Bestrophin homolog

Overview
NameBestrophin homolog
Smed IDSMED30004353
Length (bp)1778
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bestrophin homolog (SMED30004353) t-SNE clustered cells

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30004353) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bestrophin homolog (SMED30004353) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30004353) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004353

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30004353SMESG000030918.1 dd_Smed_v4_9659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004353SMESG000030918.1 dd_Smed_v4_9659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 283.108 bits (723), Expect = 2.777e-89
Identity = 146/389 (37.53%), Postives = 219/389 (56.30%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDM--KVDSNDW 1268
            MTV Y  +V +A    F +LL KW+G ++KL+Y +FIVF+ LYT IS +YRL+L    KR FEK+  Y  +    IPV F+LGFYV+LV NR+W  F  +PW  ++  +I+S              S+    E  RL RR+++RY+  + ++    VS  V +RFP +D +   G +   E ++  + +   ++ ++P  W   +  KA  +GRI +   L + + E+N++R     LF  D V +PLVYTQVVTLAVY++F +CLIGRQF+  +        D  +PIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N  +D N ++ L   D + +  P + KD ++D      P      D     F+GS   M  ++  N+W
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISS--------------SVHGSDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCIPSFLGSTVQMGKQMPKNEW 375          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 287.73 bits (735), Expect = 6.232e-88
Identity = 145/386 (37.56%), Postives = 217/386 (56.22%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSND 1265
            MTV Y  +V +A    F +LL KW+G ++KL+Y +FIVF+ LYT IS +YRL+L    KR FEK+  Y  +    IPV F+LGFYV+LV NR+W  F  +PW  ++  +I+S              S+    E  RL RR+++RY+  + ++    VS  V +RFP +D +   G +   E ++  + +   ++ ++P  W   +  KA  +GRI +   L + + E+N++R     LF  D V +PLVYTQVVTLAVY++F +CLIGRQF+  +        D  +PIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N  +D N ++ L   D + +  P + KD ++D      P      D     F+GS   M +  +D
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISS--------------SVHGSDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCIPSFLGSTVQMGLSGSD 372          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 266.159 bits (679), Expect = 2.204e-81
Identity = 156/464 (33.62%), Postives = 236/464 (50.86%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELP-MESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSSGISMFTSTASLKGLEAITPTIS 1496
            MTV Y   V +A    F +LL  W+G ++KL++ + + F   Y  +S  YR +L +  KR FEK+V Y  Q  SLIPV+F+LGFYV+LV NR+W  +  +P    +  ++A               ++    +  RL RR+++RY   S ++ L  VS  V +RFP ID +   G +   E +  +N      + ++P  W + +  +A  +GRI + + L   ++E+N FR     LF  D + VPLVYTQVVT+A+YSYFL+CLIGRQF+  +   +    D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D NF++ +   D +  D   L KD ++D      P   + +   R   F GS +D+ +   D          G  GE   D L  + L    G+        + S   +K +  + +      S A +   E   P  S
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAG--------------TVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEARAPYTAATVFQLRQPSFQGSTFDITLAKEDMQFQRLDGLDGPMGEAPGDFLQ-RLLPAGAGMVAGGPLGRRLSFLLRKNSCVSEASTGASCSCAVVP--EGAAPECS 447          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 266.159 bits (679), Expect = 2.204e-81
Identity = 156/464 (33.62%), Postives = 236/464 (50.86%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELP-MESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSSGISMFTSTASLKGLEAITPTIS 1496
            MTV Y   V +A    F +LL  W+G ++KL++ + + F   Y  +S  YR +L +  KR FEK+V Y  Q  SLIPV+F+LGFYV+LV NR+W  +  +P    +  ++A               ++    +  RL RR+++RY   S ++ L  VS  V +RFP ID +   G +   E +  +N      + ++P  W + +  +A  +GRI + + L   ++E+N FR     LF  D + VPLVYTQVVT+A+YSYFL+CLIGRQF+  +   +    D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D NF++ +   D +  D   L KD ++D      P   + +   R   F GS +D+ +   D          G  GE   D L  + L    G+        + S   +K +  + +      S A +   E   P  S
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAG--------------TVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEARAPYTAATVFQLRQPSFQGSTFDITLAKEDMQFQRLDGLDGPMGEAPGDFLQ-RLLPAGAGMVAGGPLGRRLSFLLRKNSCVSEASTGASCSCAVVP--EGAAPECS 447          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 266.159 bits (679), Expect = 2.204e-81
Identity = 156/464 (33.62%), Postives = 236/464 (50.86%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELP-MESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSSGISMFTSTASLKGLEAITPTIS 1496
            MTV Y   V +A    F +LL  W+G ++KL++ + + F   Y  +S  YR +L +  KR FEK+V Y  Q  SLIPV+F+LGFYV+LV NR+W  +  +P    +  ++A               ++    +  RL RR+++RY   S ++ L  VS  V +RFP ID +   G +   E +  +N      + ++P  W + +  +A  +GRI + + L   ++E+N FR     LF  D + VPLVYTQVVT+A+YSYFL+CLIGRQF+  +   +    D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D NF++ +   D +  D   L KD ++D      P   + +   R   F GS +D+ +   D          G  GE   D L  + L    G+        + S   +K +  + +      S A +   E   P  S
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAG--------------TVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEARAPYTAATVFQLRQPSFQGSTFDITLAKEDMQFQRLDGLDGPMGEAPGDFLQ-RLLPAGAGMVAGGPLGRRLSFLLRKNSCVSEASTGASCSCAVVP--EGAAPECS 447          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-3 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17206])

HSP 1 Score: 239.58 bits (610), Expect = 1.124e-70
Identity = 130/388 (33.51%), Postives = 215/388 (55.41%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVN----VETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFE--LPMESNMKDARAKPFMGSVYDMKVD 1256
            MTV Y  +V S+      KLL +WKG ++K ++ + +V+  LY ++S IYR +L  + +  FE +  +     + IP+ F+LGFYVS VF R+W+ F+ + WI    + I  +              I+ + E A+  RR+ IRY   +  +    V+  V++RFP  + +   G++ E E    ++      + + P+ W  +++  A  +G I+++ + ++ ++++ +FR  +  L L D V VPLVYTQVV LAV SYFL  L GRQ++    N     + T D  VPI ++LQFI ++GW+K+A  L+NP+GEDD+DF+ N ++D N ++GL + D      P L KD+F++  + E     ES M+     P +GS  DM  +
Sbjct:    1 MTVTYSLDVASSSFFCLYKLLFRWKGSIWKSVWAELVVWLCLYAVLSVIYRCLLTMKQRATFEDLCIFFDTYSNFIPITFMLGFYVSAVFTRWWQIFDNIGWIDTPCLWITQY--------------IKGETERAKCVRRNCIRYSILTQAMVYRDVAASVRKRFPTFNHLVTAGLMTEKEMAEFESIPSPHAKYWQPMHWLFSMITLARDEGMISSDIIYVDLMEKMRQFRVNILSLTLFDWVPVPLVYTQVVHLAVRSYFLIALFGRQYLHPESNRLNDFKQTIDLYVPIMSLLQFIFFIGWMKVAEVLLNPLGEDDDDFECNWILDRNLQVGLMVVDTAYNRYPTLEKDQFWEDAIAEPLYTAESAMRP--LNPQVGSCADMPTE 372          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-24 (Bestrophin homolog 24 [Source:UniProtKB/Swiss-Prot;Acc:P34672])

HSP 1 Score: 238.424 bits (607), Expect = 4.121e-70
Identity = 128/382 (33.51%), Postives = 211/382 (55.24%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIM-DSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKV 1253
            MT+ Y   V ++ P    KLL KW+G ++K + ++  V+  LY ++S IYR  L    +R FE++V Y     S IP+ F+LGF+V+ V NR+   +  + +I  I +M A              E +R   E+AR+ RR+I+RY   + ++    +S+  +RRFP +D +   G ++ HE +     +    + ++P  W+ ++  +A  +G I ++   +    EI KFR  L  +   D V +P++Y Q+V LAV++YFL CL+ RQ+++ +  + +T  D   PI + LQFI YMGW+K+A  ++NP GEDD+DF+ N ++D N  + L + D      P L +D F+D++V  L  E   K     P  GSV D+K+
Sbjct:    1 MTINYNLAVSTSKPWTLFKLLLKWRGSIWKAVILELAVWLVLYGILSVIYRTALNPGQQRTFERIVQYCDSRLSYIPLNFMLGFFVTAVVNRWTYLYQIIGFIDNIGLMAA--------------EYVRGRTEQARMYRRNIVRYCELAQVLVFRDISMRTRRRFPTLDTVVAAGFMMPHEKDRFDEIQYKYSKYWVPFQWAFSLTYEARKKGLIESDYYQVVVQDEIKKFRTGLAWICNYDWVPIPIMYPQLVCLAVHTYFLVCLLARQYVVSEHADNKTEIDLYFPIMSTLQFIFYMGWMKVAEAMLNPFGEDDDDFECNALIDRNITMVLMMVDQGYDRAPDLKRDDFWDEEVEPLYSEETAK-IPNNPLKGSVSDVKL 367          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-4 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17205])

HSP 1 Score: 235.728 bits (600), Expect = 7.710e-70
Identity = 131/384 (34.11%), Postives = 219/384 (57.03%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHE-AEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ---DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFM-GSVYDM 1247
            MTV Y  +V ++G    +K+L +WKG V+K I+ + +++   Y+++S IYR++L    +  FE++ ++       IPV F+LGFYVS+V+NR+ + F+ V WI   A+ IA +              IR   E+ARL RR+ +RY+  + ++    VS  ++RRFP I  +   G+L E E  E    T P + + + PI W  ++V  A  +G I +  + ++ + ++ +FR  +  L + D V +PLVYTQVV LAV +YF+  L GRQF+ ++ N+   +   D   PI T LQ +  +GWLK++  ++NP+GEDDEDF+ N +++ N ++G A+ D      P L +D F++ +  +  M++     +A   M GS  +M
Sbjct:    1 MTVAYSLDVATSGLFTQIKVLLRWKGSVWKSIWSELLIWLLCYSILSVIYRILLNKAQREVFEQLCTFFDTFSVFIPVTFMLGFYVSIVYNRWTKVFDNVGWIDTSALTIAQY--------------IRGTSEKARLIRRNCVRYMIVAQVMVFRDVSPAIRRRFPTIKHLIGAGLLTEDELTEFDAITSPQS-KYWQPIQWLFSLVTVAKDEGLIADSYLYVDLIDKMREFRTKILNLVIFDMVPIPLVYTQVVNLAVRTYFVLALFGRQFLENNNNIPGAKWKIDIYFPIMTSLQIVFIVGWLKVSEVMLNPLGEDDEDFETNWIIERNLQVGYAVVDQAYGRYPTLKRDPFWEDETPQT-MDTPTSTRKAHSHMQGSCINM 368          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-22 (Bestrophin homolog 22 [Source:UniProtKB/Swiss-Prot;Acc:Q23369])

HSP 1 Score: 232.261 bits (591), Expect = 3.193e-69
Identity = 131/387 (33.85%), Postives = 213/387 (55.04%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQS-QSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFF--DKKVFELPMESNMKDARAKPFMGSVYDMKVDSN 1262
            MT+ Y  +V      +F  LL +W+G V+K ++    V+++++ +ISCIYR +L    +  FE+++ Y      + IP+ F+LGF+VS V  R+    N + WI   +++ A++              IR   EE R+ RR+++RYL  S  + L  +S+ V++RFP +D +   G++   E +I+ + +    + +  I WS  +V +   +G++ +  ++   V EI KFR  L  L   D V VPLVY QV+ LAV  YF+ CLIGRQFI+   N  +  D  +PI T++QF+VYMGW+K+A  L+NP+GEDD+D + N ++D N   G ++ +      P   KD+F+  DK      MES   +    P +GS   + +  N
Sbjct:    1 MTISYTLDVSQTNLQSFFSLLLRWRGSVWKAVFGQLAVWTAVFLLISCIYRYMLSPSQQDVFEQLIRYFDNKLDANIPLTFLLGFFVSFVVARWGSILNGIGWIDDASLLFATY--------------IRGADEETRVIRRNLVRYLVLSQALVLRDISMQVRKRFPTMDTLAASGLMTHEEMDILDHIKDPYSRYWTSIQWSLNLVYECQKKGKVDSYYLMNKIVDEIGKFRHGLASLLKYDWVPVPLVYPQVIFLAVRIYFMICLIGRQFIVTGPN-PSGIDLWLPITTMVQFLVYMGWMKVAEALLNPLGEDDDDLECNYIIDKNLITGYSMVEEHMAKTPAQKKDEFWGIDKIAPLYSMES--AERSVHPLVGSASKINLVKN 370          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-22 (Bestrophin homolog 22 [Source:UniProtKB/Swiss-Prot;Acc:Q23369])

HSP 1 Score: 231.876 bits (590), Expect = 5.259e-69
Identity = 131/387 (33.85%), Postives = 213/387 (55.04%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQS-QSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFF--DKKVFELPMESNMKDARAKPFMGSVYDMKVDSN 1262
            MT+ Y  +V      +F  LL +W+G V+K ++    V+++++ +ISCIYR +L    +  FE+++ Y      + IP+ F+LGF+VS V  R+    N + WI   +++ A++              IR   EE R+ RR+++RYL  S  + L  +S+ V++RFP +D +   G++   E +I+ + +    + +  I WS  +V +   +G++ +  ++   V EI KFR  L  L   D V VPLVY QV+ LAV  YF+ CLIGRQFI+   N  +  D  +PI T++QF+VYMGW+K+A  L+NP+GEDD+D + N ++D N   G ++ +      P   KD+F+  DK      MES   +    P +GS   + +  N
Sbjct:    1 MTISYTLDVSQTNLQSFFSLLLRWRGSVWKAVFGQLAVWTAVFLLISCIYRYMLSPSQQDVFEQLIRYFDNKLDANIPLTFLLGFFVSFVVARWGSILNGIGWIDDASLLFATY--------------IRGADEETRVIRRNLVRYLVLSQALVLRDISMQVRKRFPTMDTLAASGLMTHEEMDILDHIKDPYSRYWTSIQWSLNLVYECQKKGKVDSYYLMNKIVDEIGKFRHGLASLLKYDWVPVPLVYPQVIFLAVRIYFMICLIGRQFIVTGPN-PSGIDLWLPITTMVQFLVYMGWMKVAEALLNPLGEDDDDLECNYIIDKNLITGYSMVEEHMAKTPAQKKDEFWGIDKIAPLYSMES--AERSVHPLVGSASKINLVKN 370          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0082183)

HSP 1 Score: 293.893 bits (751), Expect = 4.034e-90
Identity = 150/369 (40.65%), Postives = 227/369 (61.52%), Query Frame = 3
Query:  111 MTVQYYQEVLSA-GPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTE---PFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ----DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVF--ELP 1187
            MT+ Y  EV +  G   FLKLL +W+G ++KL+++D + F ++Y  I+ +YR  L    K  FE +V Y    + LIP++F+LGFYVS+V  R+W  + ++PW   IA+ ++S+++       G D       E  R+ RR+I+RY+   L + L+ VS  VK+RFP ++ +   G+L ++E  II+      P   + +LPI W+A+I+ +A  +GRI ++  +   + E+NKFR     L   D + VPLVYTQVVTLAVYSYFL+C +G+Q+    V   TT     D   P+FT LQF  YMGWLK+A +L+NP GEDD+DF++N +VD N ++   I D +  D P L+KD+++D +VF  ELP
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVH-------GQD-------ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYWD-EVFPNELP 354          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0337020)

HSP 1 Score: 293.508 bits (750), Expect = 8.483e-90
Identity = 150/369 (40.65%), Postives = 227/369 (61.52%), Query Frame = 3
Query:  111 MTVQYYQEVLSA-GPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTE---PFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ----DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVF--ELP 1187
            MT+ Y  EV +  G   FLKLL +W+G ++KL+++D + F ++Y  I+ +YR  L    K  FE +V Y    + LIP++F+LGFYVS+V  R+W  + ++PW   IA+ ++S+++       G D       E  R+ RR+I+RY+   L + L+ VS  VK+RFP ++ +   G+L ++E  II+      P   + +LPI W+A+I+ +A  +GRI ++  +   + E+NKFR     L   D + VPLVYTQVVTLAVYSYFL+C +G+Q+    V   TT     D   P+FT LQF  YMGWLK+A +L+NP GEDD+DF++N +VD N ++   I D +  D P L+KD+++D +VF  ELP
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVH-------GQD-------ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYWD-EVFPNELP 354          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0114590)

HSP 1 Score: 293.893 bits (751), Expect = 1.461e-89
Identity = 150/369 (40.65%), Postives = 227/369 (61.52%), Query Frame = 3
Query:  111 MTVQYYQEVLSA-GPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTE---PFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ----DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVF--ELP 1187
            MT+ Y  EV +  G   FLKLL +W+G ++KL+++D + F ++Y  I+ +YR  L    K  FE +V Y    + LIP++F+LGFYVS+V  R+W  + ++PW   IA+ ++S+++       G D       E  R+ RR+I+RY+   L + L+ VS  VK+RFP ++ +   G+L ++E  II+      P   + +LPI W+A+I+ +A  +GRI ++  +   + E+NKFR     L   D + VPLVYTQVVTLAVYSYFL+C +G+Q+    V   TT     D   P+FT LQF  YMGWLK+A +L+NP GEDD+DF++N +VD N ++   I D +  D P L+KD+++D +VF  ELP
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVH-------GQD-------ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYWD-EVFPNELP 354          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0306023)

HSP 1 Score: 293.123 bits (749), Expect = 3.004e-89
Identity = 150/369 (40.65%), Postives = 227/369 (61.52%), Query Frame = 3
Query:  111 MTVQYYQEVLSA-GPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTE---PFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ----DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVF--ELP 1187
            MT+ Y  EV +  G   FLKLL +W+G ++KL+++D + F ++Y  I+ +YR  L    K  FE +V Y    + LIP++F+LGFYVS+V  R+W  + ++PW   IA+ ++S+++       G D       E  R+ RR+I+RY+   L + L+ VS  VK+RFP ++ +   G+L ++E  II+      P   + +LPI W+A+I+ +A  +GRI ++  +   + E+NKFR     L   D + VPLVYTQVVTLAVYSYFL+C +G+Q+    V   TT     D   P+FT LQF  YMGWLK+A +L+NP GEDD+DF++N +VD N ++   I D +  D P L+KD+++D +VF  ELP
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVH-------GQD-------ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYWD-EVFPNELP 354          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best4 (gene:FBgn0036491 transcript:FBtr0113172)

HSP 1 Score: 281.952 bits (720), Expect = 1.261e-87
Identity = 148/388 (38.14%), Postives = 234/388 (60.31%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVA-FLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTE---PFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDS 1259
            MTV Y   V ++  ++ FL LL +W+G ++KLI++D IVF  LY +++  YRL++ +E KR FE ++SY  ++ SLIP++F+LGF+V +V NR+W  + T+PW   IAI+I++              SI    + AR+ RR+I+RY+    +I  + +S  VKRRFP   +I   G LLE+E +II+  +   P   + ++PI W+A+IVM+A  + +I ++  +   + E+N+ R     L   D + VPLVYTQVVT+A YS+FL  ++G+Q+     + + T+     PI T+LQF  YMGWLK+A TL+NP GEDD+DF+LN ++D N  +   I D +  + P L+KD++++ +VF   +       R  P   S   M+  S
Sbjct:    1 MTVTYTSRVSTSSVLSNFLGLLVRWRGSIYKLIWLDLIVFFGLYCLLAITYRLLVNEEGKRFFEAIMSYCEKNGSLIPLSFVLGFFVRIVMNRWWDQYTTIPWPDGIAILIST--------------SIHGSDDRARVMRRTILRYVCLCQVIVFTMISPRVKRRFPTYTQIIEAGFLLENEKKIIEAMDQAFPSYPKHWMPIVWAASIVMRARRENKIRDDYAVKTIIDELNQLRGNCGFLLYYDWISVPLVYTQVVTVATYSFFLFSVLGQQWNESHSDEDGTRIRRWFPILTVLQFFFYMGWLKVAETLINPFGEDDDDFELNWIIDRNLTVSYCIVDEMHQEHPELVKDQYWE-EVFPNEIPYAQPKMRQNPPAASTAYMESQS 373          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 294.278 bits (752), Expect = 1.548e-90
Identity = 153/426 (35.92%), Postives = 237/426 (55.63%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRS 1385
            MTV Y + V  A    F +LL +WKG ++KL+Y + ++F+ +Y +IS  YR +L +E +R FEK+  Y  Q   LIPV+F+LGFYV+LV +R+W  F +VPW  +++ +++ H              +R   E ARL RRS++RY   S I+    VS  V +RFP +  +   G++   E   ++       + ++P  W  ++ M+A ++GRI N+  +   + E+N  R     L+  D + +PLVYTQVVT+AVYS+FL+CLIGRQF+  +        DF +P+FT+LQF  Y+GWLK+A  L+NP GEDD+DF+ N +VD N ++ L   D +    P + +DK++D+   + P  +   + R   FMGS  D+ V   +         I    E  +   ++ SL    GV   N  RS
Sbjct:    1 MTVTYSRRVADARLGTFYRLLLRWKGSIYKLLYRELLIFTVMYCIISITYRCVLTEEQRRMFEKLSLYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLSALVSGH--------------VRGADEGARLIRRSLMRYANLSGILIYRSVSTAVYKRFPTMSHLVQAGLMTAEELRQLQELPSPHNKFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEMYDLVPLVERDKYWDEAEPQPPYTAASAEHRKPSFMGSALDISVPKEEMEFQHNLEQIKEHEEANHSTPFLGSLSRLLGVQSPNFPRS 412          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 266.929 bits (681), Expect = 1.099e-82
Identity = 147/385 (38.18%), Postives = 213/385 (55.32%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILG--FYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKP-FMGSVYDMKV 1253
            MTV Y   V +A    F KLL  WKG ++K++Y +F+ F ++YT IS  YR  L D  KR FEK+  Y     SLIP++F+LG  FYV+LV NR+W  + ++P   ++       M  +S    G DE         RL RR+++RY + S ++ L  VS  V +RFP ID +   G +   E +  ++      + ++P  W   +   A  +GRI ++      ++E+N FR     LF  D + VPLVYTQVVTLAVYS+FL CLIGRQF+           D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D NF++ +   D +  D P + +D++++      P  +       KP F GS +DM +
Sbjct:    1 MTVTYTARVANARFCGFSKLLLAWKGSIYKVLYKEFLAFFAMYTAISITYRFFLVDGQKRYFEKLSIYCDNYASLIPMSFVLGMRFYVTLVVNRWWSQYTSIPLPDRV-------MCVLSGGVQGSDE-------RGRLLRRTLMRYSSLSALLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFESLHSPYNKYWIPCVWFTNLAAAARCEGRIKDDNTYKLLLEELNNFRGKCSMLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPGQGYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAVDEMYGDLPMMERDRYWNDSNPRPPYTAATLFVLRKPSFQGSTFDMTI 371          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 252.292 bits (643), Expect = 3.900e-78
Identity = 134/380 (35.26%), Postives = 216/380 (56.84%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKP-FMGSVYDM 1247
            MTV Y  +V +A    F KLL +WKG ++KL+Y +F+VF  LYT IS +YR +L +  +  F ++  +  +   LIP++F+LGFYV+  F R+W  + + P    + ++++ +++       G DE         RL RR+++RY   S ++ L  +S  V++RF  +++I   G +   E   + +      + ++P+ W A +  +A  +GR+ ++  L   + E+N +R     LF  D + +PLVYTQVVT+AVYS+F   LIGRQF+    + E   D  +PIFT+L+F  Y GWLK+   ++NP GEDD+DF+ N ++D N ++ +   D +  + PPL KDK++  K    P       A  KP FMGS +DM
Sbjct:    1 MTVSYTLKVANAKFGGFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNNNQQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVH-------GTDE-------RGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTLEDIVEAGFMTTDELRKLNHLYSDFNKYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFV-KPASSEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAVDDMHQNLPPLEKDKYWVDKGPSYP------SASMKPVFMGSTHDM 359          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 228.409 bits (581), Expect = 2.426e-69
Identity = 116/330 (35.15%), Postives = 192/330 (58.18%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEI 1100
            MTV Y  +V +A    F KLL +WKG ++KL+Y +F+VF  LYT IS +YR +L +  +  F ++  +  +   LIP++F+LGFYV+  F R+W  + + P    + ++++ +++       G DE         RL RR+++RY   S ++ L  +S  V++RF  +++I   G +   E   + +      + ++P+ W A +  +A  +GR+ ++  L   + E+N +R     LF  D + +PLVYTQVVT+AVYS+F   LIGRQF+    + E   D  +PIFT+L+F  Y GWLK+   ++NP GEDD+DF+ N ++D N ++
Sbjct:    1 MTVSYTLKVANAKFGGFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNNNQQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVH-------GTDE-------RGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTLEDIVEAGFMTTDELRKLNHLYSDFNKYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFV-KPASSEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQV 315          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 164.466 bits (415), Expect = 2.377e-45
Identity = 85/231 (36.80%), Postives = 129/231 (55.84%), Query Frame = 3
Query:  696 FLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRS 1385
            ++P  W  ++ M+A ++GRI N+  +   + E+N  R     L+  D + +PLVYTQVVT+AVYS+FL+CLIGRQF+  +        DF +P+FT+LQF  Y+GWLK+A  L+NP GEDD+DF+ N +VD N ++ L   D +    P + +DK++D+   + P  +   + R   FMGS  D+ V   +         I    E  +   ++ SL    GV   N  RS
Sbjct:   22 WVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEMYDLVPLVERDKYWDEAEPQPPYTAASAEHRKPSFMGSALDISVPKEEMEFQHNLEQIKEHEEANHSTPFLGSLSRLLGVQSPNFPRS 252          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: ifitm3 (interferon induced transmembrane protein 3 [Source:Xenbase;Acc:XB-GENE-5852510])

HSP 1 Score: 283.108 bits (723), Expect = 2.815e-86
Identity = 148/394 (37.56%), Postives = 225/394 (57.11%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ--DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKV-DS----NDWI 1271
            MTV Y  +V +A    F +LL KW+G ++KL+Y +F++F+SLYT +S IYR  L D  KR FEKV  Y  +    IPV F+LGFYV+LV NR+W  F  +PW  ++  +I+S+++       G DE         RL RR+++RY+  + ++    VS  V +RFP +D +   G +   E ++  + +   ++ ++P+ W   +  KA ++GRI +   L   + E+NKFR     LF  D V +PLVYTQVVTLAVY++F +C+IGRQF +D          D  +P+FT+LQF  Y GWLK+A  L+NP GEDD+DF+ N  +D N ++ L   D + ++ P + +D +++      P      D     F+GS   M + DS     DW+
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFLLFTSLYTTLSVIYRFFLTDSQKRYFEKVSMYCDKYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSNVH-------GRDEY-------GRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTSDERKLFDSLKSPHLKYWVPVIWFGNLASKARSEGRIRDSIDLQMMMNEMNKFRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQF-LDPKQAYPGHDLDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLMAVDEMHMNLPKMNRDIYWNDSDVRPPYTLAAADYCIPSFLGSTVHMGLPDSVFLREDWL 379          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: cyp2b6 (cytochrome P450 family 2 subfamily B member 6 [Source:Xenbase;Acc:XB-GENE-5779150])

HSP 1 Score: 277.33 bits (708), Expect = 1.308e-85
Identity = 146/382 (38.22%), Postives = 220/382 (57.59%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKP-FMGSVYDMK 1250
            MTV Y  +V +A    F KLL +WKG ++KL+Y +FIVF  LY M+S  YR +L ++ K +F ++  Y  Q   LIPV+F+LGFYV+L+ NR+W  +  +P   ++  +++S++      + GD        E  RL RR+++RY   S ++ L  VS  V +RFP ++ I   G +   E +  +       + ++P  W   +  +A   GR+ ++  L   + E+NK+R     LF  D + VPLVYTQVVT+AVYS+F  C+IGRQF+   +  E    D  VPIFT+LQF  Y GWLK+A  ++NP GEDD+DF+ N ++D N ++ L   D +  + PPL KDK++D +    P          KP FMGS +DM+
Sbjct:    1 MTVSYTLKVANASFGCFFKLLFRWKGSIYKLLYKEFIVFCCLYAMLSVTYRCLLNEKQKSEFAQLARYCNQYTDLIPVSFVLGFYVTLIVNRWWAQYTNIPLPDQLMCVVSSNV------HGGD--------ERGRLLRRTMMRYANLSSVLILRSVSTRVLKRFPTMEHIVEAGFMTREELKKYECLFSDYNKYWIPCVWFTNLAAQARRDGRVRDDVALKLLMDELNKYRAKCSMLFHYDWISVPLVYTQVVTIAVYSFFGVCIIGRQFLEPELEEEKPNIDLYVPIFTLLQFFFYSGWLKVAQQIINPFGEDDDDFETNRLIDRNLQVSLLSVDDMYQNLPPLEKDKYWDDQTAAPPYTLATAAETLKPSFMGSAFDMR 368          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 271.166 bits (692), Expect = 6.374e-85
Identity = 139/382 (36.39%), Postives = 219/382 (57.33%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKV 1253
            MTV Y   V  A    F +LL +W+G ++KL+Y +F++F S Y +IS  YR +L ++ +  FEK+  Y      LIPV+F+LGFYV+LV +R+W  + +VPW  ++  +++S+++       G D       E  R+ RR+++RY   + ++ L  VS  V  RFP +  + N G +   E            + ++P  W A + + A ++GRI +  VL   +KE+N  R     L+  D + VPLVYTQVVT+AVYS+FL+CLIGRQF+           D  VP+FT+LQF  Y GWLK+A  L+NP G+DD+DF+ N ++D N ++ L   D +  D PPL KD +++    + P  ++  + R   + GS +D+++
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVH-------GTD-------ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYWNDSDPQPPYTASTVETRRPSYQGSAFDIRI 368          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 270.011 bits (689), Expect = 1.194e-83
Identity = 139/380 (36.58%), Postives = 217/380 (57.11%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDM 1247
            MTV Y   V  A    F +LL +W+G ++KL+Y +F++F S Y +IS  YR +L ++ +  FEK+  Y      LIPV+F+LGFYV+LV +R+W  + +VPW  ++  +++S+++       G D       E  R+ RR+++RY   + ++ L  VS  V  RFP +  + N G +   E            + ++P  W A + + A ++GRI +  VL   +KE+N  R     L+  D + VPLVYTQVVT+AVYS+FL+CLIGRQF+           D  VP+FT+LQF  Y GWLK+A  L+NP G+DD+DF+ N ++D N ++ L   D +  D PPL KD +++    + P  ++  + R   + GS +D+
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVH-------GTD-------ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYWNDSDPQPPYTASTVETRRPSYQGSAFDI 366          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 274.633 bits (701), Expect = 1.200e-83
Identity = 140/386 (36.27%), Postives = 219/386 (56.74%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSND 1265
            MTV Y   V  A    F +LL +W+G ++KL+Y +F++F S Y +IS  YR +L ++ +  FEK+  Y      LIPV+F+LGFYV+LV +R+W  + +VPW  ++  +++S+++       G D       E  R+ RR+++RY   + ++ L  VS  V  RFP +  + N G +   E            + ++P  W A + + A ++GRI +  VL   +KE+N  R     L+  D + VPLVYTQVVT+AVYS+FL+CLIGRQF+           D  VP+FT+LQF  Y GWLK+A  L+NP G+DD+DF+ N ++D N ++ L   D +  D PPL KD +++    + P  ++  + R   + GS +D+ +   D
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVH-------GTD-------ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYWNDSDPQPPYTASTVETRRPSYQGSAFDISLQKED 372          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best3 (bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298])

HSP 1 Score: 288.115 bits (736), Expect = 2.757e-88
Identity = 156/439 (35.54%), Postives = 236/439 (53.76%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVN-VETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVD-----SNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNS---NRSQKSMF 1400
            MTV Y  +V +A    F +LL KW+G ++KL+Y +FIVF+ LYT IS +YRL+L    KR FEK+  Y  +    IPV F+LGFYV+LV NR+W  F  +PW  ++ ++I+S              S+    +  RL RR+++RY+  + ++    VS  V +RFP +D +   G +   E ++  + +   ++ ++P  W   +  KA  +GRI +   L + + E+N++R     LF  D V +PLVYTQVVTLAVY++F +CLIGRQF+  +   V    D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N  +D N ++ L   D + +  P + KD ++D      P      D     F+GS   M +      + DW+ + +         +R  K ++ + E      R  S     S  SMF
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGAQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISS--------------SVHGSDQHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTADERKLFDHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCIPSFLGSTIQMGLSGSNFPAEDWLWNYEKHG-NRHSVMRRVKRFLSTHEHPGSPRRRRSFGRQASDSSMF 424          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 274.633 bits (701), Expect = 5.951e-86
Identity = 140/386 (36.27%), Postives = 225/386 (58.29%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSND 1265
            MT+ Y  +V +A   +F  LL  W+G ++KL+Y +F+VF  LY  I  +YR++L  + +  FEK+  Y      LIP++F+LGFYV+LV +R+W  +  +PW  ++ I ++S +        G DE       E RL RR++IRY     ++ L  +S  V +RFP +  +   G +   E + ++         ++P  W A + MKA   GRI +  +L + + E+   R    +L+  D + +PLVYTQVVT+AVYS+FL+CLIGRQF+  + +    + D VVP+FTILQF+ YMGWLK+A  L+NP GEDD+DF+ N ++D N ++ L   DG+  + PP+ +D ++++   + P  +    +R   FMGS +++ +   D
Sbjct:    1 MTITYTNKVANARLGSFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSSDQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVE-------GKDE-------EGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHLVLAGFMTHGEHKQLQKLGLPHNTFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPMERDMYWNEAAPQPPYTAASARSRRHSFMGSTFNISLKKED 372          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 276.174 bits (705), Expect = 6.276e-85
Identity = 140/386 (36.27%), Postives = 225/386 (58.29%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSND 1265
            MT+ Y  +V +A   +F  LL  W+G ++KL+Y +F+VF  LY  I  +YR++L  + +  FEK+  Y      LIP++F+LGFYV+LV +R+W  +  +PW  ++ I ++S +        G DE       E RL RR++IRY     ++ L  +S  V +RFP +  +   G +   E + ++         ++P  W A + MKA   GRI +  +L + + E+   R    +L+  D + +PLVYTQVVT+AVYS+FL+CLIGRQF+  + +    + D VVP+FTILQF+ YMGWLK+A  L+NP GEDD+DF+ N ++D N ++ L   DG+  + PP+ +D ++++   + P  +    +R   FMGS +++ +   D
Sbjct:    1 MTITYTNKVANARLGSFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSSDQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVE-------GKDE-------EGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHLVLAGFMTHGEHKQLQKLGLPHNTFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPMERDMYWNEAAPQPPYTAASARSRRHSFMGSTFNISLKKED 372          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 273.092 bits (697), Expect = 3.060e-84
Identity = 155/442 (35.07%), Postives = 235/442 (53.17%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNV-ETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKP-FMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSS 1430
            MTV Y   V +A    F +LL  W+G ++KL++ + + F  LY  +S  YR +L +E KR FEK+V Y  Q  SLIPV+F+LGFYV+LV +R+W  +  +P    +  ++A               ++    +  RL RR+++RY   S ++ L  VS  V +RFP ID +   G +   E +  +N      + ++P  W +++  +A  +GRI + + L   ++E+N FR     LF  D + +PLVYTQVVT+AVYSYFL+CLIGRQF+  +    + T D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D NF++ +   D +  D   L KD ++D      P  +       +P F GS +D+ +   D          G  GE+  D  ++Q L      S     R    +  K   +S +S
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAG--------------TVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAAEARAPYTAATAFLLQQPSFQGSTFDIALAKEDMQFQRLDGVDGPLGEVHGD--FLQRLLPAGAGSVGPLGRRLSLLRRKNSCVSEAS 426          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 273.092 bits (697), Expect = 3.060e-84
Identity = 155/442 (35.07%), Postives = 235/442 (53.17%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNV-ETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKP-FMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSS 1430
            MTV Y   V +A    F +LL  W+G ++KL++ + + F  LY  +S  YR +L +E KR FEK+V Y  Q  SLIPV+F+LGFYV+LV +R+W  +  +P    +  ++A               ++    +  RL RR+++RY   S ++ L  VS  V +RFP ID +   G +   E +  +N      + ++P  W +++  +A  +GRI + + L   ++E+N FR     LF  D + +PLVYTQVVT+AVYSYFL+CLIGRQF+  +    + T D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D NF++ +   D +  D   L KD ++D      P  +       +P F GS +D+ +   D          G  GE+  D  ++Q L      S     R    +  K   +S +S
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAG--------------TVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAAEARAPYTAATAFLLQQPSFQGSTFDIALAKEDMQFQRLDGVDGPLGEVHGD--FLQRLLPAGAGSVGPLGRRLSLLRRKNSCVSEAS 426          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6H1V1|BEST3_MOUSE (Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 1.928e-87
Identity = 156/439 (35.54%), Postives = 236/439 (53.76%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVN-VETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVD-----SNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNS---NRSQKSMF 1400
            MTV Y  +V +A    F +LL KW+G ++KL+Y +FIVF+ LYT IS +YRL+L    KR FEK+  Y  +    IPV F+LGFYV+LV NR+W  F  +PW  ++ ++I+S              S+    +  RL RR+++RY+  + ++    VS  V +RFP +D +   G +   E ++  + +   ++ ++P  W   +  KA  +GRI +   L + + E+N++R     LF  D V +PLVYTQVVTLAVY++F +CLIGRQF+  +   V    D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N  +D N ++ L   D + +  P + KD ++D      P      D     F+GS   M +      + DW+ + +         +R  K ++ + E      R  S     S  SMF
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGAQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISS--------------SVHGSDQHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTADERKLFDHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCIPSFLGSTIQMGLSGSNFPAEDWLWNYEKHG-NRHSVMRRVKRFLSTHEHPGSPRRRRSFGRQASDSSMF 424          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8N1M1|BEST3_HUMAN (Bestrophin-3 OS=Homo sapiens OX=9606 GN=BEST3 PE=1 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 2.993e-87
Identity = 145/386 (37.56%), Postives = 217/386 (56.22%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSND 1265
            MTV Y  +V +A    F +LL KW+G ++KL+Y +FIVF+ LYT IS +YRL+L    KR FEK+  Y  +    IPV F+LGFYV+LV NR+W  F  +PW  ++  +I+S              S+    E  RL RR+++RY+  + ++    VS  V +RFP +D +   G +   E ++  + +   ++ ++P  W   +  KA  +GRI +   L + + E+N++R     LF  D V +PLVYTQVVTLAVY++F +CLIGRQF+  +        D  +PIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N  +D N ++ L   D + +  P + KD ++D      P      D     F+GS   M +  +D
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISS--------------SVHGSDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCIPSFLGSTVQMGLSGSD 372          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|O88870|BEST1_MOUSE (Bestrophin-1 OS=Mus musculus OX=10090 GN=Best1 PE=2 SV=3)

HSP 1 Score: 276.174 bits (705), Expect = 4.390e-84
Identity = 140/386 (36.27%), Postives = 225/386 (58.29%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSND 1265
            MT+ Y  +V +A   +F  LL  W+G ++KL+Y +F+VF  LY  I  +YR++L  + +  FEK+  Y      LIP++F+LGFYV+LV +R+W  +  +PW  ++ I ++S +        G DE       E RL RR++IRY     ++ L  +S  V +RFP +  +   G +   E + ++         ++P  W A + MKA   GRI +  +L + + E+   R    +L+  D + +PLVYTQVVT+AVYS+FL+CLIGRQF+  + +    + D VVP+FTILQF+ YMGWLK+A  L+NP GEDD+DF+ N ++D N ++ L   DG+  + PP+ +D ++++   + P  +    +R   FMGS +++ +   D
Sbjct:    1 MTITYTNKVANARLGSFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSSDQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVE-------GKDE-------EGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHLVLAGFMTHGEHKQLQKLGLPHNTFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPMERDMYWNEAAPQPPYTAASARSRRHSFMGSTFNISLKKED 372          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8BGM5|BEST2_MOUSE (Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 2.789e-83
Identity = 155/442 (35.07%), Postives = 235/442 (53.17%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNV-ETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKP-FMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSS 1430
            MTV Y   V +A    F +LL  W+G ++KL++ + + F  LY  +S  YR +L +E KR FEK+V Y  Q  SLIPV+F+LGFYV+LV +R+W  +  +P    +  ++A               ++    +  RL RR+++RY   S ++ L  VS  V +RFP ID +   G +   E +  +N      + ++P  W +++  +A  +GRI + + L   ++E+N FR     LF  D + +PLVYTQVVT+AVYSYFL+CLIGRQF+  +    + T D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D NF++ +   D +  D   L KD ++D      P  +       +P F GS +D+ +   D          G  GE+  D  ++Q L      S     R    +  K   +S +S
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAG--------------TVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAAEARAPYTAATAFLLQQPSFQGSTFDIALAKEDMQFQRLDGVDGPLGEVHGD--FLQRLLPAGAGSVGPLGRRLSLLRRKNSCVSEAS 426          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8NFU1|BEST2_HUMAN (Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.058e-80
Identity = 156/464 (33.62%), Postives = 236/464 (50.86%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELP-MESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSSGISMFTSTASLKGLEAITPTIS 1496
            MTV Y   V +A    F +LL  W+G ++KL++ + + F   Y  +S  YR +L +  KR FEK+V Y  Q  SLIPV+F+LGFYV+LV NR+W  +  +P    +  ++A               ++    +  RL RR+++RY   S ++ L  VS  V +RFP ID +   G +   E +  +N      + ++P  W + +  +A  +GRI + + L   ++E+N FR     LF  D + VPLVYTQVVT+A+YSYFL+CLIGRQF+  +   +    D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D NF++ +   D +  D   L KD ++D      P   + +   R   F GS +D+ +   D          G  GE   D L  + L    G+        + S   +K +  + +      S A +   E   P  S
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAG--------------TVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEARAPYTAATVFQLRQPSFQGSTFDITLAKEDMQFQRLDGLDGPMGEAPGDFLQ-RLLPAGAGMVAGGPLGRRLSFLLRKNSCVSEASTGASCSCAVVP--EGAAPECS 447          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A068Y3U9 (Bestrophin homolog OS=Echinococcus multilocularis OX=6211 PE=3 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 9.999e-127
Identity = 207/475 (43.58%), Postives = 292/475 (61.47%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETT--QDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKV------DSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSSGISMFTSTASLKGLEAITPTISKMPEE 1511
            MTVQY Q+VL+ GPV FL+LL +WKG V KLIY+DFIVF   Y ++SCIYR  L    ++QFE VV YV+  Q +IP++FILGFYV LVF+RFW+ FN+VPW+    + +   +               + +  AR  RR+ +RY+ ASLII  SR+ V  K+RFP    +   GIL + E ++I +T+P   QPFLP+ W+  I M+A   G I N   L+N ++ IN FR+ L  LFL+D+VCVPLVYTQVVTLAVYSYFLS +IGRQFI+++ +      +D+ VP++TIL+FIVYMGWLK+A TLVNPMGEDDEDFD+N ++D N+  G+ + D  K     L++DKF+D     LP  ++ K  ++   +GSV+++ V      D N    S  ++  G E E  +D L+ +SL       R  S+ S +       + ST   I     + S    EA+ P ++++ E+
Sbjct:    1 MTVQYNQDVLTGGPVVFLRLLLRWKGCVIKLIYIDFIVFILAYAVVSCIYRFALTASQQKQFESVVLYVFDFQQMIPISFILGFYVQLVFSRFWQQFNSVPWVFTPTLAVIGAI---------------QGEGRARAIRRTCVRYMNASLIIASSRLHVAAKKRFPTTQHLVQAGILTQREGDLIDSTDPVAAQPFLPLVWATAISMRAEKDGYIRNPHALVNLIQVINGFRESLLRLFLMDKVCVPLVYTQVVTLAVYSYFLSSIIGRQFIVNTSDYSEPFRKDYYVPLYTILEFIVYMGWLKVAETLVNPMGEDDEDFDINAIIDCNWSYGMHMVDR-KYHPTELVRDKFWDSTNVSLPHTADSKKLQSTQMIGSVFNIDVLGTDPHDRNLNTVSAVNLHTGFESEDHHDVLH-ESLG-----PRFKSSDSLEMHNLSGDSPSTPCSIQSTMISPSTNAGEAVLPALAEVDED 453          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A5K3EZP5 (Bestrophin homolog OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 6.358e-126
Identity = 189/388 (48.71%), Postives = 257/388 (66.24%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETT--QDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPP-LIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSND 1265
            MTVQY Q+VL+ GPV FL+LL +WKG V KLIY+DFIVF   Y ++SC+YR  L  E ++ FE VV YV+  Q +IP++FILGFYV LVF+RFW+HFN+VPW+    + +   +               + +  AR  RR+ +RY+ ASLII  SR+ V  K+RFP    +   GIL + E ++I +T+P + QPFLP+ W+  I M+A   G I N   L+N ++ +N FR+ L  LFL+D+VCVPLVYTQVVTLAVYSYFLS +IGRQFI+DS    +   +D+ VP +TIL+FIVYMGWLK+A TLVNPMGEDDEDFD+N ++D N+  G+ + D  K   P  L++DKF+D     LP  +  K   +    GS+Y++ V + D
Sbjct:    1 MTVQYNQDVLTGGPVVFLRLLLRWKGCVVKLIYVDFIVFMLAYAIVSCVYRFALTAEQQKNFESVVLYVFDFQQMIPISFILGFYVQLVFSRFWQHFNSVPWVFTPTLAVIGAI---------------QGEGRARTIRRTCVRYMNASLIIASSRLHVAAKKRFPTTQHLVQAGILTQREGDLIDSTDPVSAQPFLPLVWTTAIAMRAEKDGLIQNPHALVNLIQVVNNFRESLLRLFLMDKVCVPLVYTQVVTLAVYSYFLSSIIGRQFILDSSEYSSPFRKDYYVPFYTILEFIVYMGWLKVAETLVNPMGEDDEDFDINNIIDSNWSYGMHMVD--KKHHPTELVRDKFWDSSNVILPHTAGSKKLLSTQMTGSMYNLDVATLD 371          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A068WMI5 (Bestrophin homolog OS=Echinococcus granulosus OX=6210 GN=EgrG_000672700 PE=3 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 1.200e-125
Identity = 210/476 (44.12%), Postives = 293/476 (61.55%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETT--QDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKV------DSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSSGI-SMFTSTASLKGLEAITPTISKMPEE 1511
            MTVQY Q+VL+ GPV FL+LL +WKG V KLIY+DFIVF   Y ++SCIYR  L    ++QFE VV YV+  Q +IP++FILGFYV LVF+RFW+ FN+VPW+    + +   +               + +  AR  RR+ +RY+ ASLII  SR+ V  K+RFP    +   GIL + E ++I +T P   QPFLP+ W+  I M+A   G I N   L+N ++ IN FR+ L  LFL+D+VCVPLVYTQVVTLAVYSYFLS +IGRQFI+++ +      +D+ VP++TIL+FIVYMGWLK+A TLVNPMGEDDEDFD+N ++D N+  G+ + D  K     L++DKF+D     LP  ++ K  ++   +GSV+++ V      D N    +  ++  G E E  ND L  +SL       R  S+ S +       + ST   I S   S A+  G EA+ P ++++ E+
Sbjct:    1 MTVQYNQDVLTGGPVVFLRLLLRWKGCVIKLIYIDFIVFILAYAVVSCIYRFALTASQQKQFESVVLYVFDFQQMIPISFILGFYVQLVFSRFWQQFNSVPWVFTPTLAVIGAI---------------QGEGRARAIRRTCVRYMNASLIIASSRLHVAAKKRFPTTQHLVQAGILTQREGDLIDSTNPVAAQPFLPLVWATAISMRAEKDGYIRNSHALVNLIQVINGFRESLLRLFLMDKVCVPLVYTQVVTLAVYSYFLSSIIGRQFIVNTSDYSEPFRKDYYVPLYTILEFIVYMGWLKVAETLVNPMGEDDEDFDINAIIDCNWSYGMHMVDR-KYHPTELVRDKFWDSTNVSLPHTADSKKLQSTQMIGSVFNIDVLGTDPHDRNLNTVNAVNLHTGLESEDHNDVLR-ESLG-----PRFKSSESLEMHNLPGDSPSTPCSIQSTMISPATNPG-EAVLPALAEVDED 453          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A0R3UIX4 (Bestrophin homolog OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7414 PE=3 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 1.758e-125
Identity = 187/383 (48.83%), Postives = 255/383 (66.58%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVET--TQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPP-LIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMK 1250
            MTVQY Q+VL+ GPV FL+LL +WKG V KLIY+DFIVF   Y ++SC+YR  L  E ++ FE VV YV+  Q +IP++FILGFYV LVF+RFW+HFN+VPW+    + +   +               + +  AR  RR+ +RY+ ASLII  SR+ V  K+RFP    +   GIL + E ++I +T+P + QPFLP+ W+  I M+A   G I N   L+N ++ +N FR+ L  LFL+D+VCVPLVYTQVVTLAVYSYFLS +IGRQFI+DS    +   +D+ VP +TIL+FIVYMGWLK+A TLVNPMGEDDEDFD+N ++D N+  G+ + D  K   P  L++DKF+D     LP  +  K   +    GS+Y+++
Sbjct:    1 MTVQYNQDVLTGGPVVFLRLLLRWKGCVVKLIYVDFIVFMLAYAIVSCVYRFALTAEQQKNFESVVLYVFDFQQMIPISFILGFYVQLVFSRFWQHFNSVPWVFTPTLAVIGAI---------------QGEGRARTIRRTCVRYMNASLIIASSRLHVAAKKRFPTTQHLVQAGILTQREGDLIDSTDPVSAQPFLPLVWTTAIAMRAEKDGLIQNPHALVNLIQVVNNFRESLLRLFLMDKVCVPLVYTQVVTLAVYSYFLSSIIGRQFILDSSEYSSPFRKDYYVPFYTILEFIVYMGWLKVAETLVNPMGEDDEDFDINNIIDSNWSYGMHMVD--KKHHPTELVRDKFWDSSNVILPHTAGSKKLLSTQMTGSMYNLE 366          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A504YTL7 (Bestrophin homolog OS=Fasciola gigantica OX=46835 GN=FGIG_08961 PE=3 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 3.786e-120
Identity = 186/411 (45.26%), Postives = 268/411 (65.21%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ---DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSN-DWITSLKSIAIGSEGE-LRNDKL 1328
            MTVQY Q VL+ GP  F +LL KW+G VFKLIY D +VF +LY +ISCIYR  L  E +R FE+++ +    Q++IPVAFILGFY++L+FNRFW  F  +PW+ K AI + +++       SG D       +  RL RR+ +RY+  SLI+T +R+SV  K+RFP ++   + G+  + E ++I   +P  +Q F+PI W+ +++  A  + R+TN+  L+  + E+N FRQ L +LF +D VCVPLVYTQVVTL+VYSYF++ L+GRQ+IM+S      Q   D   P FT+L+FI+YMGWLK+A TLVNPMGEDDEDFD+N V+D+N++    I DG+K   P +++D  + + V ELP     +   ++P  GSVYD+ V S  D+  S  S+  G   + +R  +L
Sbjct:    1 MTVQYNQLVLTGGPGVFFRLLLKWRGCVFKLIYFDILVFGTLYAIISCIYRFALSSEMQRSFERLILFTNNFQAMIPVAFILGFYINLIFNRFWYQFGIIPWVLKFAIALVTNV-------SGFD-------DRTRLIRRTCVRYVLGSLILTTARISVAAKKRFPTMESFVSGGVFTDEEIKMIMAQQPH-VQSFVPIVWATSLITLAEKERRLTNQHALVLLIDELNNFRQGLLKLFFMDYVCVPLVYTQVVTLSVYSYFIASLLGRQYIMESSPFSKEQNLRDLYFPFFTMLEFIIYMGWLKVAETLVNPMGEDDEDFDINEVIDFNWKTAWCIVDGMKPSPPAVVRDIHWHQSVVELPHTEESRRLLSRPCRGSVYDLNVQSTADYFGSGVSLHGGRRSQDVRGRRL 396          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 285.804 bits (730), Expect = 5.543e-87
Identity = 144/383 (37.60%), Postives = 226/383 (59.01%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLI-KDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKV 1253
            MTV Y + V  A    F  LL +WKG ++KL+Y + ++F+ LY  IS +YR +L +E +R FEK+  Y  Q   LIPV+F+LGFYV+LV +R+W  F +VPW  ++A ++ ++              +R   E ARL RRS++RY   S ++    +S  V +RFP I+ +   G++   E   + +      + ++P  W   + ++A T+GRI N+  L   + E+N  R    +L+  D + +PLVYTQVVT+AVYS+FL+CLIGRQF+  +        DF +P+FT+LQF  Y+GWLK+A  L+NP GEDD+DF+ N +VD N ++ L   D +  D  PL+ +DK++++   + P  +   + +   +MGS  D+ V
Sbjct:    1 MTVTYSRRVADARLGTFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDNEQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAY--------------VRGADEGARLIRRSLVRYANLSGVLIYRSISTAVYKRFPTIEHLVQAGLMTVEERRQLDDLPSPHNKFWVPCMWFVNLALRARTEGRINNDVALSAILNELNTLRSQCMKLYSYDWISLPLVYTQVVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEM-YDLVPLVERDKYWNESEPQPPYTAASAEHKKPSYMGSALDISV 368          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 270.781 bits (691), Expect = 5.949e-82
Identity = 145/383 (37.86%), Postives = 215/383 (56.14%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKP-FMGSVYDMKV 1253
            MTV Y   V +A    F KLL  W+G ++K++Y + + F  LYT IS  YR  L DE KR FEK+  Y     SLIP++F+LGFYV+L+ NR+W  + ++P    I  +++  +        GD        E  RL RR+++RY + + ++ L  VS  V +RFP +D +   G +   E +  ++      + ++P  W   +   A ++GRI ++      ++E+NKFR     LF  D + VPLVYTQVVTLAVYS+FL CLIGRQF+  S        D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D NF++ +   D +  D P + +D++++      P  +       KP F GS +DM +
Sbjct:    1 MTVTYTARVANARFCGFSKLLLAWRGSIYKVLYKEVLAFFILYTAISITYRFFLLDEQKRYFEKLSIYCNHYASLIPMSFVLGFYVTLIVNRWWSQYTSIPLPDSIMCVLSGGLQ------GGD--------ERGRLLRRTLMRYASLASLLILRSVSTAVFKRFPTMDHVVEAGFMTREERKKFESLHSPYNKYWIPCVWFTNLAAVARSEGRIKDDNTYKLLLEELNKFRGKCSLLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQAYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAVDEMFGDLPMMERDRYWNDSNPRPPYTAATLFVLRKPSFQGSTFDMAI 369          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 256.529 bits (654), Expect = 9.065e-80
Identity = 142/385 (36.88%), Postives = 218/385 (56.62%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQ-VVTLAVYSYFLSCLIGRQFI----MDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKP-FMGSVYDM 1247
            MTV Y  EV +A    F KLL +WKG ++KL+Y +F++F  LY++ S IYR +L D  +  FE+   +  +   LIP++F+L FYV+  F R+W  + + P    + ++++ +++       G DE         RL RR+++RY   S ++ L  +S  V +RFP +  I +   + E E   + +      + ++P+TW A +  KA  +GR+ ++  L   + E+N +R     LF  D + +PLVYTQ VVTLAVYS+F  CLIGRQF+     D + V    D  VP+FT+L+F  Y GWLK+   ++NP GEDD+DF+ N ++D N ++ +   D +  + PPL KDK++  K F  P         AKP FMGS YDM
Sbjct:    1 MTVSYTLEVANARFAGFTKLLFRWKGSIYKLLYKEFLLFCFLYSLFSLIYRCVLTDGQQELFERAARHCNKFAKLIPMSFVL-FYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVH-------GSDE-------RGRLLRRTLMRYANLSSVLILRSISTRVHKRFPTLQHIVD-AFMTEEEMRTLDHLYSDFNKYWMPLTWFANLASKAREEGRVKDDIALRLLMDELNNYRGKCSMLFHYDWISIPLVYTQQVVTLAVYSFFAFCLIGRQFVKPERADELKVHV--DLYVPVFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAVDDMHQNLPPLEKDKYWTDKSFSRPFSP------AKPIFMGSTYDM 361          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 248.44 bits (633), Expect = 2.737e-73
Identity = 133/383 (34.73%), Postives = 210/383 (54.83%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLI-KDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKV 1253
            MTV Y + V  A    F  LL +WKG ++KL+Y + ++F+ LY  IS +YR +L +E +R FEK+  Y  Q   LIPV+F+LGFYV+LV +R+W  F +VPW  ++A ++ ++              +R   E ARL RRS++RY   S ++    +S  V +RFP I+ +   G++   E   + +      + ++P  W   + ++A T+GRI N+  L   +                           VVT+AVYS+FL+CLIGRQF+  +        DF +P+FT+LQF  Y+GWLK+A  L+NP GEDD+DF+ N +VD N ++ L   D +  D  PL+ +DK++++   + P  +   + +   +MGS  D+ V
Sbjct:    1 MTVTYSRRVADARLGTFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDNEQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAY--------------VRGADEGARLIRRSLVRYANLSGVLIYRSISTAVYKRFPTIEHLVQAGLMTVEERRQLDDLPSPHNKFWVPCMWFVNLALRARTEGRINNDVALSAILN--------------------------VVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEM-YDLVPLVERDKYWNESEPQPPYTAASAEHKKPSYMGSALDISV 342          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 153.295 bits (386), Expect = 2.977e-40
Identity = 81/227 (35.68%), Postives = 122/227 (53.74%), Query Frame = 3
Query:  576 RVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKV 1253
            ++S+   R    I   F  G +   E +I +N +   ++ ++P  W   +  KA   GRI +   L   + E+N+FR     LF  D V +PLVYTQVVTLAVY++F + +IGRQF+  +        D  VP+FT+LQF  Y GWLK+A  L+NP GEDD+DF+ N  +D N ++ L   D + ++ P + KD +++      P      D     F+GS  DM +
Sbjct:   64 KLSIYCDRYAEQIPVTFVLGFMTPEEKKIFENLKSPHLKYWIPTVWFTNLASKARKDGRIQDSVDLQTILTEMNRFRTWCSTLFGYDWVGIPLVYTQVVTLAVYTFFSASIIGRQFLDPAQGYPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWCIDRNLQVSLMAVDEMHMNIPRMTKDVYWNDPDVRPPYTRAAADYCIPSFLGSTTDMGL 290          

HSP 2 Score: 78.1814 bits (191), Expect = 5.474e-15
Identity = 35/84 (41.67%), Postives = 55/84 (65.48%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGF 362
            MTV Y  +V +A    F +LL +W+G ++KL+Y +F+ F+ LY+++S +YR +L D  +R FEK+  Y  +    IPV F+LGF
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLRWRGSIYKLLYREFLFFALLYSILSLVYRWVLTDPQRRLFEKLSIYCDRYAEQIPVTFVLGF 84          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 270.396 bits (690), Expect = 9.117e-86
Identity = 140/380 (36.84%), Postives = 212/380 (55.79%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMK 1250
            MTV Y  +V +A    F +LL +WKG ++KL+Y +F +F  L+  +S +YR +L++  KR FEK+  Y  +   LIPV+F+LGFYV+LV +R+W  + ++PW  ++  ++A +++       G D       E  RL RR+++RY   S ++ L  VS  V +RFP +D +   G +   E            + ++P  W A +  +A  +GRI +   L   + ++N FR     L+  D V +PLVYTQVVT+AVYS+FL+CLIGRQF+          D  +P+FT+LQF  Y GWLK+A  L+NP GEDD+DF+ N  VD N ++ L   D +  D PPL  D ++D      P            F GS +D++
Sbjct:    1 MTVTYSNKVANARLGGFSQLLLRWKGSIYKLLYKEFCIFLVLFFTLSSVYRYMLQENQKRYFEKLAMYCNKYAELIPVSFVLGFYVTLVVSRWWSQYESLPWPDRLMHLVACNVH-------GAD-------ERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTMDHVVEAGFMTPAERRKFDGLRSPHNKFWVPCVWFANLAAQAKAEGRILDNVSLQLILNDLNNFRSCCSMLYSYDWVSIPLVYTQVVTVAVYSFFLACLIGRQFLGPQGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEANWCVDRNLQVSLMGVDEMYRDLPPLEHDVYWDDISPCPPYTGASLVHHKASFQGSTFDVR 366          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 252.677 bits (644), Expect = 3.314e-77
Identity = 132/387 (34.11%), Postives = 211/387 (54.52%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKP-FMGSVYDMKVDSND 1265
            MTV Y   V +A    F KLL +W+G ++KL+Y +F ++  +Y  +S   R  L ++ KR FEK+  Y     +LIPV    GFYV+LV +R+W  + ++P   ++   +A  ++ V               E  RL RR+++RY   S ++ L  VS  V +RFP +D +   G +   E +          + ++P  W +++  +A  +GR+ ++  L   + E+N +R     LF  D + VPLVYTQVVT+AVYS+FL+CLIGRQF+  +        D  +P+FT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D N ++ +   D +  + P L +D +++      P  +       KP F+GS +DM +  +D
Sbjct:    1 MTVTYTNRVANARLCGFSKLLLQWRGSIYKLLYREFSIYFMMYAALSLTSRFALSEDQKRLFEKLSLYCNNYANLIPVRSCSGFYVALVVSRWWSQYTSIPTPDRLMCAVAGTVHGV--------------DERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTMDHVVEAGFMTRDERKRFDGLRCSYNKYWVPCVWLSSLAAQARAEGRVRDDVALKLLLDEMNVYRGNCGMLFHYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPAQGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNLQVSMLAVDEMYQNLPLLQRDMYWNASDPRPPYTAATMSTLHKPSFLGSAFDMSMHKDD 373          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: BEST3 (bestrophin 3 [Source:NCBI gene;Acc:101172121])

HSP 1 Score: 286.574 bits (732), Expect = 5.680e-88
Identity = 143/383 (37.34%), Postives = 222/383 (57.96%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ--DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKV 1253
            MTV Y  +V +A  ++F +LL +W+G ++KL+Y +F++F+ LYT++S IYRL L ++ KR FEK+  Y  +    IPV F+LGFYV+LV NR+W  F  +PW  ++   I+S               ++   E  RL RR+++RY+  + ++    VS  V +RFP ID +   G +   E ++ +N     ++ ++P+ W + +  +A  +GRI +   L N + E+N FR     LF  D V +PLVYTQVVTLAVY++F +C+IGRQF +D          D  VP+FT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D N ++ L   D + ++ P + KD +++      P      D     F+GS  DM +
Sbjct:    1 MTVTYSSKVANATFLSFHRLLLRWRGSIYKLLYREFLLFALLYTILSLIYRLALSEQQKRLFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFLNLPWPDRLMFHISS--------------CVQGKDEYGRLLRRTLVRYINLTSLLIFRSVSTAVCKRFPTIDHVVEAGFMTPEERKVFENIRSPHLKYWIPVVWFSNLASRARQEGRIQDAIDLQNILNEMNTFRTWCATLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQF-LDPAQGHPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWIIDRNLQVSLLAVDEMHMNLPHMTKDIYWNDSDARPPYTLAAADYCIPSFLGSTTDMGL 368          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best2 (bestrophin 2 [Source:NCBI gene;Acc:110015962])

HSP 1 Score: 277.715 bits (709), Expect = 4.279e-85
Identity = 147/383 (38.38%), Postives = 216/383 (56.40%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKP-FMGSVYDMKV 1253
            MTV Y   V +A    F KLL  WKG ++K++Y +F+ F  LY  IS  YR  L ++ KR FEK+  Y     SLIP++F+LGFYV+L+ NR+W  + ++P   +I  +++  +        G+DE         RL RRS++RY + S ++ L  VS  V +RFP +D +   G +   E +  +       + ++P  W   +   A  +GRI ++  L   ++E+N FR     LF  D V VPLVYTQVVTLAVYS+FL CLIGRQF+  S   +    D  VPIFT+LQF  Y GWLK+A  L+NP GEDD+DF+ N ++D NF++ +   D +  D P + +D++++      P  +       KP F GS +DM +
Sbjct:    1 MTVTYTARVANARFCGFSKLLLAWKGSIYKVLYKEFLAFFVLYAAISITYRFFLYEDQKRYFEKLAIYCNHYASLIPMSFVLGFYVTLIVNRWWNQYTSIPLPDRIMCVLSGGLQ-------GNDE-------RGRLLRRSMMRYASLSALLILRSVSTAVFKRFPTMDHVVEAGFMTREERKKFEGLHSPYNKYWIPCVWFTNLAAVARCEGRIRDDHALKLLLEELNAFRGKCSLLFHYDMVSVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQGYQGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAVDEMYGDLPVMERDRYWNDSNPRPPYTAATLFGLRKPSFQGSTFDMAI 369          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:101167866])

HSP 1 Score: 264.618 bits (675), Expect = 4.482e-79
Identity = 139/383 (36.29%), Postives = 216/383 (56.40%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGIL---LEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDM 1247
            MTV Y + V  AG   F  LL +WKG ++KL+Y + I+F+ LY  +S +Y  +L ++ +R FE++  Y  +   LIPV+F+L FYV+LV +R+W  F  +PW  ++A ++  H              +R   E +RL RR+++RY+  S ++    VS  V +RFP  + +    +    L H  E+      F    ++P  W   + ++A T+GRI N+  L   + E+N  R    +L+  D + +PLVYTQV T+AVYS+FL+CLIGRQF+  +        DF +P+FT+LQF  Y+GWLK+A  L+NP GEDD+DF+ N VVD N ++ L   D +    P + KD +++    + P  +   + R   FMGS  D+
Sbjct:    1 MTVTYSRRVADAGLGTFFHLLLRWKGSIYKLLYRELIIFTLLYYFLSLVY-YMLDNDQRRLFERLSIYCDRYAELIPVSFVL-FYVTLVVSRWWGQFENIPWPDRLAALVGGH--------------VRGTDEASRLTRRALMRYVNLSGVLIYRSVSTAVYKRFPTTEHLVQALMTSEELRHFEELPSPHNKF----WVPCMWFVNLALRARTEGRINNDVALTAILTELNSLRAKCMKLYGYDWISLPLVYTQVATVAVYSFFLACLIGRQFLDPAQGYPGHDVDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWVVDRNLQVSLLSVDEMYDSLPLVEKDVYWNDSEPQPPYTAASAEHRKPSFMGSALDI 363          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000030918.1 (SMESG000030918.1)

HSP 1 Score: 1057.36 bits (2733), Expect = 0.000e+0
Identity = 530/533 (99.44%), Postives = 531/533 (99.62%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSSGISMFTSTASLKGLEAITPTISKMPEEIDEPPTPVKSNEKHPLLVXXXXXXXXXXXXXLKSIRKSRDYLNENSADENDESSLKESLCSGQSKV 1709
            MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSSGISMFTSTASLKGLEAITPTISKMPEEIDEPPTPVKSNEKHPLLVIEEEEQSQGNEIELK IRKSRD LNENSADENDE+SLKESLCSGQSKV
Sbjct:    1 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSEGELRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSSGISMFTSTASLKGLEAITPTISKMPEEIDEPPTPVKSNEKHPLLVIEEEEQSQGNEIELKPIRKSRDDLNENSADENDENSLKESLCSGQSKV 533          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000030927.1 (SMESG000030927.1)

HSP 1 Score: 487.263 bits (1253), Expect = 3.092e-168
Identity = 230/398 (57.79%), Postives = 313/398 (78.64%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSE 1304
            MTV+YYQ+VL+AGP+ FLKLL +WKG +F+LIY D ++F++ Y  IS I+R +L +++KRQFE V++YV +SQ+LIPVAFI+GFYV+L+F+RFW+HFNT+PWI+K A+++++            ++ I+K+KE+ RLQ+R+IIRYL +SL+ITLSRVS+PVKRRF NI+E+ NKGILLEHE+ +I+  EP+ MQPFLP+               I NE++LI  V+EINKFRQLLQELFLLDQ+CVPLVYTQVVTLA+YSYFLSCL+GRQFI+ S  ++   DFV+PIFTILQFIVY+GW+KLAL+LVNPMGEDDEDFDLN ++DYNF+ G++  + +K  QPP  KD FF+ K+++LP+    K  + +PF GS  +M++D+ +WI S+KS+ I  E
Sbjct:    1 MTVKYYQDVLTAGPIGFLKLLIRWKGSIFRLIYSDLLLFAAFYMAISMIHRFMLPEDNKRQFETVINYVAKSQALIPVAFIVGFYVNLIFSRFWQHFNTIPWISKTALLVSTFFQDPEFNPEMSEDEIKKEKEKTRLQKRTIIRYLVSSLLITLSRVSIPVKRRFKNINELSNKGILLEHESGLIEKCEPYIMQPFLPVI--------------IPNESLLIGIVEEINKFRQLLQELFLLDQICVPLVYTQVVTLAIYSYFLSCLVGRQFIIVSDYLKNRNDFVIPIFTILQFIVYIGWIKLALSLVNPMGEDDEDFDLNTLIDYNFQTGISSVENLKSSQPPFEKDFFFNSKIYKLPLNEKSKFNKTRPFRGSFCEMRIDNENWIASIKSLLIDKE 384          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000030927.1 (SMESG000030927.1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.221e-152
Identity = 216/398 (54.27%), Postives = 292/398 (73.37%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSE 1304
            MTV+YYQ+VL+AGP+ FLKLL +WKG +F+LIY D ++F++ Y  IS I+R +L +++KRQFE V++YV +SQ+LIPVAFI+GFYV+L+F+RFW+HFNT+PWI+K A+++++            ++ I+K+KE+ RLQ+R+IIRYL +SL+ITLSRVS+PVKRRF NI+E+ NKGILLEHE+E                                           EINKFRQLLQELFLLDQ+CVPLVYTQVVTLA+YSYFLSCL+GRQFI+ S  ++   DFV+PIFTILQFIVY+GW+KLAL+LVNPMGEDDEDFDLN ++DYNF+ G++  + +K  QPP  KD FF+ K+++LP+    K  + +PF GS  +M++D+ +WI S+KS+ I  E
Sbjct:    1 MTVKYYQDVLTAGPIGFLKLLIRWKGSIFRLIYSDLLLFAAFYMAISMIHRFMLPEDNKRQFETVINYVAKSQALIPVAFIVGFYVNLIFSRFWQHFNTIPWISKTALLVSTFFQDPEFNPEMSEDEIKKEKEKTRLQKRTIIRYLVSSLLITLSRVSIPVKRRFKNINELSNKGILLEHESE-------------------------------------------EINKFRQLLQELFLLDQICVPLVYTQVVTLAIYSYFLSCLVGRQFIIVSDYLKNRNDFVIPIFTILQFIVYIGWIKLALSLVNPMGEDDEDFDLNTLIDYNFQTGISSVENLKSSQPPFEKDFFFNSKIYKLPLNEKSKFNKTRPFRGSFCEMRIDNENWIASIKSLLIDKE 355          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000054993.1 (SMESG000054993.1)

HSP 1 Score: 235.728 bits (600), Expect = 1.681e-71
Identity = 129/383 (33.68%), Postives = 224/383 (58.49%), Query Frame = 3
Query:  111 MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFI-MDSVNVETTQDFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSVYDMKVD 1256
            MT+ Y   V ++    FL+LL +WKG ++K+I+ + IVF++LYT +SC+YR  L   +K++FE+  ++  ++  +IPV F+LGFYV+LV +R+W  F  +PW   +AI +++ +         DD+S+        + RR+I+RYL  S  +T + +S   KR FP++  +   G+L + E +I+   E    + F+P  W++ +V +A ++     E  +   ++EI KFR  L  ++  D +  PLVYTQ+ T++V++YF+  +   QFI  D V+V       VP+F  LQF+ YMGWLK+A +L+NP G+DD+DF+++ ++  N ++   I D +    P L KD F++    ++ +  + K  +   F GS+ ++  D
Sbjct:    1 MTITYINTVATSKYWTFLRLLLRWKGSIYKIIWFEMIVFATLYTGLSCLYRFGLYGIYKKRFEEFCAFSKKNADMIPVPFVLGFYVTLVVSRWWNQFMEIPWPDSMAIYVSTFI------LGNDDKSV--------MYRRTIMRYLNLSFCMTFASISSKAKRMFPDLKTLIENGLLTKDEEKILNEYETNNAKYFVPALWASNLVYQAESEKMTIGERGVETLIEEIGKFRGSLGMIYCFDWINPPLVYTQIATISVHAYFMIFVFAEQFISKDKVDV------YVPMFGFLQFVFYMGWLKVAESLINPFGDDDDDFEIDEMIHRNIKMSYLIIDEMHDSYPELDKDVFWNSNR-DIQIIHDYKSPKNDMFAGSLLNLNTD 362          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000040095.1 (SMESG000040095.1)

HSP 1 Score: 216.468 bits (550), Expect = 6.283e-65
Identity = 120/347 (34.58%), Postives = 191/347 (55.04%), Query Frame = 3
Query:  201 LIYMDFIVFSSLYTMISCIYRLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTVPWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASLIITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPITWSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVYTQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQ-DFVVPIFTILQFIVYMGWLKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKFFDKKVFELPMESNMKDARAKPFMGSV 1238
            +++ + ++F  LY+ IS +YR +L   +K QFE+   Y     + +P+AFIL FYV+++ NR+W  FN +PW   +A+ +    NT  P NS           +  + +R+++RYL  SL++ L  VS   K+RFP    + +  +  E E  +    +P   + ++PI W++ ++ KA   G I  E  L N + EI++FR+ L +LF  D V  PLVYTQ  T+AVY+YF++ L  RQF+  +        DF VP+F ++Q + Y GWLK+A  L+NP GEDD+DFD   +++ N          +    P L+KD F+D    E P++ N        F+GS+
Sbjct:    1 MVWFELVLFGILYSSISIMYRNLLSGLYKEQFERFCIYCDSIGNFMPIAFILSFYVTMIANRWWEQFNIIPWPDHVALFV----NTYIPGNS----------VKLVMLKRNVVRYLNISLLLYLRSVSPQTKKRFPTEASLMDARLFNETEFNLFNQIDPTYNRYYVPIIWASNLIKKAFIDGDIKTEGRLNNIILEISQFRERLIKLFSYDWVNPPLVYTQTATIAVYTYFVTSLFSRQFLDPNKGYRNHNIDFYVPVFFLIQLVFYFGWLKVAECLINPFGEDDDDFDCLGLIERNITANFIFVKPLIEPHPVLMKDVFWDV---ESPIKLNNYKDDVNFFVGSM 330          
The following BLAST results are available for this feature:
BLAST of Bestrophin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BEST32.777e-8937.53bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
BEST36.232e-8837.56bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
BEST22.204e-8133.62bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST22.204e-8133.62bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST22.204e-8133.62bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best-31.124e-7033.51Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-244.121e-7033.51Bestrophin homolog 24 [Source:UniProtKB/Swiss-Pro... [more]
best-47.710e-7034.11Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-223.193e-6933.85Bestrophin homolog 22 [Source:UniProtKB/Swiss-Pro... [more]
best-225.259e-6933.85Bestrophin homolog 22 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best14.034e-9040.65gene:FBgn0040238 transcript:FBtr0082183[more]
Best18.483e-9040.65gene:FBgn0040238 transcript:FBtr0337020[more]
Best11.461e-8940.65gene:FBgn0040238 transcript:FBtr0114590[more]
Best13.004e-8940.65gene:FBgn0040238 transcript:FBtr0306023[more]
Best41.261e-8738.14gene:FBgn0036491 transcript:FBtr0113172[more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best11.548e-9035.92bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best21.099e-8238.18bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best43.900e-7835.26bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best42.426e-6935.15bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best12.377e-4536.80bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifitm32.815e-8637.56interferon induced transmembrane protein 3 [Source... [more]
cyp2b61.308e-8538.22cytochrome P450 family 2 subfamily B member 6 [Sou... [more]
best16.374e-8536.39bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best11.194e-8336.58bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best11.200e-8336.27bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best32.757e-8835.54bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298][more]
Best15.951e-8636.27bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best16.276e-8536.27bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best23.060e-8435.07bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best23.060e-8435.07bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
back to top
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6H1V1|BEST3_MOUSE1.928e-8735.54Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=... [more]
sp|Q8N1M1|BEST3_HUMAN2.993e-8737.56Bestrophin-3 OS=Homo sapiens OX=9606 GN=BEST3 PE=1... [more]
sp|O88870|BEST1_MOUSE4.390e-8436.27Bestrophin-1 OS=Mus musculus OX=10090 GN=Best1 PE=... [more]
sp|Q8BGM5|BEST2_MOUSE2.789e-8335.07Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=... [more]
sp|Q8NFU1|BEST2_HUMAN1.058e-8033.62Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1... [more]
back to top
BLAST of Bestrophin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068Y3U99.999e-12743.58Bestrophin homolog OS=Echinococcus multilocularis ... [more]
A0A5K3EZP56.358e-12648.71Bestrophin homolog OS=Mesocestoides corti OX=53468... [more]
A0A068WMI51.200e-12544.12Bestrophin homolog OS=Echinococcus granulosus OX=6... [more]
A0A0R3UIX41.758e-12548.83Bestrophin homolog OS=Mesocestoides corti OX=53468... [more]
A0A504YTL73.786e-12045.26Bestrophin homolog OS=Fasciola gigantica OX=46835 ... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best15.543e-8737.60bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
best25.949e-8237.86bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best49.065e-8036.88bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best12.737e-7334.73bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
BEST32.977e-4035.68bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
best19.117e-8636.84bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best23.314e-7734.11bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BEST35.680e-8837.34bestrophin 3 [Source:NCBI gene;Acc:101172121][more]
best24.279e-8538.38bestrophin 2 [Source:NCBI gene;Acc:110015962][more]
best14.482e-7936.29bestrophin-2 [Source:NCBI gene;Acc:101167866][more]
back to top
BLAST of Bestrophin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030918.10.000e+099.44SMESG000030918.1[more]
SMESG000030927.13.092e-16857.79SMESG000030927.1[more]
SMESG000030927.11.221e-15254.27SMESG000030927.1[more]
SMESG000054993.11.681e-7133.68SMESG000054993.1[more]
SMESG000040095.16.283e-6534.58SMESG000040095.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004353 ID=SMED30004353|Name=Bestrophin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1778bp
TGTAAATAAATGTGTAATATTTAAATTTTTACTTTCAAATTTGAAATTAT
TTATCATTTCATTCAATTAAAATTGAATAATTTTAATAATACTTTCTACA
ACGAAATTCTATGACAGTTCAGTACTACCAGGAAGTTCTCAGCGCAGGTC
CTGTGGCATTTTTAAAATTACTTCGAAAATGGAAAGGAGGAGTTTTTAAA
TTGATTTACATGGATTTTATAGTGTTTTCGTCGTTATACACGATGATCAG
TTGCATATACCGACTGATCCTGAGGGATGAGCATAAGAGGCAATTCGAAA
AAGTCGTCTCGTATGTTTACCAATCTCAATCATTGATTCCCGTGGCTTTC
ATTCTCGGATTTTATGTCAGTCTGGTTTTCAATCGGTTCTGGCGGCATTT
TAACACGGTGCCTTGGATAACAAAGATTGCAATAATGATAGCGAGTCACA
TGAATACAGTTTCACCAGCGAATTCCGGTGACGATGAGTCAATCCGAAAA
GACAAAGAAGAAGCGCGATTGCAACGACGAAGCATAATCCGATACTTGAC
AGCGAGTTTGATCATAACTCTGTCTCGTGTCAGTGTGCCAGTCAAGCGGA
GATTCCCGAATATTGATGAGATATTCAACAAGGGGATTTTATTGGAGCAC
GAAGCGGAAATTATCAAGAACACAGAACCATTCACAATGCAGCCATTTCT
GCCAATAACATGGAGTGCTACAATTGTCATGAAGGCCGGCACTCAAGGCA
GAATCACTAATGAGGCGGTTCTCATCAACACTGTCAAGGAGATCAATAAG
TTCCGTCAATTGTTGCAGGAATTATTTCTTCTCGATCAAGTTTGTGTGCC
TCTCGTCTACACTCAAGTCGTAACACTGGCGGTTTATTCCTACTTTCTCA
GTTGTCTGATTGGTCGGCAATTTATAATGGATTCTGTCAATGTCGAGACC
ACTCAAGACTTTGTCGTCCCGATCTTTACGATTCTACAGTTCATTGTCTA
TATGGGTTGGCTTAAGCTTGCACTAACTCTAGTCAATCCAATGGGTGAAG
ATGACGAAGATTTCGATTTGAATTGTGTTGTCGATTACAATTTCGAGATA
GGTCTAGCAATAGCTGATGGAGTTAAAATTGATCAGCCTCCTTTAATAAA
AGATAAATTTTTCGACAAGAAAGTGTTTGAGTTGCCAATGGAAAGCAATA
TGAAAGATGCCAGAGCGAAGCCATTTATGGGATCAGTCTATGACATGAAA
GTCGACTCAAATGATTGGATCACGTCTCTTAAATCAATTGCCATTGGATC
AGAAGGAGAGCTCCGTAATGATAAATTGTACATTCAATCTTTAGAAGACA
AAAAAGGCGTTAGTCGAAATAATTCTAATAGGAGTCAAAAATCTATGTTT
ACAAAAAAGCGCACAATATCAACATCCTCAGGTATATCAATGTTCACTAG
CACCGCTTCTCTCAAAGGGTTAGAAGCTATTACACCAACTATCAGTAAAA
TGCCGGAAGAAATTGATGAACCTCCAACCCCTGTGAAATCAAATGAAAAG
CACCCACTGCTTGTAATTGAAGAAGAGGAACAGTCACAGGGAAATGAAAT
TGAATTAAAGTCGATCCGAAAATCCAGAGATTATCTGAATGAAAACTCAG
CCGATGAAAATGATGAGAGCTCTTTGAAAGAGTCTTTATGTAGTGGTCAA
TCCAAGGTTTAATAATAAAACAGAGCTATTTTTCAGAATCAATTCTGTGC
AGTGTCTTCCTTATTGTCATTTTATCTC
back to top

protein sequence of SMED30004353-orf-1

>SMED30004353-orf-1 ID=SMED30004353-orf-1|Name=SMED30004353-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=534bp
MTVQYYQEVLSAGPVAFLKLLRKWKGGVFKLIYMDFIVFSSLYTMISCIY
RLILRDEHKRQFEKVVSYVYQSQSLIPVAFILGFYVSLVFNRFWRHFNTV
PWITKIAIMIASHMNTVSPANSGDDESIRKDKEEARLQRRSIIRYLTASL
IITLSRVSVPVKRRFPNIDEIFNKGILLEHEAEIIKNTEPFTMQPFLPIT
WSATIVMKAGTQGRITNEAVLINTVKEINKFRQLLQELFLLDQVCVPLVY
TQVVTLAVYSYFLSCLIGRQFIMDSVNVETTQDFVVPIFTILQFIVYMGW
LKLALTLVNPMGEDDEDFDLNCVVDYNFEIGLAIADGVKIDQPPLIKDKF
FDKKVFELPMESNMKDARAKPFMGSVYDMKVDSNDWITSLKSIAIGSEGE
LRNDKLYIQSLEDKKGVSRNNSNRSQKSMFTKKRTISTSSGISMFTSTAS
LKGLEAITPTISKMPEEIDEPPTPVKSNEKHPLLVIEEEEQSQGNEIELK
SIRKSRDYLNENSADENDESSLKESLCSGQSKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000615Bestrophin
IPR021134Bestrophin/UPF0187
Vocabulary: molecular function
TermDefinition
GO:0005254chloride channel activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0034707chloride channel complex
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006821chloride transport
GO:1902476chloride transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021134Bestrophin/UPF0187PFAMPF01062Bestrophincoord: 14..327
e-value: 1.2E-80
score: 271.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 416..435
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 469..522
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 421..435
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 464..533
NoneNo IPR availablePANTHERPTHR10736:SF55BESTROPHIN 1, ISOFORM C-RELATEDcoord: 1..491
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 284..301
NoneNo IPR availableTMHMMTMhelixcoord: 244..263
NoneNo IPR availableTMHMMTMhelixcoord: 32..54
IPR000615BestrophinPANTHERPTHR10736BESTROPHINcoord: 1..491