTCACAATAATCCCC
AGGAAAATCCAGATTTCTGTCAAAAACCGAGAGACTTCAATTCTCCATAT
GTTACATCAAGTTTTGTTTAAATTGTCATATTTAATTGAAATGCTTTTCA
CTTACGACAATCTTATCAATCTAAGAATCATAATAGAAAGATTAAATTAA
TTTTTTATTTTCAAATAATTCCTTCAATTAGTCTTTGTAAATAATCC
back to top

protein sequence of SMED30004358-orf-1

>SMED30004358-orf-1 ID=SMED30004358-orf-1|Name=SMED30004358-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1066bp
MLIELDILIIFSIKLVITLNVEFSVDENCRIGHVVGNVYSKLNQLPNSSR
SSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQD
THAIQIVIEINDINDNVPVFQTTQKVINIQENIPIGTTYPLPVAQDKDSY
KYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEII
KNIDREEFVSFVFILIATDFGNQTGSCTVTVLVTDVNDNAPEWTKDNYKV
NIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYIN
GNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPP
VISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLK
NIRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFS
INIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVY
SILNSNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMV
VKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNG
TVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISVYGNLDREEISSI
QLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEW
EIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQPEGEIIIAHT
MKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIHSLTNLNPTSIGK
KSHSSDNNNFGFRLKNDNKNPISTKNFNPNLSDSMMVLYSLAAILFFIFL
IVLFVLVFIYWSKHYSVNDRYSKKIYKAGNVQLDLDTNLKEMKNVTKSIR
SNRDCETSGNEDASAVCFIGDDGSSYTHLMMLSNSKYTPMLHNPGSPGSL
RQIVNNKNFHQSSVENNLINYSENLINPSSYMPPISCPSKARMKGFSTSI
SYNSDKEGENYSTLKDKINVDFNALNIDRNVHTISIASHNNPQENPDFCQ
KPRDFNSPYVTSSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000099neuron
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 632..658
score: 28.74
coord: 120..149
score: 28.15
coord: 61..80
score: 36.15
coord: 222..241
score: 45.78
coord: 241..254
score: 27.98
coord: 666..683
score: 46.29
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 485..563
e-value: 1.7E-20
score: 84.1
coord: 589..682
e-value: 6.0E-21
score: 85.6
coord: 142..241
e-value: 3.2E-8
score: 43.3
coord: 264..350
e-value: 2.7E-8
score: 43.6
coord: 38..118
e-value: 0.57
score: 6.3
coord: 374..461
e-value: 8.2E-15
score: 65.2
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 583..675
e-value: 8.7E-10
score: 38.9
coord: 470..556
e-value: 3.9E-17
score: 62.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 459..560
e-value: 6.2E-28
score: 99.5
coord: 348..458
e-value: 6.3E-19
score: 70.5
coord: 114..238
e-value: 4.7E-16
score: 61.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 239..347
e-value: 1.1E-14
score: 56.9
coord: 561..682
e-value: 1.5E-20
score: 75.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 20..113
e-value: 1.1E-14
score: 56.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 683..794
e-value: 9.6E-13
score: 50.4
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 513..929
coord: 20..575
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 244..352
score: 15.943
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 17..120
score: 12.83
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 464..565
score: 24.339
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 703..797
score: 8.949
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 121..243
score: 16.184
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 565..684
score: 22.87
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 353..463
score: 18.004
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 361..459
e-value: 2.43265E-13
score: 65.0273
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 126..239
e-value: 8.37856E-13
score: 63.4865
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 22..116
e-value: 1.06158E-7
score: 48.849
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 248..348
e-value: 9.75052E-5
score: 40.3746
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 470..560
e-value: 2.07118E-27
score: 105.088
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 693..785
e-value: 9.81948E-8
score: 48.849
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 569..680
e-value: 3.27591E-19
score: 81.5909
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.618
NoneNo IPR availableTMHMMTMhelixcoord: 839..861
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 21..95
e-value: 6.7E-11
score: 41.9
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 231..241
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 672..682
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 451..461
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 21..85
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 346..463
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 672..789
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 237..352
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 108..253
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 451..572
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 553..689