Alpha-2-macroglobulin

Overview
NameAlpha-2-macroglobulin
Smed IDSMED30004348
Length (bp)5775
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-2-macroglobulin (SMED30004348) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-2-macroglobulin (SMED30004348) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-2-macroglobulin (SMED30004348) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-2-macroglobulin (SMED30004348) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004348

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30004348SMESG000037145.1 SMESG000037203.1 SMESG000037155.1 SMESG000037154.1 SMESG000037147.1 SMESG000037146.1 dd_Smed_v4_568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004348SMESG000037145.1 SMESG000037203.1 SMESG000037155.1 SMESG000037154.1 SMESG000037147.1 SMESG000037146.1 dd_Smed_v4_568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004348SMESG000037145.1 SMESG000037203.1 SMESG000037155.1 SMESG000037154.1 SMESG000037147.1 SMESG000037146.1 dd_Smed_v4_568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004348SMESG000037145.1 SMESG000037203.1 SMESG000037155.1 SMESG000037149.1 SMESG000037144.1 SMESG000037154.1 SMESG000037147.1 SMESG000037146.1 dd_Smed_v6_568_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-2-macroglobulin vs. Ensembl Human
Match: A2ML1 (alpha-2-macroglobulin like 1 [Source:HGNC Symbol;Acc:HGNC:23336])

HSP 1 Score: 338.961 bits (868), Expect = 5.754e-97
Identity = 280/976 (28.69%), Postives = 456/976 (46.72%), Query Frame = 1
Query: 2059 MGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVD--PGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLL------------RKHKC-------IPQKRVKRMIQ-----------PIYGLEYDSRKVLSTAGFTAITNARIVN-VKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSF-----TLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYW---PFDKESSDEQKSNSA-DIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGV-SQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAAN-DTFKLSV---KTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPL-NRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            + PD  ++ Y I     VVAD ++ +  +   +Q+  G   F+    +P ++V L +   PG   + CA+R  DE++L                L++ + +++  S  G+                +C        PQ  +  M Q           P +    D        G   ++NA+I   V C    +   P+  Y+T         ++  S   +  A+   Q+R+YFPE+W++  F   N   + +++TVPD++T W+A S+C ++ +G  ++PT  L    PF+ ++ +PYS+   E  +L   +FNY   C    +++  D  + +   L+S+     + C C +D KT ++N+    +G +N TI +    S+     +K  +     SD++ + +LV+P GV  E T S L+C K +         +P +IV  S ++Y+T  GD+MG    NLD LV MP GCGEQNMV   P IYVL YL    +    + ++A  ++  GY ++L YKH +GS+SAFG+ D  G+TWLTAFV K F  A K++ I+   +++A K++   Q   GC+   G L  + M GG+      D   LTAYV  +L   G D+      +        +N   +T N         +        +   +  QL  Q++  G   YW   P    ++      +A D+E T YA+LA      +  ++++ +   V WL+ Q N+ GG+ STQDTVVAL ALA +A T  + S+ +NL V    N  +T+N  I   NRLV Q   L      Y +++ +G GC  +Q    YNI  L   N  TF LSV   K   +         + +  +Y+    +SNM +V +   SG+   E   + L  Q   PL  +++F    + +Y D    N       + F I +   ++NL+PA +K+ DYY P+  +   YS
Sbjct:   37 LAPDPSLVIYAIFPSGGVVADKIQFSVEMCFDNQVSLG---FSPSQQLPGAEVELQLQAAPG---SLCALRAVDESVL----------------LLRPDRELSNRSVYGMFPFWYGHYPYQVAEYDQCPVSGPWDFPQPLIDPMPQGHSSQRSIIWRPSFSEGTDLFSFFRDVGLKILSNAKIKKPVDC----SHRSPE--YSTAMGAGGGHPEAFESSTPLHQAE-DSQVRQYFPETWLWDLFPIGNSGKEAVHVTVPDAITEWKAMSFCTSQSRGFGLSPTVGLTAFKPFFVDLTLPYSVVRGESFRLTATIFNYLKDC----IRVQTDLAKSHEYQLESWADSQTSSCLCADDAKTHHWNITAVKLGHINFTISTKILDSNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTHSSLLCPKGKVASESVSLELPVDIVPDSTKAYVTVLGDIMGTALQNLDGLVQMPSGCGEQNMVLFAPIIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHSNGSYSAFGERDGNGNTWLTAFVTKCFGQAQKFIFIDPKNIQDALKWMAGNQLPSGCYANVGNLLHTAMKGGVD-----DEVSLTAYVTAALLEMGKDV---DDPMVSQGLRCLKNSATSTTNLYTQALLAYIFSLAGEMDIRNILLKQLDQQAIISGESIYWSQKPTPSSNASPWSEPAAVDVELTAYALLAQLTKPSLTQKEIAKATSIVAWLAKQHNAYGGFSSTQDTVVALQALAKYATTAYMPSEEINLVVKSTENFQRTFN--IQSVNRLVFQQDTLPNVPGMY-TLEASGQGCVYVQTVLRYNI--LPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQ---PLVKKVEFGTDTLNIYLDELIKN----TQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYS 959          
BLAST of Alpha-2-macroglobulin vs. Ensembl Human
Match: A2ML1 (alpha-2-macroglobulin like 1 [Source:HGNC Symbol;Acc:HGNC:23336])

HSP 1 Score: 338.191 bits (866), Expect = 2.243e-96
Identity = 280/976 (28.69%), Postives = 456/976 (46.72%), Query Frame = 1
Query: 2059 MGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVD--PGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLL------------RKHKC-------IPQKRVKRMIQ-----------PIYGLEYDSRKVLSTAGFTAITNARIVN-VKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSF-----TLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYW---PFDKESSDEQKSNSA-DIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGV-SQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAAN-DTFKLSV---KTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPL-NRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            + PD  ++ Y I     VVAD ++ +  +   +Q+  G   F+    +P ++V L +   PG   + CA+R  DE++L                L++ + +++  S  G+                +C        PQ  +  M Q           P +    D        G   ++NA+I   V C    +   P+  Y+T         ++  S   +  A+   Q+R+YFPE+W++  F   N   + +++TVPD++T W+A S+C ++ +G  ++PT  L    PF+ ++ +PYS+   E  +L   +FNY   C    +++  D  + +   L+S+     + C C +D KT ++N+    +G +N TI +    S+     +K  +     SD++ + +LV+P GV  E T S L+C K +         +P +IV  S ++Y+T  GD+MG    NLD LV MP GCGEQNMV   P IYVL YL    +    + ++A  ++  GY ++L YKH +GS+SAFG+ D  G+TWLTAFV K F  A K++ I+   +++A K++   Q   GC+   G L  + M GG+      D   LTAYV  +L   G D+      +        +N   +T N         +        +   +  QL  Q++  G   YW   P    ++      +A D+E T YA+LA      +  ++++ +   V WL+ Q N+ GG+ STQDTVVAL ALA +A T  + S+ +NL V    N  +T+N  I   NRLV Q   L      Y +++ +G GC  +Q    YNI  L   N  TF LSV   K   +         + +  +Y+    +SNM +V +   SG+   E   + L  Q   PL  +++F    + +Y D    N       + F I +   ++NL+PA +K+ DYY P+  +   YS
Sbjct:   78 LAPDPSLVIYAIFPSGGVVADKIQFSVEMCFDNQVSLG---FSPSQQLPGAEVELQLQAAPG---SLCALRAVDESVL----------------LLRPDRELSNRSVYGMFPFWYGHYPYQVAEYDQCPVSGPWDFPQPLIDPMPQGHSSQRSIIWRPSFSEGTDLFSFFRDVGLKILSNAKIKKPVDC----SHRSPE--YSTAMGAGGGHPEAFESSTPLHQAE-DSQVRQYFPETWLWDLFPIGNSGKEAVHVTVPDAITEWKAMSFCTSQSRGFGLSPTVGLTAFKPFFVDLTLPYSVVRGESFRLTATIFNYLKDC----IRVQTDLAKSHEYQLESWADSQTSSCLCADDAKTHHWNITAVKLGHINFTISTKILDSNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTHSSLLCPKGKVASESVSLELPVDIVPDSTKAYVTVLGDIMGTALQNLDGLVQMPSGCGEQNMVLFAPIIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHSNGSYSAFGERDGNGNTWLTAFVTKCFGQAQKFIFIDPKNIQDALKWMAGNQLPSGCYANVGNLLHTAMKGGVD-----DEVSLTAYVTAALLEMGKDV---DDPMVSQGLRCLKNSATSTTNLYTQALLAYIFSLAGEMDIRNILLKQLDQQAIISGESIYWSQKPTPSSNASPWSEPAAVDVELTAYALLAQLTKPSLTQKEIAKATSIVAWLAKQHNAYGGFSSTQDTVVALQALAKYATTAYMPSEEINLVVKSTENFQRTFN--IQSVNRLVFQQDTLPNVPGMY-TLEASGQGCVYVQTVLRYNI--LPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQ---PLVKKVEFGTDTLNIYLDELIKN----TQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYS 1000          
BLAST of Alpha-2-macroglobulin vs. Ensembl Human
Match: A2ML1 (alpha-2-macroglobulin like 1 [Source:HGNC Symbol;Acc:HGNC:23336])

HSP 1 Score: 339.732 bits (870), Expect = 2.092e-94
Identity = 280/984 (28.46%), Postives = 458/984 (46.54%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVD--PGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLL------------RKHKC-------IPQKRVKRMIQ-----------PIYGLEYDSRKVLSTAGFTAITNARIVN-VKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSF-----TLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPF----DKESSDEQKSNSADIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGV-SQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAAN-DTFKLSV---KTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPL-NRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            +S+     + PD  ++ Y I     VVAD ++ +  +   +Q+  G   F+    +P ++V L +   PG   + CA+R  DE++L                L++ + +++  S  G+                +C        PQ  +  M Q           P +    D        G   ++NA+I   V C    +   P+  Y+T         ++  S   +  A+   Q+R+YFPE+W++  F   N   + +++TVPD++T W+A S+C ++ +G  ++PT  L    PF+ ++ +PYS+   E  +L   +FNY   C    +++  D  + +   L+S+     + C C +D KT ++N+    +G +N TI +    S+     +K  +     SD++ + +LV+P GV  E T S L+C K +         +P +IV  S ++Y+T  GD+MG    NLD LV MP GCGEQNMV   P IYVL YL    +    + ++A  ++  GY ++L YKH +GS+SAFG+ D  G+TWLTAFV K F  A K++ I+   +++A K++   Q   GC+   G L  + M GG+      D   LTAYV  +L   G D+      +        +N   +T N         +        +   +  QL  Q++  G   YW         +S   +  + D+E T YA+LA      +  ++++ +   V WL+ Q N+ GG+ STQDTVVAL ALA +A T  + S+ +NL V    N  +T+N  I   NRLV Q   L      Y +++ +G GC  +Q    YNI  L   N  TF LSV   K   +         + +  +Y+    +SNM +V +   SG+   E   + L  Q   PL  +++F    + +Y D    N       + F I +   ++NL+PA +K+ DYY P+  +   YS
Sbjct:  520 LSLTFTSRLAPDPSLVIYAIFPSGGVVADKIQFSVEMCFDNQVSLG---FSPSQQLPGAEVELQLQAAPG---SLCALRAVDESVL----------------LLRPDRELSNRSVYGMFPFWYGHYPYQVAEYDQCPVSGPWDFPQPLIDPMPQGHSSQRSIIWRPSFSEGTDLFSFFRDVGLKILSNAKIKKPVDC----SHRSPE--YSTAMGAGGGHPEAFESSTPLHQAE-DSQVRQYFPETWLWDLFPIGNSGKEAVHVTVPDAITEWKAMSFCTSQSRGFGLSPTVGLTAFKPFFVDLTLPYSVVRGESFRLTATIFNYLKDC----IRVQTDLAKSHEYQLESWADSQTSSCLCADDAKTHHWNITAVKLGHINFTISTKILDSNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTHSSLLCPKGKVASESVSLELPVDIVPDSTKAYVTVLGDIMGTALQNLDGLVQMPSGCGEQNMVLFAPIIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHSNGSYSAFGERDGNGNTWLTAFVTKCFGQAQKFIFIDPKNIQDALKWMAGNQLPSGCYANVGNLLHTAMKGGVD-----DEVSLTAYVTAALLEMGKDV---DDPMVSQGLRCLKNSATSTTNLYTQALLAYIFSLAGEMDIRNILLKQLDQQAIISGESIYWSQKPTPSSNASPWSEPAAVDVELTAYALLAQLTKPSLTQKEIAKATSIVAWLAKQHNAYGGFSSTQDTVVALQALAKYATTAYMPSEEINLVVKSTENFQRTFN--IQSVNRLVFQQDTLPNVPGMY-TLEASGQGCVYVQTVLRYNI--LPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQ---PLVKKVEFGTDTLNIYLDELIKN----TQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYS 1450          

HSP 2 Score: 90.5077 bits (223), Expect = 3.259e-17
Identity = 81/322 (25.16%), Postives = 139/322 (43.17%), Query Frame = 1
Query:  433 FAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCM---LYSYGK-------KKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINV--TVTENGTSSSVSKAVEGPGIKYNSFNIKF-DGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
            F +TDKP+Y PG +V  R                     + +D N  F+     ND     + ++ ++ P++ R+AQW  V   + + +L +QL  + + G +   AV +G+     F +++YVLP+F VEV+ P E+    ES   K+C +Y+ GKPM   +    C     Y Y +        KC        K  C    ++     ++  ++ +     QIN+  TV E GT    + A +   I     ++ F D   +Y P  P+ G+I +  H+    K   + + I    YG N  F +   ++  G+  F +
Sbjct:  123 FVQTDKPLYTPGQQVYFRI--------------------VTMDSN--FVPV---NDK----YSMVELQDPNSNRIAQWLEVVPEQGIVDLSFQLAPEAMLGTYTV-AVAEGKT-FGTFSVEEYVLPKFKVEVVEPKELSTVQESFLVKICCRYTYGKPMLGAVQVSVCQKANTYWYREVEREQLPDKCRNLSGQTDKTGCFSAPVDMATFDLIGYAYSH-----QINIVATVVEEGTGVE-ANATQNIYISPQMGSMTFEDTSNFYHPNFPFSGKIRVRGHDDSFLKNHLVFLVI----YGTNGTFNQTLVTDNNGLAPFTL 403          
BLAST of Alpha-2-macroglobulin vs. Ensembl Human
Match: A2M (alpha-2-macroglobulin [Source:HGNC Symbol;Acc:HGNC:7])

HSP 1 Score: 334.724 bits (857), Expect = 9.057e-93
Identity = 276/984 (28.05%), Postives = 455/984 (46.24%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAYFINTDNEVVADAL--EIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYL-VQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEY---------DSRKVLSTAGFTAITNARIVNVK----CMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINV-IGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKT--DKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXX-----XXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSD------EQKSNSADIETTGYAILALINHQ------DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNAL-----AVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLD--NRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAAND-TFKLSVKT---EIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNK 4830
            ISIP+  ++ P   ++ Y +    +V+ D+   ++ + L N   L      F+   ++P S   L V     ++ CA+R  D+++L      +A+LS   V  L+           +       CI +  V      I G+ Y         D    L   G  A TN++I   K      QY   G P+     F  E   M +    ++ + +   +  +R+YFPE+W++      +     + +TVPD++T W+A ++C++E  GL I+ T  L+   PF+  + +PYS+   E   L   V NY   C  ++V++      + V +  +    C C N  +TV + + PK +G +N T+ + +  S      +   +      D+V + +LVEP G+  ETTF+ L+C    ++       +P  +V  S R+ ++  GD++G    N   L+ MPYGCGEQNMV   P+IYVLDYLN      P + +KA  Y+  GY RQL YKH DGS+S FG+      G+TWLTAFVLK+F  A  Y+ I+ + + +A  +L + Q+ +GCF   G L ++ + GG++     D   L+AY+ I+L  + LT T   +  A         T    ++  +               +    + V   L +++V      +W   ++         E ++ SA++E T Y +LA +  Q      DL+ +   V W++ Q+N+ GG+ STQDTVVAL+AL     A F +T   +Q       V +  + T++    +D  NRL+ Q  +L      Y SMK  G GC  +Q S  YNI  L    +  F L V+T     D  K      I +  +Y      SNM +V +   SG+     +     L+ S  ++R +     + +Y D  S     +     F + +   + +L+PA+VK+ DYY  +   E + + +N  C+K
Sbjct:  526 ISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDVENCLANKVDL-----SFSPSQSLPASHAHLRVT-AAPQSVCALRAVDQSVLLM--KPDAELSASSVYNLLPEKDLTGFPGPLNDQDNEDCINRHNVY-----INGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHG-PEGLRVGFY-ESDVMGRGHARLVHVEEPHTET-VRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVEKEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVIKPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVE-----DEVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGDHGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQ-------VTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEY-SMKVTGEGCVYLQTSLKYNI--LPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAIVDVKMVSGF--IPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVS----NQTLSLFFTVLQDVPVRDLKPAIVKVYDYYETD---EFAIAEYNAPCSK 1469          

HSP 2 Score: 90.5077 bits (223), Expect = 3.114e-17
Identity = 80/330 (24.24%), Postives = 154/330 (46.67%), Query Frame = 1
Query:  415 DKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKA--KAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYS-----YGKKK---CVAFKSDLMKQNCNKIKLESKIVFILASSFR---YSKAKSQINVTVTE--NGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
            +++ ++F +TDK IYKPG  V+ R ++                    +D+N   +++            L+ I+ P   R+AQW++  +   +    + L+ +P  G +K   +    G+ E   F ++++VLP+F V+V  P  I   +E ++  VC  Y+ GKP+   ++   C  YS     +G+     C  F   L    C   ++++K+  +    +    +++A+ Q   TV E     SS +++      I   SF +K D   +++ G+P+FG++ LV  + K   + N  I I+    GN   +  N T+++ G+++F I
Sbjct:  124 NEDSLVFVQTDKSIYKPGQTVKFRVVS--------------------MDENFHPLNE---------LIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEH-PFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRT-----ITKLSF-VKVDS--HFRQGIPFFGQVRLV--DGKGVPIPNKVIFIR----GNEANYYSNATTDEHGLVQFSI 409          
BLAST of Alpha-2-macroglobulin vs. Ensembl Human
Match: CD109 (CD109 molecule [Source:HGNC Symbol;Acc:HGNC:21685])

HSP 1 Score: 313.153 bits (801), Expect = 3.644e-86
Identity = 276/964 (28.63%), Postives = 457/964 (47.41%), Query Frame = 1
Query: 2065 PDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKM--KKQIREYFPESWVFSYFN---KTTKHLNLTVPDSMTTWRADSYCMTEK---GLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKIN--------VDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVP---TETTFSELICNK-NEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNN-TPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYW-PFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKT-YNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAA--------NDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNK--ACNKSDEKEPGRP 4857
            P   VI Y+I  D E+++D L+I   L   +++   K  ++K  A P  KV L +     ++   I   D+++     S++  +  +V +L   N    L                          G+  +S  V    G   +T+A +       Y+     +  YA    ER  M ++   ++ I D  +     +R++FPE+W++   N   +  +   +TVPDS+T+W A  + ++E    GL   P + L+   PF+  + +PYS+   E   L + +FNY     E+ V I         + +NEIN  G +  TL     D  TV F ++P  +G++ +T+                 ++   SD+V + ILV+  G+    +++   +L  N+    L  LS F+ P   V+GS R  +T  GDV+G + + L  L+ MPYGCGEQNM+   P+IY+LDYL         L  KA S++  GY R+L Y+ +DGSFSAFG  D  GSTWL+AFVL+ F +A  Y++I+ + L     +L+  Q+S+G F + G++  S + GG K         LTAY++ SL G       I++ ++I+      +   + NY   L     +L +  S  ++     L  ++   G  ++W   + + SD  +  S DIE   YA+L+       S  +  + WLS QRNSLGG+ STQDT VAL AL+ FA  +  ++  N++V+V    + +    LI   NRL+ QT  L     + V++  NG G A  QL+ +YN+    ++         + F L V  + ++    N  ++ VC ++    + S M L+ +N  SG+        S ++ +S  + ++++   ++ LY D  S N+     C         K+SN Q A V IVDYY P   + +SY+   K  +C+   + +  RP
Sbjct:  450 PKACVIVYYIEDDGEIISDVLKIPVQLVFKNKI---KLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHELELYNTGYYL--------------------------GMFMNSFAVFQECGLWVLTDANLTK----DYIDGVYDNAEYA----ERF-MEENEGHIVDIHDFSLGSSPHVRKHFPETWIWLDTNMGYRIYQEFEVTVPDSITSWVATGFVISEDLGLGLTTTPVE-LQAFQPFFIFLNLPYSVIRGEEFALEITIFNYLKDATEVKVIIEKSDKFDILMTSNEINATGHQQ-TLLVPSEDGATVLFPIRPTHLGEIPITV---------------TALSPTASDAVTQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLS-FSFPPNTVTGSERVQITAIGDVLGPSINGLASLIRMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLYQREDGSFSAFGNYDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGHQKSNGEFWDPGRVIHSELQGGNK-----SPVTLTAYIVTSLLGYRKYQPNIDVQESIHFLESEFSRGISDNY--TLALITYALSSVGSPKAKEALNMLTWRAEQEGGMQFWVSSESKLSDSWQPRSLDIEVAAYALLSHFLQFQTSEGIPIMRWLSRQRNSLGGFASTQDTTVALKALSEFAALMN-TERTNIQVTVTGPSSPSPVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVVYNVKASGSSRRRRSIQNQEAFDLDVAVK-ENKDDLNHVDLNVCTSFSGPGR-SGMALMEVNLLSGF-----MVPSEAISLSETVKKVEYDHGKLNLYLD--SVNET--QFCVNIPAVRNFKVSNTQDASVSIVDYYEPRRQAVRSYNSEVKLSSCDLCSDVQGCRP 1338          

HSP 2 Score: 59.6918 bits (143), Expect = 7.824e-8
Identity = 79/331 (23.87%), Postives = 136/331 (41.09%), Query Frame = 1
Query:  703 YQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSK-------AKSQINVTVTEN--GTSSSVSKAVEGPGIKYNSFNIK-FDGRPYYKPGLPYFGRINLVRHNKKPAKMV----NISISIQSWAYGNNWGFIR------------NYTSNKKGVIEFVIPYIPLAQSLSIQISEVSSNLKPPMAATTVYQSLTNFQSKDGHYLQFMPINDKFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIVKM 1617
            +QL+  PI G W  +   + Q     F++ +YVLP+F V +  P       + ++  + +KY+ GKP+   ++  F  L  +GKKK +  K+  +  + N    + ++  ++ SS   S+          +I  TVTE+  G S +VS  V     K + + I+ FD     KP L +   + + R +     +     N+ I++    Y   W                NYT  + G   F I +  L  S  +Q+       K  MA  ++      F+S    Y+Q    ++  K      L +  N  +   S  V   SRGQ+V +
Sbjct:  116 FQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCSMNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNIT-KTFKINGSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNV---FFKQHDYIIEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVPQSGT--FKIEFPILEDSSELQLKAYFLGSKSSMAVHSL------FKSPSKTYIQLKTRDENIKVGSPFELVVSGNKRLKELSYMV--VSRGQLVAV 432          
BLAST of Alpha-2-macroglobulin vs. Ensembl Celegans
Match: tep-1 (TEP (ThiolEster containing Protein) [Source:UniProtKB/TrEMBL;Acc:Q7JKM0])

HSP 1 Score: 326.25 bits (835), Expect = 2.477e-90
Identity = 273/976 (27.97%), Postives = 455/976 (46.62%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAY-FINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLE-YDSRKVLSTAGFTAITNARIVNVKCMQYLA----RGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKHLNLTV--PDSMTTWRADSYCMTEK-GLWIAPT-QKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDE-----------------KTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAI--PSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENI-TNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQIST-----PLNRIDFQK--TRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPE-----IYSEKSYSMFNKACNK 4830
            IS P   NM P   +I Y  I +  EV+ DAL+        +Q+       +K+   P   V   V    K +   + + D+++L     ++     + Q L   +    +    G  R  + I +K+ + + +P +G+   D++ + S AG   +T+A +      ++++     G P  + A F+           +      +     +R++FP +W++S  N T+  + + +  PD++T+W A ++ + E+ GL +APT  KL+V  PF+  + +PY+++  E   L V VFNY     ++ V +  D +    +  K  T+   + DE                 K VYF + P  IG++ V I                 I     D+V   + V+P G   +     +I   N          +  P+++V GS ++ L   GD+MG   +N  KLV MPYGCGEQNM+ +VP+I V+ YL + N     L  KA  +I  G  R+LTYK  D SFSAFG +DK GSTWLTAFV++SFH A +Y  ++ + +  A  +L   Q   G F E+G++    M GG +      G  LTA+VLIS+  NG++       + K ++  + N  T     Y L L     +     +     +  +  D   +  + K     +  +   ++   DIETT YA+L+ +     S S+  + WL +QRN LGG+ STQDTV+AL AL+ +A  +  S     +V+ +LN   T++  I + N +V Q++ L + N   VS+  NG+G    QLS  Y+ +R  + ND        EI  ++  N   + +C  Y R  K SNM L  I+  SG+       +  + Q+ T      L R++ +K  T+M +Y++       G+  C     +   ++++ +PA  ++VDYY+PE      Y+ K      + C +
Sbjct:  549 ISFPATANMAPKSRLIVYAIIESSQEVLVDALDFKVEGIFQNQVA---LSIDKQAVEPGQNVKFKVTSD-KNSFVGLLVVDQSVLLLKTGNDITREKVEQDLENYDSN-NVGGGFGGPRPWEAIDRKK-RSIWRPWWGIGGSDAQSIFSNAGLVVLTDALLYREPQREFMSVMMMDGAPGMAEAAFA-----------APPMGGSSPPPPTVRKFFPHTWIWSDLNSTSGEVEMEIEAPDTITSWVASTFAINEENGLGVAPTTSKLRVFRPFFIQLNLPYAVRRGEKFALLVLVFNYMEKEQDVTVTLKYDKDSGYDLLKKDGTVV--RRDEVGQQNVRIVSVAGGGTSKAVYFPIVPSSIGEIPVHI---------------SAIASQGGDAVEMNLRVDPQGYKVDRNIPFVIDLNNNSSDFSKNLELIWPNDVVDGSQKARLDVIGDMMGPVLNNAHKLVQMPYGCGEQNMLNLVPNILVVKYLRATNRNESQLETKAIKFIEQGIQRELTYKRADNSFSAFGDSDKAGSTWLTAFVVRSFHHAKQYAFVDPNVISRAVAFLNSQQMESGAFAERGEVHHKDMQGGAQDG----GVALTAFVLISILENGMENGKAVTYLEKHLDEVSGNAYTMAVVAYALQLAKSKQAGKAFENLKKHKIVEKSGDVKFASAQKKVEKLKESRAYMFQARPVDIETTSYAVLSYLAQNQTSESLSIIRWLVSQRNELGGFTSTQDTVMALQALSSYA-AVTYSDKHTSQVT-ILNGKHTHSFDINIRNAIVLQSYQLSSLN-DAVSINANGTGVVFAQLS--YSYYR-DSLNDDAPFFCSQEIKEIRAGNRLQLDLCCNYTRPGK-SNMALAEIDALSGY-------RFDAEQVHTLTSIEDLQRVEMEKDDTKMNVYFNPL----GGRPVCLSLYSDVTYQVADQKPANFRLVDYYDPEEQLKMTYAAKQTRSLQEKCGE 1468          
BLAST of Alpha-2-macroglobulin vs. Ensembl Celegans
Match: tep-1 (TEP (ThiolEster containing Protein) [Source:UniProtKB/TrEMBL;Acc:Q7JKM0])

HSP 1 Score: 326.25 bits (835), Expect = 2.477e-90
Identity = 273/976 (27.97%), Postives = 455/976 (46.62%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAY-FINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLE-YDSRKVLSTAGFTAITNARIVNVKCMQYLA----RGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKHLNLTV--PDSMTTWRADSYCMTEK-GLWIAPT-QKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDE-----------------KTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAI--PSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENI-TNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQIST-----PLNRIDFQK--TRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPE-----IYSEKSYSMFNKACNK 4830
            IS P   NM P   +I Y  I +  EV+ DAL+        +Q+       +K+   P   V   V    K +   + + D+++L     ++     + Q L   +    +    G  R  + I +K+ + + +P +G+   D++ + S AG   +T+A +      ++++     G P  + A F+           +      +     +R++FP +W++S  N T+  + + +  PD++T+W A ++ + E+ GL +APT  KL+V  PF+  + +PY+++  E   L V VFNY     ++ V +  D +    +  K  T+   + DE                 K VYF + P  IG++ V I                 I     D+V   + V+P G   +     +I   N          +  P+++V GS ++ L   GD+MG   +N  KLV MPYGCGEQNM+ +VP+I V+ YL + N     L  KA  +I  G  R+LTYK  D SFSAFG +DK GSTWLTAFV++SFH A +Y  ++ + +  A  +L   Q   G F E+G++    M GG +      G  LTA+VLIS+  NG++       + K ++  + N  T     Y L L     +     +     +  +  D   +  + K     +  +   ++   DIETT YA+L+ +     S S+  + WL +QRN LGG+ STQDTV+AL AL+ +A  +  S     +V+ +LN   T++  I + N +V Q++ L + N   VS+  NG+G    QLS  Y+ +R  + ND        EI  ++  N   + +C  Y R  K SNM L  I+  SG+       +  + Q+ T      L R++ +K  T+M +Y++       G+  C     +   ++++ +PA  ++VDYY+PE      Y+ K      + C +
Sbjct:  549 ISFPATANMAPKSRLIVYAIIESSQEVLVDALDFKVEGIFQNQVA---LSIDKQAVEPGQNVKFKVTSD-KNSFVGLLVVDQSVLLLKTGNDITREKVEQDLENYDSN-NVGGGFGGPRPWEAIDRKK-RSIWRPWWGIGGSDAQSIFSNAGLVVLTDALLYREPQREFMSVMMMDGAPGMAEAAFA-----------APPMGGSSPPPPTVRKFFPHTWIWSDLNSTSGEVEMEIEAPDTITSWVASTFAINEENGLGVAPTTSKLRVFRPFFIQLNLPYAVRRGEKFALLVLVFNYMEKEQDVTVTLKYDKDSGYDLLKKDGTVV--RRDEVGQQNVRIVSVAGGGTSKAVYFPIVPSSIGEIPVHI---------------SAIASQGGDAVEMNLRVDPQGYKVDRNIPFVIDLNNNSSDFSKNLELIWPNDVVDGSQKARLDVIGDMMGPVLNNAHKLVQMPYGCGEQNMLNLVPNILVVKYLRATNRNESQLETKAIKFIEQGIQRELTYKRADNSFSAFGDSDKAGSTWLTAFVVRSFHHAKQYAFVDPNVISRAVAFLNSQQMESGAFAERGEVHHKDMQGGAQDG----GVALTAFVLISILENGMENGKAVTYLEKHLDEVSGNAYTMAVVAYALQLAKSKQAGKAFENLKKHKIVEKSGDVKFASAQKKVEKLKESRAYMFQARPVDIETTSYAVLSYLAQNQTSESLSIIRWLVSQRNELGGFTSTQDTVMALQALSSYA-AVTYSDKHTSQVT-ILNGKHTHSFDINIRNAIVLQSYQLSSLN-DAVSINANGTGVVFAQLS--YSYYR-DSLNDDAPFFCSQEIKEIRAGNRLQLDLCCNYTRPGK-SNMALAEIDALSGY-------RFDAEQVHTLTSIEDLQRVEMEKDDTKMNVYFNPL----GGRPVCLSLYSDVTYQVADQKPANFRLVDYYDPEEQLKMTYAAKQTRSLQEKCGE 1468          
BLAST of Alpha-2-macroglobulin vs. Ensembl Celegans
Match: tep-1 (TEP (ThiolEster containing Protein) [Source:UniProtKB/TrEMBL;Acc:Q7JKM0])

HSP 1 Score: 326.25 bits (835), Expect = 2.477e-90
Identity = 273/976 (27.97%), Postives = 455/976 (46.62%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAY-FINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLE-YDSRKVLSTAGFTAITNARIVNVKCMQYLA----RGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKHLNLTV--PDSMTTWRADSYCMTEK-GLWIAPT-QKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDE-----------------KTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAI--PSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENI-TNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQIST-----PLNRIDFQK--TRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPE-----IYSEKSYSMFNKACNK 4830
            IS P   NM P   +I Y  I +  EV+ DAL+        +Q+       +K+   P   V   V    K +   + + D+++L     ++     + Q L   +    +    G  R  + I +K+ + + +P +G+   D++ + S AG   +T+A +      ++++     G P  + A F+           +      +     +R++FP +W++S  N T+  + + +  PD++T+W A ++ + E+ GL +APT  KL+V  PF+  + +PY+++  E   L V VFNY     ++ V +  D +    +  K  T+   + DE                 K VYF + P  IG++ V I                 I     D+V   + V+P G   +     +I   N          +  P+++V GS ++ L   GD+MG   +N  KLV MPYGCGEQNM+ +VP+I V+ YL + N     L  KA  +I  G  R+LTYK  D SFSAFG +DK GSTWLTAFV++SFH A +Y  ++ + +  A  +L   Q   G F E+G++    M GG +      G  LTA+VLIS+  NG++       + K ++  + N  T     Y L L     +     +     +  +  D   +  + K     +  +   ++   DIETT YA+L+ +     S S+  + WL +QRN LGG+ STQDTV+AL AL+ +A  +  S     +V+ +LN   T++  I + N +V Q++ L + N   VS+  NG+G    QLS  Y+ +R  + ND        EI  ++  N   + +C  Y R  K SNM L  I+  SG+       +  + Q+ T      L R++ +K  T+M +Y++       G+  C     +   ++++ +PA  ++VDYY+PE      Y+ K      + C +
Sbjct:  549 ISFPATANMAPKSRLIVYAIIESSQEVLVDALDFKVEGIFQNQVA---LSIDKQAVEPGQNVKFKVTSD-KNSFVGLLVVDQSVLLLKTGNDITREKVEQDLENYDSN-NVGGGFGGPRPWEAIDRKK-RSIWRPWWGIGGSDAQSIFSNAGLVVLTDALLYREPQREFMSVMMMDGAPGMAEAAFA-----------APPMGGSSPPPPTVRKFFPHTWIWSDLNSTSGEVEMEIEAPDTITSWVASTFAINEENGLGVAPTTSKLRVFRPFFIQLNLPYAVRRGEKFALLVLVFNYMEKEQDVTVTLKYDKDSGYDLLKKDGTVV--RRDEVGQQNVRIVSVAGGGTSKAVYFPIVPSSIGEIPVHI---------------SAIASQGGDAVEMNLRVDPQGYKVDRNIPFVIDLNNNSSDFSKNLELIWPNDVVDGSQKARLDVIGDMMGPVLNNAHKLVQMPYGCGEQNMLNLVPNILVVKYLRATNRNESQLETKAIKFIEQGIQRELTYKRADNSFSAFGDSDKAGSTWLTAFVVRSFHHAKQYAFVDPNVISRAVAFLNSQQMESGAFAERGEVHHKDMQGGAQDG----GVALTAFVLISILENGMENGKAVTYLEKHLDEVSGNAYTMAVVAYALQLAKSKQAGKAFENLKKHKIVEKSGDVKFASAQKKVEKLKESRAYMFQARPVDIETTSYAVLSYLAQNQTSESLSIIRWLVSQRNELGGFTSTQDTVMALQALSSYA-AVTYSDKHTSQVT-ILNGKHTHSFDINIRNAIVLQSYQLSSLN-DAVSINANGTGVVFAQLS--YSYYR-DSLNDDAPFFCSQEIKEIRAGNRLQLDLCCNYTRPGK-SNMALAEIDALSGY-------RFDAEQVHTLTSIEDLQRVEMEKDDTKMNVYFNPL----GGRPVCLSLYSDVTYQVADQKPANFRLVDYYDPEEQLKMTYAAKQTRSLQEKCGE 1468          
BLAST of Alpha-2-macroglobulin vs. Ensembl Celegans
Match: tep-1 (TEP (ThiolEster containing Protein) [Source:UniProtKB/TrEMBL;Acc:Q7JKM0])

HSP 1 Score: 325.479 bits (833), Expect = 4.212e-90
Identity = 271/973 (27.85%), Postives = 456/973 (46.87%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAY-FINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLE-YDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSR-NSVLKISDAKMKKQIREYFPESWVFSYFNKTTKHLNLTV--PDSMTTWRADSYCMTEK-GLWIAPT-QKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDE-----------------KTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAI--PSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENI-TNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQIST-----PLNRIDFQK--TRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPE-----IYSEKSYSMFNKACNK 4830
            IS P   NM P   +I Y  I +  EV+ DAL+        +Q+       +K+   P   V   V    K +   + + D+++L     ++     + Q L   +    +    G  R  + I +K+ + + +P +G+   D++ + S AG   +T+A +      ++++     R+     +    M+++   +      +     +R++FP +W++S  N T+  + + +  PD++T+W A ++ + E+ GL +APT  KL+V  PF+  + +PY+++  E   L V VFNY     ++ V +  D +    +  K  T+   + DE                 K VYF + P  IG++ V I                 I     D+V   + V+P G   +     +I   N          +  P+++V GS ++ L   GD+MG   +N  KLV MPYGCGEQNM+ +VP+I V+ YL + N     L  KA  +I  G  R+LTYK  D SFSAFG +DK GSTWLTAFV++SFH A +Y  ++ + +  A  +L   Q   G F E+G++    M GG +      G  LTA+VLIS+  NG++       + K ++  + N  T     Y L L     +     +     +  +  D   +  + K     +  +   ++   DIETT YA+L+ +     S S+  + WL +QRN LGG+ STQDTV+AL AL+ +A  +  S     +V+ +LN   T++  I + N +V Q++ L + N   VS+  NG+G    QLS  Y+ +R  + ND        EI  ++  N   + +C  Y R  K SNM L  I+  SG+       +  + Q+ T      L R++ +K  T+M +Y++       G+  C     +   ++++ +PA  ++VDYY+PE      Y+ K      + C +
Sbjct:  549 ISFPATANMAPKSRLIVYAIIESSQEVLVDALDFKVEGIFQNQVA---LSIDKQAVEPGQNVKFKVTSD-KNSFVGLLVVDQSVLLLKTGNDITREKVEQDLENYDSN-NVGGGFGGPRPWEAIDRKK-RSIWRPWWGIGGSDAQSIFSNAGLVVLTDALLYREPQREFMSGTFMRRNKVMMMDGAPGMAEAAFAAPPMGGSSPPPPTVRKFFPHTWIWSDLNSTSGEVEMEIEAPDTITSWVASTFAINEENGLGVAPTTSKLRVFRPFFIQLNLPYAVRRGEKFALLVLVFNYMEKEQDVTVTLKYDKDSGYDLLKKDGTVV--RRDEVGQQNVRIVSVAGGGTSKAVYFPIVPSSIGEIPVHI---------------SAIASQGGDAVEMNLRVDPQGYKVDRNIPFVIDLNNNSSDFSKNLELIWPNDVVDGSQKARLDVIGDMMGPVLNNAHKLVQMPYGCGEQNMLNLVPNILVVKYLRATNRNESQLETKAIKFIEQGIQRELTYKRADNSFSAFGDSDKAGSTWLTAFVVRSFHHAKQYAFVDPNVISRAVAFLNSQQMESGAFAERGEVHHKDMQGGAQDG----GVALTAFVLISILENGMENGKAVTYLEKHLDEVSGNAYTMAVVAYALQLAKSKQAGKAFENLKKHKIVEKSGDVKFASAQKKVEKLKESRAYMFQARPVDIETTSYAVLSYLAQNQTSESLSIIRWLVSQRNELGGFTSTQDTVMALQALSSYA-AVTYSDKHTSQVT-ILNGKHTHSFDINIRNAIVLQSYQLSSLN-DAVSINANGTGVVFAQLS--YSYYR-DSLNDDAPFFCSQEIKEIRAGNRLQLDLCCNYTRPGK-SNMALAEIDALSGY-------RFDAEQVHTLTSIEDLQRVEMEKDDTKMNVYFNPL----GGRPVCLSLYSDVTYQVADQKPANFRLVDYYDPEEQLKMTYAAKQTRSLQEKCGE 1476          
BLAST of Alpha-2-macroglobulin vs. Ensembl Celegans
Match: tep-1 (TEP (ThiolEster containing Protein) [Source:UniProtKB/TrEMBL;Acc:Q7JKM0])

HSP 1 Score: 325.479 bits (833), Expect = 4.212e-90
Identity = 271/973 (27.85%), Postives = 456/973 (46.87%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAY-FINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLE-YDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSR-NSVLKISDAKMKKQIREYFPESWVFSYFNKTTKHLNLTV--PDSMTTWRADSYCMTEK-GLWIAPT-QKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDE-----------------KTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAI--PSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENI-TNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQIST-----PLNRIDFQK--TRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPE-----IYSEKSYSMFNKACNK 4830
            IS P   NM P   +I Y  I +  EV+ DAL+        +Q+       +K+   P   V   V    K +   + + D+++L     ++     + Q L   +    +    G  R  + I +K+ + + +P +G+   D++ + S AG   +T+A +      ++++     R+     +    M+++   +      +     +R++FP +W++S  N T+  + + +  PD++T+W A ++ + E+ GL +APT  KL+V  PF+  + +PY+++  E   L V VFNY     ++ V +  D +    +  K  T+   + DE                 K VYF + P  IG++ V I                 I     D+V   + V+P G   +     +I   N          +  P+++V GS ++ L   GD+MG   +N  KLV MPYGCGEQNM+ +VP+I V+ YL + N     L  KA  +I  G  R+LTYK  D SFSAFG +DK GSTWLTAFV++SFH A +Y  ++ + +  A  +L   Q   G F E+G++    M GG +      G  LTA+VLIS+  NG++       + K ++  + N  T     Y L L     +     +     +  +  D   +  + K     +  +   ++   DIETT YA+L+ +     S S+  + WL +QRN LGG+ STQDTV+AL AL+ +A  +  S     +V+ +LN   T++  I + N +V Q++ L + N   VS+  NG+G    QLS  Y+ +R  + ND        EI  ++  N   + +C  Y R  K SNM L  I+  SG+       +  + Q+ T      L R++ +K  T+M +Y++       G+  C     +   ++++ +PA  ++VDYY+PE      Y+ K      + C +
Sbjct:  549 ISFPATANMAPKSRLIVYAIIESSQEVLVDALDFKVEGIFQNQVA---LSIDKQAVEPGQNVKFKVTSD-KNSFVGLLVVDQSVLLLKTGNDITREKVEQDLENYDSN-NVGGGFGGPRPWEAIDRKK-RSIWRPWWGIGGSDAQSIFSNAGLVVLTDALLYREPQREFMSGTFMRRNKVMMMDGAPGMAEAAFAAPPMGGSSPPPPTVRKFFPHTWIWSDLNSTSGEVEMEIEAPDTITSWVASTFAINEENGLGVAPTTSKLRVFRPFFIQLNLPYAVRRGEKFALLVLVFNYMEKEQDVTVTLKYDKDSGYDLLKKDGTVV--RRDEVGQQNVRIVSVAGGGTSKAVYFPIVPSSIGEIPVHI---------------SAIASQGGDAVEMNLRVDPQGYKVDRNIPFVIDLNNNSSDFSKNLELIWPNDVVDGSQKARLDVIGDMMGPVLNNAHKLVQMPYGCGEQNMLNLVPNILVVKYLRATNRNESQLETKAIKFIEQGIQRELTYKRADNSFSAFGDSDKAGSTWLTAFVVRSFHHAKQYAFVDPNVISRAVAFLNSQQMESGAFAERGEVHHKDMQGGAQDG----GVALTAFVLISILENGMENGKAVTYLEKHLDEVSGNAYTMAVVAYALQLAKSKQAGKAFENLKKHKIVEKSGDVKFASAQKKVEKLKESRAYMFQARPVDIETTSYAVLSYLAQNQTSESLSIIRWLVSQRNELGGFTSTQDTVMALQALSSYA-AVTYSDKHTSQVT-ILNGKHTHSFDINIRNAIVLQSYQLSSLN-DAVSINANGTGVVFAQLS--YSYYR-DSLNDDAPFFCSQEIKEIRAGNRLQLDLCCNYTRPGK-SNMALAEIDALSGY-------RFDAEQVHTLTSIEDLQRVEMEKDDTKMNVYFNPL----GGRPVCLSLYSDVTYQVADQKPANFRLVDYYDPEEQLKMTYAAKQTRSLQEKCGE 1476          
BLAST of Alpha-2-macroglobulin vs. Ensembl Fly
Match: Tep2 (gene:FBgn0041182 transcript:FBtr0079511)

HSP 1 Score: 290.812 bits (743), Expect = 2.543e-79
Identity = 238/767 (31.03%), Postives = 376/767 (49.02%), Query Frame = 1
Query: 2641 KKQIREYFPESWVFSYF-NKTTKHLNLT--VPDSMTTWRADSYCMTEKGLWIAPTQ---KLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKI-NVD--------ANEI------NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFA-IPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQ------KSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFA-KTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYL-----RRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQ--KTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACN 4827
            + Q+R+ FPE+W+F+ F N   +   LT  +PD++T+W    + +      IA T+   K++V  PF+ +  +PYS+K  EV+ +PV +FNY     + +V + N D         NE+       V  +K  T+    N  K+V F ++PK +G   + I                  +    D++ +++ VEP GV      +  I  K++     S+ A IP+E+V  S     +  GD++G T  NLD LV MPYGCGEQNMV  VP+I VL YL     K P++ +KA+ ++  GY R+LTYKHDDGS+SAFGK+D  GSTWLTA+V++SFH A  Y +I+   +     +L   Q+  G F E GKLF          N   +   LT++VL++   N   +      I KA+    E        Y  +L    ++L       S+ V A+L   +       +W    ES+ E       K  S D+E T Y +LAL+       ++  + WL +QRNS GG+ STQDTV+ L AL  FA KT   S  ++++ S       T    +  +N LV QT +L  ++   V     G+G A +QLS  YN+        +FK++  T  D+  Q  I  + VC  Y+      +DK+SNM ++ I  PSG+    +      +Q    + R++ +   + + +Y+D+ +  D     C   +  +   ++  +PA V + DYY+ E  + + Y + +  C+
Sbjct:  660 EPQVRKEFPENWIFNIFENVGEEEFTLTKKIPDTITSWVVTGFSLNPTS-GIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKRVTIPA--NSGKSVSFMIRPKNVGFTTLKI---------------TATSALAGDAIHQKLKVEPEGVTLFENRAVFINLKDQPEMSQSLDADIPNEVVPQSEFIEFSVVGDLLGPTLQNLDNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAGTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFD---------NANQNPLALTSFVLLAFFENHELIPKYQSAIKKAVRYVAEEADKTDDQY--SLAIAAVALQLAKHPQSEKVIAKLESVARKENDRMWWSKATESTGEDGRVFHWKPRSNDVEITSYVLLALLEKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKFAYKTGSGSGTMDIEFSSAGESKNTIK--VNPENSLVLQTHDL-PKSTRKVDFTAKGTGSAMVQLSYRYNLAE-KEKKPSFKVT-PTVKDTPNQLLI--VDVCAEYVPLEDADKDKDSNMAVMEIALPSGF--VGDSTSLGKIQAVDRVKRVETKNSDSTVVVYFDSLTPGDV---RCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEYYQVKSSLCD 1385          

HSP 2 Score: 78.5666 bits (192), Expect = 6.056e-14
Identity = 58/199 (29.15%), Postives = 94/199 (47.24%), Query Frame = 1
Query:  361 TKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFDGQ-EEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYG 951
             + ++G     + ++   DK   +F +TDK  YKP D V+ R +                     LD+N    ++P+K +       +III+   N R+ Q  +V + + + + E QL++ P+ G WK     DG   E   FE+ KYVLP+F V V  P  ++  D+ I   + +KY+ GKP+  K +    M  SYG
Sbjct:   93 AEGVSGVVFKNSTKLNYADKKPSVFVQTDKATYKPADLVQFRIL--------------------FLDEN----TRPAKIEKP---ISVIIIDGAQN-RIKQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGKAT--VSMERSYG 261          
BLAST of Alpha-2-macroglobulin vs. Ensembl Fly
Match: Tep2 (gene:FBgn0041182 transcript:FBtr0079510)

HSP 1 Score: 288.115 bits (736), Expect = 1.994e-78
Identity = 235/761 (30.88%), Postives = 369/761 (48.49%), Query Frame = 1
Query: 2650 IREYFPESWVFSYFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQ---KLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKI-NVD--------ANEI------NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFA-IPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQ------KSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFA-KTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYL-----RRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQ--KTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACN 4827
            IR+ FPE+W F    +    L   +PD++T+W    + +      IA T+   K++V  PF+ +  +PYS+K  EV+ +PV +FNY     + +V + N D         NE+       V  +K  T+    N  K+V F ++PK +G   + I                  +    D++ +++ VEP GV      +  I  K++     S+ A IP+E+V  S     +  GD++G T  NLD LV MPYGCGEQNMV  VP+I VL YL     K P++ +KA+ ++  GY R+LTYKHDDGS+SAFGK+D  GSTWLTA+V++SFH A  Y +I+   +     +L   Q+  G F E GKLF          N   +   LT++VL++   N   +      I KA+    E        Y  +L    ++L       S+ V A+L   +       +W    ES+ E       K  S D+E T Y +LAL+       ++  + WL +QRNS GG+ STQDTV+ L AL  FA KT   S  ++++ S       T    +  +N LV QT +L  ++   V     G+G A +QLS  YN+        +FK++  T  D+  Q  I  + VC  Y+      +DK+SNM ++ I  PSG+    +      +Q    + R++ +   + + +Y+D+ +  D     C   +  +   ++  +PA V + DYY+ E  + + Y + +  C+
Sbjct:  687 IRKEFPETWFFENVGEEEFTLTKKIPDTITSWVVTGFSLNPTS-GIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKRVTIPA--NSGKSVSFMIRPKNVGFTTLKI---------------TATSALAGDAIHQKLKVEPEGVTLFENRAVFINLKDQPEMSQSLDADIPNEVVPQSEFIEFSVVGDLLGPTLQNLDNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAGTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFD---------NANQNPLALTSFVLLAFFENHELIPKYQSAIKKAVRYVAEEADKTDDQY--SLAIAAVALQLAKHPQSEKVIAKLESVARKENDRMWWSKATESTGEDGRVFHWKPRSNDVEITSYVLLALLEKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKFAYKTGSGSGTMDIEFSSAGESKNTIK--VNPENSLVLQTHDL-PKSTRKVDFTAKGTGSAMVQLSYRYNLAE-KEKKPSFKVT-PTVKDTPNQLLI--VDVCAEYVPLEDADKDKDSNMAVMEIALPSGF--VGDSTSLGKIQAVDRVKRVETKNSDSTVVVYFDSLTPGDV---RCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEYYQVKSSLCD 1406          

HSP 2 Score: 78.5666 bits (192), Expect = 5.498e-14
Identity = 58/199 (29.15%), Postives = 94/199 (47.24%), Query Frame = 1
Query:  361 TKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFDGQ-EEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYG 951
             + ++G     + ++   DK   +F +TDK  YKP D V+ R +                     LD+N    ++P+K +       +III+   N R+ Q  +V + + + + E QL++ P+ G WK     DG   E   FE+ KYVLP+F V V  P  ++  D+ I   + +KY+ GKP+  K +    M  SYG
Sbjct:   93 AEGVSGVVFKNSTKLNYADKKPSVFVQTDKATYKPADLVQFRIL--------------------FLDEN----TRPAKIEKP---ISVIIIDGAQN-RIKQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGKAT--VSMERSYG 261          
BLAST of Alpha-2-macroglobulin vs. Ensembl Fly
Match: Tep2 (gene:FBgn0041182 transcript:FBtr0335488)

HSP 1 Score: 287.345 bits (734), Expect = 3.450e-78
Identity = 238/765 (31.11%), Postives = 374/765 (48.89%), Query Frame = 1
Query: 2647 QIREYFPESWVF-SYFNKTTKHLNLT--VPDSMTTWRADSYCMTEKGLWIAPTQ---KLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKI-NVD--------ANEI------NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFA-IPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQ------KSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFA-KTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYL-----RRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQ--KTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACN 4827
            QIR+ FPE+W+F +  N   +   LT  +PD++T+W    + +      IA T+   K++V  PF+ +  +PYS+K  EV+ +PV +FNY     + +V + N D         NE+       V  +K  T+    N  K+V F ++PK +G   + I                  +    D++ +++ VEP GV      +  I  K++     S+ A IP+E+V  S     +  GD++G T  NLD LV MPYGCGEQNMV  VP+I VL YL     K P++ +KA+ ++  GY R+LTYKHDDGS+SAFGK+D  GSTWLTA+V++SFH A  Y +I+   +     +L   Q+  G F E GKLF          N   +   LT++VL++   N   +      I KA+    E        Y  +L    ++L       S+ V A+L   +       +W    ES+ E       K  S D+E T Y +LAL+       ++  + WL +QRNS GG+ STQDTV+ L AL  FA KT   S  ++++ S       T    +  +N LV QT +L  ++   V     G+G A +QLS  YN+        +FK++  T  D+  Q  I  + VC  Y+      +DK+SNM ++ I  PSG+    +      +Q    + R++ +   + + +Y+D+ +  D     C   +  +   ++  +PA V + DYY+ E  + + Y + +  C+
Sbjct:  672 QIRKEFPENWIFYNAENVGEEEFTLTKKIPDTITSWVVTGFSLNPTS-GIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKRVTIPA--NSGKSVSFMIRPKNVGFTTLKI---------------TATSALAGDAIHQKLKVEPEGVTLFENRAVFINLKDQPEMSQSLDADIPNEVVPQSEFIEFSVVGDLLGPTLQNLDNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAGTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFD---------NANQNPLALTSFVLLAFFENHELIPKYQSAIKKAVRYVAEEADKTDDQY--SLAIAAVALQLAKHPQSEKVIAKLESVARKENDRMWWSKATESTGEDGRVFHWKPRSNDVEITSYVLLALLEKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKFAYKTGSGSGTMDIEFSSAGESKNTIK--VNPENSLVLQTHDL-PKSTRKVDFTAKGTGSAMVQLSYRYNLAE-KEKKPSFKVT-PTVKDTPNQLLI--VDVCAEYVPLEDADKDKDSNMAVMEIALPSGF--VGDSTSLGKIQAVDRVKRVETKNSDSTVVVYFDSLTPGDV---RCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEYYQVKSSLCD 1395          

HSP 2 Score: 78.9518 bits (193), Expect = 5.127e-14
Identity = 58/199 (29.15%), Postives = 94/199 (47.24%), Query Frame = 1
Query:  361 TKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFDGQ-EEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYG 951
             + ++G     + ++   DK   +F +TDK  YKP D V+ R +                     LD+N    ++P+K +       +III+   N R+ Q  +V + + + + E QL++ P+ G WK     DG   E   FE+ KYVLP+F V V  P  ++  D+ I   + +KY+ GKP+  K +    M  SYG
Sbjct:   93 AEGVSGVVFKNSTKLNYADKKPSVFVQTDKATYKPADLVQFRIL--------------------FLDEN----TRPAKIEKP---ISVIIIDGAQN-RIKQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGKAT--VSMERSYG 261          
BLAST of Alpha-2-macroglobulin vs. Ensembl Fly
Match: Tep2 (gene:FBgn0041182 transcript:FBtr0079513)

HSP 1 Score: 280.026 bits (715), Expect = 7.687e-76
Identity = 232/766 (30.29%), Postives = 370/766 (48.30%), Query Frame = 1
Query: 2647 QIREYFPESWVFSYFNKTTKHLNLT----VPDSMTTWRADSYCMTEKGLWIAPTQ---KLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKI-NVD--------ANEI------NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFA-IPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQ------KSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFA-KTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYL-----RRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQ--KTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACN 4827
            +IR+ F + W++    ++      T    +PD++T+W    + +      IA T+   K++V  PF+ +  +PYS+K  EV+ +PV +FNY     + +V + N D         NE+       V  +K  T+    N  K+V F ++PK +G   + I                  +    D++ +++ VEP GV      +  I  K++     S+ A IP+E+V  S     +  GD++G T  NLD LV MPYGCGEQNMV  VP+I VL YL     K P++ +KA+ ++  GY R+LTYKHDDGS+SAFGK+D  GSTWLTA+V++SFH A  Y +I+   +     +L   Q+  G F E GKLF          N   +   LT++VL++   N   +      I KA+    E        Y  +L    ++L       S+ V A+L   +       +W    ES+ E       K  S D+E T Y +LAL+       ++  + WL +QRNS GG+ STQDTV+ L AL  FA KT   S  ++++ S       T    +  +N LV QT +L  ++   V     G+G A +QLS  YN+        +FK++  T  D+  Q  I  + VC  Y+      +DK+SNM ++ I  PSG+    +      +Q    + R++ +   + + +Y+D+ +  D     C   +  +   ++  +PA V + DYY+ E  + + Y + +  C+
Sbjct:  670 EIRKNFADVWIWQSIGRSVGEEEFTLTKKIPDTITSWVVTGFSLNPTS-GIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKRVTIPA--NSGKSVSFMIRPKNVGFTTLKI---------------TATSALAGDAIHQKLKVEPEGVTLFENRAVFINLKDQPEMSQSLDADIPNEVVPQSEFIEFSVVGDLLGPTLQNLDNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAGTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFD---------NANQNPLALTSFVLLAFFENHELIPKYQSAIKKAVRYVAEEADKTDDQY--SLAIAAVALQLAKHPQSEKVIAKLESVARKENDRMWWSKATESTGEDGRVFHWKPRSNDVEITSYVLLALLEKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKFAYKTGSGSGTMDIEFSSAGESKNTIK--VNPENSLVLQTHDL-PKSTRKVDFTAKGTGSAMVQLSYRYNLAE-KEKKPSFKVT-PTVKDTPNQLLI--VDVCAEYVPLEDADKDKDSNMAVMEIALPSGF--VGDSTSLGKIQAVDRVKRVETKNSDSTVVVYFDSLTPGDV---RCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEYYQVKSSLCD 1394          

HSP 2 Score: 78.1814 bits (191), Expect = 7.882e-14
Identity = 58/199 (29.15%), Postives = 94/199 (47.24%), Query Frame = 1
Query:  361 TKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFDGQ-EEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYG 951
             + ++G     + ++   DK   +F +TDK  YKP D V+ R +                     LD+N    ++P+K +       +III+   N R+ Q  +V + + + + E QL++ P+ G WK     DG   E   FE+ KYVLP+F V V  P  ++  D+ I   + +KY+ GKP+  K +    M  SYG
Sbjct:   93 AEGVSGVVFKNSTKLNYADKKPSVFVQTDKATYKPADLVQFRIL--------------------FLDEN----TRPAKIEKP---ISVIIIDGAQN-RIKQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGKAT--VSMERSYG 261          
BLAST of Alpha-2-macroglobulin vs. Ensembl Fly
Match: Tep2 (gene:FBgn0041182 transcript:FBtr0335487)

HSP 1 Score: 275.404 bits (703), Expect = 1.706e-74
Identity = 233/766 (30.42%), Postives = 371/766 (48.43%), Query Frame = 1
Query: 2650 IREYFPESWVFSYFNKTT---KHLNLT--VPDSMTTWRADSYCMTEKGLWIAPTQ---KLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKI-NVD--------ANEI------NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFA-IPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQ------KSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFA-KTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYL-----RRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQ--KTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACN 4827
            +R  F E W+++  +  +   +   LT  +PD++T+W    + +      IA T+   K++V  PF+ +  +PYS+K  EV+ +PV +FNY     + +V + N D         NE+       V  +K  T+    N  K+V F ++PK +G   + I                  +    D++ +++ VEP GV      +  I  K++     S+ A IP+E+V  S     +  GD++G T  NLD LV MPYGCGEQNMV  VP+I VL YL     K P++ +KA+ ++  GY R+LTYKHDDGS+SAFGK+D  GSTWLTA+V++SFH A  Y +I+   +     +L   Q+  G F E GKLF          N   +   LT++VL++   N   +      I KA+    E        Y  +L    ++L       S+ V A+L   +       +W    ES+ E       K  S D+E T Y +LAL+       ++  + WL +QRNS GG+ STQDTV+ L AL  FA KT   S  ++++ S       T    +  +N LV QT +L  ++   V     G+G A +QLS  YN+        +FK++  T  D+  Q  I  + VC  Y+      +DK+SNM ++ I  PSG+    +      +Q    + R++ +   + + +Y+D+ +  D     C   +  +   ++  +PA V + DYY+ E  + + Y + +  C+
Sbjct:  662 VRTNFAEVWMWTTSDNGSVGEEEFTLTKKIPDTITSWVVTGFSLNPTS-GIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKRVTIPA--NSGKSVSFMIRPKNVGFTTLKI---------------TATSALAGDAIHQKLKVEPEGVTLFENRAVFINLKDQPEMSQSLDADIPNEVVPQSEFIEFSVVGDLLGPTLQNLDNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAGTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFD---------NANQNPLALTSFVLLAFFENHELIPKYQSAIKKAVRYVAEEADKTDDQY--SLAIAAVALQLAKHPQSEKVIAKLESVARKENDRMWWSKATESTGEDGRVFHWKPRSNDVEITSYVLLALLEKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKFAYKTGSGSGTMDIEFSSAGESKNTIK--VNPENSLVLQTHDL-PKSTRKVDFTAKGTGSAMVQLSYRYNLAE-KEKKPSFKVT-PTVKDTPNQLLI--VDVCAEYVPLEDADKDKDSNMAVMEIALPSGF--VGDSTSLGKIQAVDRVKRVETKNSDSTVVVYFDSLTPGDV---RCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEYYQVKSSLCD 1386          

HSP 2 Score: 78.5666 bits (192), Expect = 5.474e-14
Identity = 58/198 (29.29%), Postives = 93/198 (46.97%), Query Frame = 1
Query:  364 KNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFDGQ-EEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYG 951
            + ++G     + ++   DK   +F +TDK  YKP D V+ R +                     LD+N    ++P+K +       +III+   N R+ Q  +V + + + + E QL++ P+ G WK     DG   E   FE+ KYVLP+F V V  P  ++  D+ I   + +KY+ GKP+  K      M  SYG
Sbjct:   94 EGVSGVVFKNSTKLNYADKKPSVFVQTDKATYKPADLVQFRIL--------------------FLDEN----TRPAKIEKP---ISVIIIDGAQN-RIKQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGK--ATVSMERSYG 261          
BLAST of Alpha-2-macroglobulin vs. Ensembl Zebrafish
Match: si:ch211-212c13.8 (si:ch211-212c13.8 [Source:ZFIN;Acc:ZDB-GENE-131118-28])

HSP 1 Score: 343.199 bits (879), Expect = 2.486e-97
Identity = 261/947 (27.56%), Postives = 456/947 (48.15%), Query Frame = 1
Query: 2056 NMGPDVHVIAYFINTDNEVVA--DALEIASGLNNCSQLGGGKFKFNKKTAMP--KSKVVLTVDPGVKENGCAIRIADEA--LLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSR----NSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDAN-EINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQ-----DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDS-VKQCNIRN--IKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQIST-------PLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            ++ P V ++AY +     ++A   +L+I     N   L     +F+   A+P  K+ + L+  PG   + C +   D++  +L+ G+  +AD  + +     + +  + +       +  C+P  R +R +     L  +    L + G    +N  +   +C+ +  RG+   +Y  F +     +  R    +S+   +       IR  FPE+W++      +  +  + +TVPD++TTW  +++C++  GL +AP  +L V  PF+  + +PYS+   E+ +L   VFNY   C  + V     ++  +       ++ C C N  +T  + L P ++G +NVT+ + ++ S    + +   +      D V R +LV+  G+    T S L+C K + L       +P +++ GS +S ++  GD++G+   NL  L+ MPYGCGEQNM  + P+IY+L YL +      A+  KA S++  GY RQL YKH DG++S FG  D  G+TWLTAFVL+SF  A KY  I+   ++ A  +L   + SDGCF ++G+LF++ M GG+      D   +TAY+  SL  ++ T  T  +         ++  +  N                ++  Q +F++L D ++S G   +W    +S+    S S D+E + Y +LA++        DL  + + V WL  Q+N+ GG+ STQDTVVAL AL+++A  +  S   +     V +   +++  +  DN+L+ Q   L      Y S++  GS C S+Q++  YNI     A     LS+  E++   K+   +N  + V   Y      +NM++V I   SG+       K+      +       P+ RID +   + +Y +     D       +  + +  ++ NL+PAV+K+ DYY     SE  YS
Sbjct:  233 DVAPVVRILAYCVLPSENIIAASKSLDIEKCFGNKVSL-----QFSPAKAVPGEKNTLQLSAQPG---SLCGLSAVDQSVLILESGKRLDADKIFSLLPFQYVYYPYSAED------EQPCLP-VRPRRSV-----LTDNVYNSLKSVGLKMASNLAVRVPECLSF--RGL---TYHRFRDIVMYHTSGRVGLGSSIESSTFDNSAVTIRTIFPETWIWDLAEVGDSGSTEVPVTVPDTITTWETEAFCLSSTGLGLAPPAQLTVFQPFFLELSLPYSIIRGEIFELKATVFNYLSKCIMVKVSPAPSSDYTLKASSDDQYSSCLCANGRQTFKWILTPSVLGVVNVTVSAEAEASQTVCDNEIVSVPERGRIDIVTRSLLVQAEGIEKTETNSWLLCPKGDSLSENVDLTVPKDVIEGSAKSSVSVIGDILGRALQNLHGLLRMPYGCGEQNMAVLSPNIYILQYLENTKQLTSAIREKASSFLKSGYQRQLNYKHFDGAYSTFGYGD--GNTWLTAFVLRSFGKAQKYTFIDPQIIQSAKDWLISRRDSDGCFIQQGRLFNNRMKGGV-----TDNVTMTAYITASLLELE-TPVTDPVVTKGLSCLRSVIEDVKNTYTTALLAYTFSLARDTNTRQQLFSKLEDLAISDGPLVHW---SQSASADDSASLDVEISSYVLLAVLTADSLTTADLGFANRIVSWLVKQQNAYGGFSSTQDTVVALQALSLYATKVFSSDGSS--TVTVQSAGDSHHFDVNQDNKLLYQEKQLANVPGKY-SIEVKGSACVSVQMAQFYNIPTPTEAK---TLSIDAEVEGDCKKTFGQNLMLNVTVTYDGPQNRTNMVIVDIKLLSGFTADTSMLKTQRQSFDSLDFFGHAPVERIDSKDDHVLVYLEEVLKEDPVN---LQIGLNQIIQVKNLKPAVIKVYDYYQTSDQSEMEYS 1134          
BLAST of Alpha-2-macroglobulin vs. Ensembl Zebrafish
Match: si:dkey-105h12.2 (si:dkey-105h12.2 [Source:ZFIN;Acc:ZDB-GENE-131118-9])

HSP 1 Score: 346.665 bits (888), Expect = 7.564e-97
Identity = 235/796 (29.52%), Postives = 394/796 (49.50%), Query Frame = 1
Query: 2470 LSTAGFTAITNARIVNVKCMQYLARGMP-DRSYA---TFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDAN-EINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQ-----DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDS-VKQCNIRNIKVCF--AYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            L   G    +N  +   +C+ Y  RG+   R  A     +  R++M  SR     ++       IR  FPE+W++      +  +  + +TVPD++TTW  +++C++  GL +AP  +L V  PF+  + +PYS+   E+ +L   VFNY   C  + V     ++  +       ++ C C N  +T  + L P ++G +N+T+ + ++ S    + +   +      D V R +LV+  G     T S L+C K + L       +P +++ GS +S ++  GD++G+   NL  L+ MPYGCGEQNM  + P+IY+L YL +      A+  KA S++  GY RQL YKH DG++S FG  D  G+TWLTAFVLKSF  A KY  I+   ++ A  +L   + SDGCF ++G+LF++ M GG+  N       +TAY+  SL  ++ T  T  +         ++  +  N                ++  Q +F +L D ++S G   +W    +S+    S S D+E + Y +LA++        DL  + + V WL  Q+N+ GG+ STQDTVVAL AL+++A  +  S   +     V +   +++  +  DN+L+ Q   L      Y S++  GS C S+Q++  YNI       +   LS+  E++   K+   +++ + F   Y      +NM++V I   SG+       K+     ++P+ RID +   + +Y       D       +  + +  ++ NL+PAV+K+ DYY     SE  YS
Sbjct:  663 LKRVGLKMASNLFVRVPECLSY--RGLTYHRKIARTGVVNTARSRMGFSRPESSLVNRDSPTVTIRTVFPETWIWDLAEVGDSGSAEVPVTVPDTITTWETEAFCLSSTGLGLAPPAQLTVFQPFFLELSLPYSIIRGEIFELKATVFNYLSKCIMVKVSPAPSSDYTLKASSDDQYSSCLCANGRQTFKWILTPSVLGVMNITVSAEAEASQTVCDNEIVSVPERGRIDIVTRSLLVQAEGTEKTETNSWLLCPKGDSLSEEMNLTLPKDVIEGSAKSSVSVIGDILGRALQNLHGLLRMPYGCGEQNMAVLSPNIYILQYLENTKQLTSAIREKASSFLKSGYQRQLNYKHFDGAYSTFGYGD--GNTWLTAFVLKSFGKAQKYTFIDPQIIQSAKDWLISRRNSDGCFIQQGRLFNNRMKGGVNNN-----VTMTAYITASLLELE-TPVTDPVITKGLSCLRSVIEDVKNTYTTALLAYTFSLARDTNTRQQLFNKLEDLAISDGPLVHW---SQSASADDSASLDVEISSYVLLAVLTADSLTTADLGFANRIVSWLVKQQNAYGGFSSTQDTVVALQALSLYATKVFSSDGSS--TVTVQSAGDSHHFDVNQDNKLLYQEKQLANVPGKY-SIEVKGSACVSVQMAQFYNI---LTPTEAKTLSIDAEVEGDCKKTFGKSLLLNFTVTYDGPQAKTNMVIVDIKLLSGFTADTSMLKTQQQSYASPVERIDSKDDHVLVYLKEVPKADPVN---LQIGLNQIIQVKNLKPAVIKVYDYYQTSDQSEMEYS 1436          

HSP 2 Score: 87.8113 bits (216), Expect = 1.278e-16
Identity = 94/349 (26.93%), Postives = 148/349 (42.41%), Query Frame = 1
Query:  346 MKCELTKNITGNFINETREIGLIDKNF--IIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINE-AMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQ-FEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFC---MLYSYGKK---KCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKS-QINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRP-YYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWG--FIRNYTSNKKGVIEF 1350
            MK EL     G     T E  ++ K++  + F +TDKPIY PG  V  R                     + LDKN   +        D  Y  +++ ++ DN R+ QW NVS     +   Y+LN +   G +K KA F G+  I   F++KKYVLP+F V V  P+++   +E +  +VC+KY+ G+P+  K     C   M + + K     C    +++ K  C        I   L S+ +     S  +   VTE GT  +++K+   P + Y    +     P  Y+ G    G+I L      P     + +       G NW    + N T++  G+  F
Sbjct:  101 MKVELQ----GESFKRTEERKVMFKSYHPLTFIQTDKPIYIPGQTVNFRI--------------------VTLDKNFAPL--------DQQYSSVVLEDSQDN-RIGQWTNVSSTRWILQRSYELNPECREGTYKLKA-FIGERMISHYFKVKKYVLPKFEVAVKKPNKVSVDEEELLIEVCAKYTYGQPVPGKSWVKVCRNSMRHFHTKDFNPLCSEETTEITKAGCAIHNF--GISVFLNSTLKERLMNSLHVEAVVTEEGTEITMTKSESVP-LTYEIGKVTLIDLPKTYEHGSVIEGKIKLFDFKDAPIPNKEVYL-----LEGENWSSKLLLNLTTDSDGLASF 407          
BLAST of Alpha-2-macroglobulin vs. Ensembl Zebrafish
Match: a2ml (alpha-2-macroglobulin-like [Source:ZFIN;Acc:ZDB-GENE-090212-1])

HSP 1 Score: 345.125 bits (884), Expect = 1.969e-96
Identity = 265/944 (28.07%), Postives = 453/944 (47.99%), Query Frame = 1
Query: 2056 NMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGK--FKFNKKTAMP--KSKVVLTVDPGVKENGCAIRIADEA--LLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMP-DRSYATFSNER---TQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDAN-EINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQ-----DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEID--SVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKA 4821
            ++ P V ++AY +     V+A     A+   +  +  G K   +F+   A+P  K+ + L+  PG   + C +   D++  +L+ G+  +AD      K+  L    ++      +   +     R +R +     L  ++ + L + G    TN  +    C+ Y  RG+   ++   + + R      +     V           IR  FPE+W++      +  +  + +TVPD++TTW  +++C++  GL +AP  +L V  PF+  + +PYS+   E+ +L   VFNY   C  + V     ++  +       ++ C C N  KT  + L P ++G +NVT+ + ++ S    + +   +      D V R +LV+  G+    T S L+C K + L       +P +++ GS +S ++  GD++G+   NL  L+ MPYGCGEQNM  + P+IY+L YL +      A+  KA S++  GY RQL YKH DG++S FG  D  G+TWLTAFVL+SF  A KY  I+   ++ A  +L   + SDGCF ++G+LF++ M GG+      D   +TAY+  SL  ++ T  T  +         ++     N                ++  Q +F +L D ++S G   +W     S+    S S D+E + Y +LA++        DL  + + V WL  Q+N+ GG+ STQDTVVAL AL+++A  +  S   +     V +   +++  +  DN+L+ Q   L      Y S++  GS C S+Q++  YNI     A  T  +  K E D  ++ Q  I +  V   Y   ++ +NM +V I   SG+        + S    + + R+D +   + +Y    S N A     ++ ++++  ++ NL+PAVVK+ DYY     SE  YS   +A
Sbjct:  535 DVAPVVQILAYCVLPSENVIA-----ANKRLDTEKCFGNKVSLQFSPAKAVPGEKNTLQLSAQPG---SLCGLSAVDQSVLILESGKRLDAD------KIFNLLPVQSVSYYPYSVEDEQACLYVRPRRSV-----LTDNTYETLKSVGLKMATNLAVRVPDCLSY--RGLTYHKNLVMYPDHRPVPVMFALGMAGVDGPVGNSPSVTIRTVFPETWIWELAEVGDSGSAEVPVTVPDTITTWETEAFCLSSTGLGLAPPAQLTVFQPFFLELSLPYSIIRGEIFELKATVFNYLSKCIMVKVSPAPSSDYTLKASSDDQYSSCLCANGRKTFKWILTPSVLGVVNVTVSAEAEASQTVCDNEIVSVPERGRIDIVTRSLLVQAEGIEKTETNSWLLCPKGDSLSEKVDLTLPKDVIEGSAKSSVSVIGDILGRALQNLHGLLRMPYGCGEQNMAVLSPNIYILQYLENTKQLTSAIREKASSFLKSGYQRQLNYKHFDGAYSTFGYGD--GNTWLTAFVLRSFGKAQKYTFIDPQIIQSAKDWLISRRDSDGCFIQQGRLFNNRMKGGVN-----DNVTMTAYITASLLELE-TPVTDPVITKGLSCLRSVIEEVKNTYTTALLAYTFSLARDTNTRQQLFNKLEDLAISDGPLVHW---SRSASADDSASLDVEISSYVLLAVLTADSLTTADLGFANRIVSWLVKQQNAYGGFSSTQDTVVALQALSLYATKVFSSDGSS--TVTVQSAGDSHHFDVNQDNKLLYQEKQLANVPGKY-SIEVKGSACVSVQIAQFYNIPTPTEAK-TLSIDAKIEGDCEALGQNFIFDFTV--KYDGPEEKTNMAIVDIKLLSGFTADTSALGTSSGTYVSLVERVDSKDDHVIVYLKEISKNVAMN---YQIQMKQVLQVKNLKPAVVKVYDYYQTSDQSEIEYSFHCEA 1437          

HSP 2 Score: 83.5741 bits (205), Expect = 2.141e-15
Identity = 87/330 (26.36%), Postives = 138/330 (41.82%), Query Frame = 1
Query:  385 INETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINE-AMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFC---MLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYS-KAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRP-YYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWG--FIRNYTSNKKGVIEF 1350
            + E R++     + + F +TDKPIY PG  V  R + +  TN               +D+   F  K    DN                R+ QW NVS     +   Y+LN +   G +K KA    +     F++KKYVLP+F V V  P  +   +E +  +VC+KY+ G+P+  K     C   + Y      C+    ++ K  C        +  IL S+ + + K    +   VTE GT  +++K+ E   + Y    I     P  Y+PG    G+I L   + K A + N  + +     G NW    + N T++  G+  F
Sbjct:  112 MTEERKVMFKSYDPLTFIQTDKPIYMPGQIVNFRVVTM-DTNFAP------------VDQQCVFGIKQDSQDN----------------RIGQWTNVSSTRWILQRSYELNPECREGAYKLKAFIGERMSSHYFQVKKYVLPKFEVTVKKPKTVSVVEEELLIEVCAKYTYGQPVPGKSWVKVCRNPLPYIIFFPLCLEETLEITKTGCAIHNF--GLSMILNSTLKDNLKDSLHVEAVVTEEGTEITMTKS-ESVHLTYEIGKITLIDLPKTYEPGSVIEGKIKL--SDFKDAPIPNKEVYLLE---GENWSSKLLLNLTTDSDGLASF 404          
BLAST of Alpha-2-macroglobulin vs. Ensembl Zebrafish
Match: a2ml (alpha-2-macroglobulin-like [Source:ZFIN;Acc:ZDB-GENE-090212-1])

HSP 1 Score: 344.739 bits (883), Expect = 2.709e-96
Identity = 265/944 (28.07%), Postives = 453/944 (47.99%), Query Frame = 1
Query: 2056 NMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGK--FKFNKKTAMP--KSKVVLTVDPGVKENGCAIRIADEA--LLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMP-DRSYATFSNER---TQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDAN-EINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQ-----DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEID--SVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKA 4821
            ++ P V ++AY +     V+A     A+   +  +  G K   +F+   A+P  K+ + L+  PG   + C +   D++  +L+ G+  +AD      K+  L    ++      +   +     R +R +     L  ++ + L + G    TN  +    C+ Y  RG+   ++   + + R      +     V           IR  FPE+W++      +  +  + +TVPD++TTW  +++C++  GL +AP  +L V  PF+  + +PYS+   E+ +L   VFNY   C  + V     ++  +       ++ C C N  KT  + L P ++G +NVT+ + ++ S    + +   +      D V R +LV+  G+    T S L+C K + L       +P +++ GS +S ++  GD++G+   NL  L+ MPYGCGEQNM  + P+IY+L YL +      A+  KA S++  GY RQL YKH DG++S FG  D  G+TWLTAFVL+SF  A KY  I+   ++ A  +L   + SDGCF ++G+LF++ M GG+      D   +TAY+  SL  ++ T  T  +         ++     N                ++  Q +F +L D ++S G   +W     S+    S S D+E + Y +LA++        DL  + + V WL  Q+N+ GG+ STQDTVVAL AL+++A  +  S   +     V +   +++  +  DN+L+ Q   L      Y S++  GS C S+Q++  YNI     A  T  +  K E D  ++ Q  I +  V   Y   ++ +NM +V I   SG+        + S    + + R+D +   + +Y    S N A     ++ ++++  ++ NL+PAVVK+ DYY     SE  YS   +A
Sbjct:  541 DVAPVVQILAYCVLPSENVIA-----ANKRLDTEKCFGNKVSLQFSPAKAVPGEKNTLQLSAQPG---SLCGLSAVDQSVLILESGKRLDAD------KIFNLLPVQSVSYYPYSVEDEQACLYVRPRRSV-----LTDNTYETLKSVGLKMATNLAVRVPDCLSY--RGLTYHKNLVMYPDHRPVPVMFALGMAGVDGPVGNSPSVTIRTVFPETWIWELAEVGDSGSAEVPVTVPDTITTWETEAFCLSSTGLGLAPPAQLTVFQPFFLELSLPYSIIRGEIFELKATVFNYLSKCIMVKVSPAPSSDYTLKASSDDQYSSCLCANGRKTFKWILTPSVLGVVNVTVSAEAEASQTVCDNEIVSVPERGRIDIVTRSLLVQAEGIEKTETNSWLLCPKGDSLSEKVDLTLPKDVIEGSAKSSVSVIGDILGRALQNLHGLLRMPYGCGEQNMAVLSPNIYILQYLENTKQLTSAIREKASSFLKSGYQRQLNYKHFDGAYSTFGYGD--GNTWLTAFVLRSFGKAQKYTFIDPQIIQSAKDWLISRRDSDGCFIQQGRLFNNRMKGGVN-----DNVTMTAYITASLLELE-TPVTDPVITKGLSCLRSVIEEVKNTYTTALLAYTFSLARDTNTRQQLFNKLEDLAISDGPLVHW---SRSASADDSASLDVEISSYVLLAVLTADSLTTADLGFANRIVSWLVKQQNAYGGFSSTQDTVVALQALSLYATKVFSSDGSS--TVTVQSAGDSHHFDVNQDNKLLYQEKQLANVPGKY-SIEVKGSACVSVQIAQFYNIPTPTEAK-TLSIDAKIEGDCEALGQNFIFDFTV--KYDGPEEKTNMAIVDIKLLSGFTADTSALGTSSGTYVSLVERVDSKDDHVIVYLKEISKNVAMN---YQIQMKQVLQVKNLKPAVVKVYDYYQTSDQSEIEYSFHCEA 1443          

HSP 2 Score: 87.0409 bits (214), Expect = 2.054e-16
Identity = 84/330 (25.45%), Postives = 140/330 (42.42%), Query Frame = 1
Query:  385 INETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINE-AMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFC---MLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYS-KAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRP-YYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWG--FIRNYTSNKKGVIEF 1350
            + E R++     + + F +TDKPIY PG  V  R                     + +D N   + +          + +I++E   + R+ QW NVS     +   Y+LN +   G +K KA    +     F++KKYVLP+F V V  P  +   +E +  +VC+KY+ G+P+  K     C   + Y      C+    ++ K  C        +  IL S+ + + K    +   VTE GT  +++K+ E   + Y    I     P  Y+PG    G+I L   + K A + N  + +     G NW    + N T++  G+  F
Sbjct:  118 MTEERKVMFKSYDPLTFIQTDKPIYMPGQIVNFRV--------------------VTMDTNFAPVDQ---------QYSIIVLEDSQDNRIGQWTNVSSTRWILQRSYELNPECREGAYKLKAFIGERMSSHYFQVKKYVLPKFEVTVKKPKTVSVVEEELLIEVCAKYTYGQPVPGKSWVKVCRNPLPYIIFFPLCLEETLEITKTGCAIHNF--GLSMILNSTLKDNLKDSLHVEAVVTEEGTEITMTKS-ESVHLTYEIGKITLIDLPKTYEPGSVIEGKIKL--SDFKDAPIPNKEVYLLE---GENWSSKLLLNLTTDSDGLASF 410          
BLAST of Alpha-2-macroglobulin vs. Ensembl Zebrafish
Match: sb:cb37 (sb:cb37 [Source:ZFIN;Acc:ZDB-GENE-030131-9800])

HSP 1 Score: 341.658 bits (875), Expect = 3.330e-95
Identity = 262/947 (27.67%), Postives = 447/947 (47.20%), Query Frame = 1
Query: 2056 NMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGK--FKFNKKTAMP--KSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKC------IPQKRVKRMIQPIYGLEYD-SRKVLSTAGFTAITNARIVNVKCMQY--LARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDAN-EINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQ-----DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEID--SVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKA 4821
            ++ P V ++AY +     V+A     A+   +  +  G K   +F+   A+P  K+ + L+  PG   + C +   D+++L                +++   ++  D    LL  H        +   +    ++P   L  D + + L + G    TN  +   +C+ Y  LA       Y   +      ++    V  +        IR  FPE+W++      +  +  + + VPD++TTW  +++C++  GL +AP  +L V  PF+  + +PYS+   E+ +L   VFNY   C  + V     ++  +       ++ C C N  KT  + L P ++G +NVT+ + ++ S    + +   +      D V R +LV+  G+    T S L+C K + L       +P +++ GS +S ++  GD++G+   NL  L+ MPYGCGEQNM  + P+IY+L YL +      A+  KA S++  GY RQL YKH DG++S FG  D  G+TWLTAFVL+SF  A KY  I+   ++ A  +L   + SDGCF ++G+LF++ M GG+      D   +TAY+  SL  ++ T  T  +         ++     N                ++  Q +F +L D ++S G   +W    +S+    S S D+E + Y +LA++        DL  + + V WL  Q+N+ GG+ STQDTVVAL AL+++A  +  S   +     V +   +++  +  DN+L+ Q   L      Y S++  GS C S+Q++  YNI     A  T  +  K E D  ++ Q  I +  V   Y   ++ +NM +V I   SG+        + S    + + R+D +   + +Y      N A     ++ ++++   + NL+PAVVK+ DYY     SE  YS   +A
Sbjct:  541 DLTPVVQILAYCVLPSENVIA-----ANKTLDTEKCFGNKVSLQFSPAKAVPGEKNTLQLSAQPG---SLCGLSAVDQSVL----------------ILESGKRLEADKIFNLLPVHSVSDYPYSVEDGQACLYVRPRRSLLTDNTYETLKSVGLKMATNLAVRVPECLLYKGLAYHKNFVMYRQNAPAPGMFAQGMAGVDGLVGNSPSVTIRTVFPETWIWELAEVGDSGSAEVPVKVPDTITTWETEAFCLSSTGLGLAPPAQLTVFQPFFLELSLPYSIIRGEIFELKATVFNYLSKCIMVKVSPAPSSDYTLKASSDDQYSSCLCANGRKTFKWILTPSVLGVVNVTVSAEAEASQTVCDNEIVSVPERGRIDIVTRSLLVQAEGIEKTETNSWLLCPKGDSLSEKVDLTLPKDVIEGSAKSSVSVIGDILGRALQNLHGLLRMPYGCGEQNMAVLSPNIYILQYLENTKQLTSAIREKASSFLKSGYQRQLNYKHFDGAYSTFGYGD--GNTWLTAFVLRSFGKAQKYTFIDPQIIQSAKDWLISRRDSDGCFIQQGRLFNNRMKGGVN-----DNVTMTAYITASLLELE-TPVTDPVITKGLSCLRSVIEEVKNTYTTALLAYTFSLARDTNTRQQLFNKLEDLAISDGPLVHW---SQSASADDSASLDVEISSYVLLAVLTADSLTTADLGFANRIVSWLVKQQNAYGGFSSTQDTVVALQALSLYATKVFSSDGSS--TVTVQSAGDSHHFDVNQDNKLLYQEKQLANVPGKY-SIEVKGSACVSVQIAQFYNIPTPTEAK-TLSIDAKIEGDCEALGQNFIFDFTV--KYDGPEEKTNMAIVDIKLLSGFTADTSALGTSSGTYVSLVERVDSKDDHVIVYLKEIPKNVAMN---YQIQMKQVLPVKNLKPAVVKVYDYYQTSDQSEIEYSFHCEA 1443          

HSP 2 Score: 83.1889 bits (204), Expect = 3.241e-15
Identity = 82/331 (24.77%), Postives = 138/331 (41.69%), Query Frame = 1
Query:  385 INETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINE-AMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQ-FEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFC---MLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYS-KAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRP-YYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWG--FIRNYTSNKKGVIEF 1350
            + E R++     + + F +TDKPIY PG  V  R                     + +D N   + +          + +I++E   + R+ QW NVS     +   Y+LN +   G +K KA F G+  I+  F++KKYVLP+F V +  P  +   +E +  +VC+KY+ G+P+  K     C   + Y +    C+    ++ K  C        +  IL S+ + + K    +   VTE GT  + +K+ E   + Y          P  Y+ G    G+I L      P     + +       G NW    + N T++  G+  F
Sbjct:  118 MTEERKVMFKSYDPLTFIQTDKPIYMPGQIVNFRV--------------------VTMDTNFAPVDQ---------QYSIIVLEDSQDNRIGQWTNVSSTRWILQRSYELNPECREGAYKLKA-FIGERMILHDFQVKKYVLPKFEVTLKKPKTVSVVEEELLIEVCAKYTYGQPVPGKSWVKVCRDPLPYIFFFPLCLGETLEITKTGCAIHNF--GLSMILNSTLKNNLKDSLHVEAVVTEEGTEITRTKS-ESVHLTYEIGKATLIDLPKTYEHGSVIKGKIKLFDFKDAPIPNKEVYL-----LEGENWSSKLLLNLTTDSDGLASF 410          
BLAST of Alpha-2-macroglobulin vs. Ensembl Xenopus
Match: a2ml1 (alpha-2-macroglobulin-like 1 [Source:NCBI gene;Acc:100127688])

HSP 1 Score: 345.895 bits (886), Expect = 2.228e-96
Identity = 239/749 (31.91%), Postives = 384/749 (51.27%), Query Frame = 1
Query: 2650 IREYFPESWVFSY---FNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDAN-EINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICN-------KNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYW---PFDKESSDE--QKSNSADIETTGYAILALIN--HQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAK-TIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIR--NIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSC-FRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACN 4827
            IR YFPE+W++            ++ + PD++T W A ++CM   G  I+P   L+   PF+  + +PYS+   E   L   VFNY   C ++   +      E        ++ C C ++ KT Y+NLK   +G++N+T+ + +  +      +   +     SD+V + +LV+P GV  E + S LIC+       K E + +     +P  I+ GS R+Y+T  GD+MG    NLD+L+ MPYGCGEQNMV   P+I++L YL + +  +P +  KAK ++  GY RQLTYK +DGS+SAFG  D  G+TWLTAFV+KSF  A  Y+ I+   L  +  +L+  ++  GCF   GKLF++ M GG+      D   L+AYV I+L    L+     ++ A++C  +     +  Y            +  +   + + A+L +++V      +W   P  K S      ++ SA++E T YA+LAL++  ++DL  + + V WLS Q+N  GG+ STQDTVVAL ALA +A+ T     +V + V+     ++ ++  +   NRL+ Q  +L      Y S+   GS C  +Q    YNI     ++ TF + V+T+     Q  ++  +I +   Y    + SNM LV +   SG+   +   K L    S  + R + Q   + LY      N+ G D   F   +E+  ++ NL+PA VK+ DYY     +E + + +N  C+
Sbjct:  723 IRAYFPETWIWQLEPVGESGRAEVHGSAPDTITEWNAGAFCMGPSGFGISPPTSLRAFQPFFVELTLPYSVVRGESFTLKASVFNYLKQCIKVQTTLQPSLELEQEPCADCQYSSCICADESKTFYWNLKASNLGEVNITVRTEALNTQDMCNNEIPIVPKQGHSDTVIKPLLVQPGGVLIEKSHSSLICSPEGEDHSKTEDISL----NVPENILEGSERAYVTALGDLMGTAMQNLDRLLAMPYGCGEQNMVLFAPNIFILQYLENTHQLSPEIQTKAKGFLESGYQRQLTYKRNDGSYSAFGSRDPEGNTWLTAFVVKSFSKARPYIFIDGDHLNHSFSWLKDKRQRSGCFRSVGKLFNNAMKGGVD-----DEISLSAYVTIALMEAGLSKEDPMVSDALSCLRKAARKVSSAY-TQALLAYTFTLSDDTKHREKLLAKLEEKAVRKDGQLHWERKPASKASDLPYWYRAPSAEVELTSYALLALLSGPNKDLGKASEIVNWLSKQQNPYGGFSSTQDTVVALQALAKYAEATFSDKGDVTVTVTSKTGFHQQFH--VDQTNRLLLQKASLPDIPGEY-SLSATGSSCVYVQTVLRYNIPPP-RSDATFSVRVETQPKQCPQEPMKQMHIDIYIQYTGSREKSNMALVEVKMLSGFIPVKSTIKQLVS--SNTIKRSEIQTDMVTLY-----LNELGHDPVHFSIMVEQDIEVKNLKPATVKVYDYYE---TAEHAVTEYNSPCS 1447          

HSP 2 Score: 71.633 bits (174), Expect = 1.711e-11
Identity = 54/214 (25.23%), Postives = 91/214 (42.52%), Query Frame = 1
Query:  640 PDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFC---MLYSYGKKK-----CVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTS---SSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKP 1245
            P+  R+AQW +V++ + +  L   L+ +P  G +         + +  F +++YVLP+F V    P  +    E    K C +Y+ GKP+        C   + Y +G        CV F   L +  C+ +   S+   +   ++   +   +   T+TE GT    S   K +    +   SF    D    YKPG+PY G + +V  N  P
Sbjct:  166 PNKNRIAQWLDVTLTQGIAELSLPLSPEPSLGEYSIHV----GDTVHYFSVEEYVLPKFEVSFQFPKVVFFTSEQFQLKTCGRYTYGKPVQGTYKATVCRKVIRYWWGHNDDRSDLCVDFSGKLDQSGCSTLTATSENFNL---TYNTHEMGLEGTSTITEGGTGVEYSGSGKTIISSVVTSCSF---LDADSNYKPGIPYSGTVKVVDANDDP 369          
BLAST of Alpha-2-macroglobulin vs. Ensembl Xenopus
Match: pzp (pregnancy-zone protein [Source:NCBI gene;Acc:779547])

HSP 1 Score: 342.043 bits (876), Expect = 3.274e-95
Identity = 281/998 (28.16%), Postives = 462/998 (46.29%), Query Frame = 1
Query: 1984 NETEIRKFEKQTIFERIISIPLMKNMGPDVHVIAYFINTDNEVVADA--LEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKH-KCIPQKR-----VKRMIQPI-YGLEYDSRKVLSTAGFTAITNARIVN-VKCMQYLARG-----MP----DRS--YATFSNERTQM-SKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEIN-VKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELIC-------NKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQ-----KSNSADIETTGYAILALIN--HQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLD--NRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFA--YLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKSDEK 4842
            NE E+ + E        I + L  ++ P + V+ Y +    ++ AD+   ++     N   +G     F+    +P + V L V      + C +R+ D++++   +      +  +  L         D RI     H    P  R      KR IQP  +  E D   +        ITNA I   V+C  Y  RG     MP    DR    A+ S ER  M   +    ++  + +  + IR YFPE+W++            ++ + PD++T W A ++CM   G  I+P   L+V  PF+  + +PYS+   E   L   VFNY   C ++  + +     E+       ++ C C  + KT Y+NLK   +G++NVT+ + +  +      +   +     SD+V + +LV+P GV  E + S L+C        K E++ +     +P  I+  S R+Y T  GD+MG    NL +L+ MPYGCGEQNM    P+I++L YL       P + +KAK ++  GY RQLTYK +DGS+SAFG+ DK G+TWLTAFV+ SF  A  Y+ I+ S L  +  +L   +   GCF   G+LF++ + GGI      D   L+ YV ++L    ++     +  A++C  +   + +  Y            +    L + + A+L +++V      +W     +         ++ SA++E T Y +LA ++  ++DL  + + V WLS Q+N  GG+ STQDTVVAL ALA + +     +     V+  +     ++    +D  NRL+ Q  +L      Y S+   GSGC  +Q    YNI     ++ TF + V+TE D   Q  ++ +K+     Y    + SNM ++     SG+     +     L+ S  + R +     + LY D   +          F +E+   + NL+PA VK+ DYY+ E   E++ + +N  C    +K
Sbjct:  479 NEDEVLRGEVS------IKLDLSADVSPTLRVLTYILLPGGDMPADSATFKLQRCFRNKVSVG-----FSPDEVLPGADVSLQVQAAAG-SLCGLRVVDQSVV-LMKPDKELTANKIHDLFPSRDFGNYDYRIQEYDDHCPFFPYWRPWNRFFKRSIQPWHFPEERDVYSLFKKMRIKIITNADIKKPVECQHYDFRGPGLPGMPGIPGDRRVVMASPSIERDVMVGAAMPDTIQQPEPEAAEIIRTYFPETWIWELAPVGESGRAEVHGSAPDTITEWNAGAFCMGPSGFGISPPTSLRVFQPFFVELALPYSVVRGESFTLKATVFNYLKQCIKVQTILLPSQELELEPCADCQYSSCLCAEESKTFYWNLKASNLGEVNVTVKTEALDTQDLCNNEFPIVPKQGRSDTVVKPLLVQPGGVLIEKSHSSLLCCQAGEDHPKTEEISL----KVPENILKDSERAYATVLGDLMGTAMQNLGRLLAMPYGCGEQNMALFAPNIFILQYLTKTRQLTPEVQSKAKGFLESGYQRQLTYKRNDGSYSAFGQRDKEGNTWLTAFVVNSFSKARPYIFIDESHLNHSFSWLRDNRNESGCFRSVGRLFNNALKGGID-----DETSLSTYVTMALLEAGVSVQDPVVADALSCLRKAAKDVSSVY-TQALLAYTFTLSKDIELREMLLAKLEEKAVRNEGQLHWERKPATVPSDLPYWYRAPSAEVELTSYVLLAHLSGPNKDLGKASEIVNWLSKQQNPYGGFSSTQDTVVALQALAKYGEATFTDKG---DVTATVTSKTGFHQQFHVDQTNRLLLQKASLPDIPGEY-SLSATGSGCVYVQTVLRYNIPPP-RSDATFSVRVETEPDKCPQDQLKVLKISMTAQYTGSREKSNMAVIECKMLSGF--IPVKSSVRKLEKSRTIKRSEILTEMVTLYLDELGHEPLH----LSFMVEQDIVVKNLKPATVKVYDYYDTE---EEAVAEYNSPCGSDGDK 1439          

HSP 2 Score: 90.5077 bits (223), Expect = 2.921e-17
Identity = 74/305 (24.26%), Postives = 131/305 (42.95%), Query Frame = 1
Query:  376 GNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCM-LYSY--------GKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINV----TVTENGTSSSVSKAVEGPGIKYNSFNIKF-DGRPYYKPGLPYFGRINLVRHNKKP 1245
            G  I+ +R + +      +F +TDK +YKPG  VR R +++   NL  E  ++                 P+           I ++ P   R+ QW NVS+ + +  L   L+ +P  G +  +     ++ +  F +++YVLPRF V +  P  +    +  +  +C++Y+ GKP+        C   YSY        G+  C  F   L +  C+ + ++S    +L S +       Q+N+    +V E+GT   +S +     I      + F D    YKPG+ Y G + +V  +  P
Sbjct:   74 GETISNSRRVLVKRARTSLFVQTDKAVYKPGQTVRFRVVSLK-ENLQPEESQV-----------------PT-----------IELQDPGKNRIGQWLNVSLQQGIAELSLPLSSEPSLGEYSIRV----KDTVHGFSVEEYVLPRFEVTLQLPRVVAVNSKQFAVNICARYTYGKPVQGTYKVNVCRKHYSYRTMVASDQGRDLCADFSGTLSQSGCSTLDVQSSTYNLLLSEW-------QLNLEGTGSVLEDGTGIEISASGRS-QISSQLTTVTFLDADDTYKPGISYIGTVKVVDASDTP 337          
BLAST of Alpha-2-macroglobulin vs. Ensembl Xenopus
Match: lrrc2 (leucine rich repeat containing 2 [Source:Xenbase;Acc:XB-GENE-962135])

HSP 1 Score: 295.434 bits (755), Expect = 1.736e-80
Identity = 255/932 (27.36%), Postives = 445/932 (47.75%), Query Frame = 1
Query: 2056 NMGPDVHVIAYFINTDNEVVADA--LEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSS--NADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIY--GLEYDSRKVLSTAGFTA-ITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTT---KHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEI--NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNK-NEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQ-------SVSFGRYKYWPFDKESSDE---QKSNSADIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVC--FAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYY-DAFSYNDAGKDSCFRFKIEEKTKISNLQPAVV 4755
            N+ P  + + Y I    EV+AD+  L++     N  +L      F+   A+P +   L +      + CA+R  DE++L     +  +A   Y +  L  L+  I   + +  L    CI        ++P++  G+ Y S   ++   F   ++ +  + V+    +  GM              +   RN  + +++  ++  +R+YFPE+W++            L +TVPD++TTW+A  +C ++  G  ++ T  L    PF+  + +PYS    E+  L   VFNY      + + +  D+N+       ++    C   N + T+ + +  K +G++N T+ + +       E +         D++ + I+VE   +  +   ++ +C++  E + +     +P ++V GS R+Y +  GD++G    NL  LV MPYGCGEQNMV   P IY+ +YLN  N   P + +K  SY+  GY +QL+YKH DGS+SAFG+    G+TWLTAF +KSF  A  ++ I    +  A  +L   Q+ +GCF   GKLF++ M GG+      D   L AY+ I+L    L  T   +  A+ C    +      Y  AL +Y  +L        Q    Q LD+       +V   R ++   D    D    +++ SA++E   Y +LAL     ++ +DL+++ + V W+  Q+N  GG+ STQDTVVAL AL+++  ++ +S +    VS+ L++       +   NRL+ Q   L      Y++   +GSGC  +Q +  YN+  +   +  F +SV T+ ++  + +++   +    +Y+ +  NSNM +V +  PSG+         + ++ S    RI F  +  E +  +   + D      FRF +E++  I NLQPA V
Sbjct:  509 NIAPSANFLVYLILESGEVIADSISLKVEKCFGNKVEL-----SFSPSEALPGAPADLHLLTA-PSSLCALRAVDESVLILKPEAELSAQTIYNLLPLQDLSGYIHDGNFLEELWDDPCIK-------MEPLFINGIYYISCSFITGGPFAVPMSLSAGMGVQAGMGVQAGMSGAG----------LHIGRN--IPVAEPVIET-VRKYFPETWLWQLVETDADGKADLAVTVPDTITTWKAGMFCTSQGAGFGLSETISLVAFQPFFLELTLPYSAIRGEIFTLKATVFNYLSQTIRVGILLE-DSNQFLAKPTKVQEDGYCVTANGQVTLSWEVTLKSLGEVNFTMSAETLNGEGLCENEIVSPAQGRKDTITKHIIVEVGALWGKR--ADFLCSEITENIPL----KLPEKVVEGSARAYFSAVGDILGTAMQNLGNLVQMPYGCGEQNMVLFTPIIYISEYLNKTNQLTPEMKSKTLSYMSTGYQKQLSYKHPDGSYSAFGQRYGEGNTWLTAFTMKSFARARAHIYIEEKLITGALLWLSIRQKPNGCFHSVGKLFNNAMKGGVD-----DEVTLAAYITIALLEYPLPVTHPTVRNALFCLESALGGKNGIYTKALMAYAFTLAGRMDIRRQ--LLQSLDEQAIKKDGTVHLHRPEFS--DDSGVDRFPYRRAPSAEVEMNSYMLLALLSKHNVSDEDLTLATQVVSWMIKQQNPNGGFSSTQDTVVALQALSLYG-SLTLSHDAMRTVSLSLDKTPVAEFHVEDSNRLLLQRIALKEVPGDYLA-TVSGSGCLYLQTTLRYNV-PIPKEDAPFTISVTTDPETCDRKSLKTFTIVANVSYVGKRLNSNMAVVEVKLPSGY---------IPIKPSVKKVRISFIASGAEAHANEVILFKDI---QSFRFSVEQEIPIGNLQPATV 1383          

HSP 2 Score: 104.375 bits (259), Expect = 1.574e-21
Identity = 103/401 (25.69%), Postives = 178/401 (44.39%), Query Frame = 1
Query:  358 LTKNITGNFIN--ETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLE-YQLNKDPIFGIWKAKAVFDGQEEIIQ-FEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDG-RPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQI----SEVSSNLKPPMAATTVYQ----SLTNFQSKDGHYLQFMPINDKFKC 1521
            LT ++ G+ ++    R+I +      +F +TDKPIYKPG KV+ R  +                    LD+N   +S+                + P   R++QW NV + + +  E +QL+ +P  GI+K     +    +   F +++YVLP++ V+V  P  +   D+ I   VC +Y+ GKP+  +I    C  +S     C   +       C    + +++  +  S +   + K + + T+ E+GT   ++ AV    IK     + F     +Y+ GLP FG++ L   +  P  M N ++ I    YG N+     YT+ + G  EF+I    + +S S+QI     E  S  +    + + YQ    S+  F S+   YL+  PI    +C
Sbjct:   97 LTLDVQGDALHFKSQRKILIKPLQNPVFIQTDKPIYKPGQKVQFRIAS--------------------LDENFHPVSE----------------KDPQGNRISQWLNVELKKGLTQESFQLSSEPTLGIYKLTVGREKSAPVTHSFSVEEYVLPKYEVQVKLPPVVGIMDKGIKVTVCGRYTYGKPVLGRIKVRVCRKFSDRYNLCKGEEDGAGPNGCFSEVVSTRMFQMRRSGY---EDKIRASATIIEDGTGVELTAAVSSE-IKKTLAKVSFRHLDSHYRKGLPLFGQLFLEDASGNP--MANETVVI-FVGYGTNF----TYTTGQDGTAEFLIDTSNVQKS-SLQIRARYKEGESCYQYRWVSVS-YQGDERSVKEFYSRAKSYLKIQPIYKILEC 448          
BLAST of Alpha-2-macroglobulin vs. Ensembl Xenopus
Match: tubal3.1 (tubulin alpha like 3, gene 1 [Source:Xenbase;Acc:XB-GENE-490055])

HSP 1 Score: 293.123 bits (749), Expect = 8.697e-80
Identity = 258/962 (26.82%), Postives = 438/962 (45.53%), Query Frame = 1
Query: 2032 IISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSK--VVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSY-LVQKLIKLNHKITLDSR---IGLLRKHKCIPQKRVKRMIQPIY--GLEY---------DSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFS-NERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTT---KHLNLTVPDSMTTWRADSYCMTEK-GLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKI-NVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDE-------QKSNSADIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVC--FAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            +  +P+  N+ P   ++ Y +    EV+AD++ +   +  C +    K  F+    +P S+  + L  +P    + CA+R  DE++L       A+LS   +  L+ L      D     +  LR   C+P       ++P+Y  G+ Y         D+  +L + G    TN  I   K   Y     P+ +   F   E   M+      +++ +      +R+YFPE+W++            L +TVPD++TTW+A  +C ++  G  ++ T  L    PF+  + +PYS    E   L   VFNY      + + + + D        L+    C   N   T+ +++  K +G++N T+ + +       E +         D++ + ILVEP GV  E T + +IC K  ++       +P  +V GS R+Y +  GD++G    NL  LV MPYGCGEQNMV   P IY+ +YLN  N   P + +K  SY+  G  R L+         +F K        LTAF +KSF  A  ++ I    + +A  +L   Q+ +GCF   GKLF++ M GG+      D   L AY+ I+L    L  T   +  A+ C    +      Y  AL +Y  +L        Q +   L +Q++      +W   + S D         ++ SA++E T Y +L L     ++ +DL+++ + V W+  Q+N  GG+ STQDTVVAL ALA++  ++ +S++    V + L +       +   NRL+ Q   L      Y +   +GSGC  ++ +  YN+      +  F + V TE  +  + ++++  +    +Y+ +  NSNM L+ I  PSG  +  +       +++  + R + Q  ++ +Y++            F F +E+   ISNLQPA   I DYY  + ++   YS
Sbjct:  417 LFDLPVGTNVSPSAKILVYLVLESGEVIADSITLK--VVQCFE-NKVKLSFSPTEGLPGSQAHLRLVTNP---TSLCAVRAVDESVLLL--KPEAELSARTIYDLLPLKDLSGYDHDGKFLEELRDDPCLP-------LEPMYINGIYYTPSNPDWDTDTYTILKSLGLKVFTNTNIRTPKLHFYFI-ACPNINLFYFGFTEELAMAPMAMRYMEVIET-----VRKYFPETWLWDLVETDADGKADLAVTVPDTITTWKAGMFCTSQSAGFGLSETISLVAFQPFFLELTLPYSAIRGEKFILKATVFNYLSQTIRVAISLEDSDQFLAKPSNLQEDGYCVKGNGRVTLSWDVTLKSLGEVNFTMSAETLTGEGLCENEIVDPIQGRKDTITKHILVEPEGVEKEETQNAMICGKGSEITEDIHLKLPERVVEGSARAYFSAVGDILGTAIQNLGNLVQMPYGCGEQNMVLFTPIIYISEYLNKTNQLTPEMKSKTLSYMSTG-KRDLSCTL----MCSFAK-------GLTAFTMKSFARARAHIYIEEKLISDALTWLSNHQKENGCFHSVGKLFNNAMKGGVD-----DEVTLAAYITIALLEYPLPVTHPTVRNALFCLESALGGKNSIYTKALMAYAFTLAGRMDIRRQ-LLQSLDEQAIKKDGTVHWQRPETSDDSGHYRNPYSQAPSAEVEMTSYGLLTLLSKPDVSDEDLTLATQVVSWIIKQQNPSGGFSSTQDTVVALQALALYG-SLTLSRDSTRTVLLSLEKTPVAKFNVEDSNRLLLQQIALKEVPGDYTA-TVSGSGCLYLKTALRYNVPHP-KEDAAFTILVTTEPTACDRKSLKSFAIVANVSYIGKRANSNMALMEIKMPSG-HVPVKSSVKKLPRLNNFIKRTEIQTNKVNVYFEL-------DIQSFSFLVEQDIPISNLQPATAIIYDYYEKDDFAVTKYS 1328          

HSP 2 Score: 90.5077 bits (223), Expect = 2.353e-17
Identity = 91/386 (23.58%), Postives = 165/386 (42.75%), Query Frame = 1
Query:  427 IIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEY-QLNKDPIFGIWKAKAVFD-GQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASS-FRYSKAKSQINVT----VTENGTSSSVSKAVEGPG-IKYNSFNIKFDG-RPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQISEVSSNLKPPMA--------ATTVYQSLT----NFQSKDGHYLQFMPINDKFKC 1521
            ++F +TDKPIYKPG KV+ R ++                    LD+N   +S+                + P   R++QW NV + + +  E+ QL+ +P  G +      + G      F +++YVLP++ V+V  P+ +    + +   VC +Y+ GKP+  +I+   C  +S     C   +  + ++   +  L   I  ++ +  F+  +A  ++ +     +TE+GT   ++   EG   IK     + F     +YK G+P +G++ L      P  M N ++ +    Y  N G    YT+ + G  EF I       + S Q+S V   +              T  Y+  T    +F S+   +L+  PI+   +C
Sbjct:   38 LVFVQTDKPIYKPGQKVQFRIVS--------------------LDENFYPVSE----------------KDPQGNRISQWLNVELKKGLTQEFFQLSPEPTLGTYSLIVEREKGAPVTHSFSVEEYVLPKYEVQVKLPATLTILGQEVPVTVCGRYTYGKPVLGRINVRVCRKFSDRYNLCQGEEDGVCEEISQRADLNGCISDVVNTKVFQMRRAGYEMKIIASAKITEDGTGVELTG--EGSSEIKSTLATVSFRHLDSHYKKGIPLYGQVFLEDAAGNP--MSNETVVV----YVGNDGTNFTYTTGQDGTAEFSI------DTSSFQLSSVRIKVIYKTGDYCSGHRWLTASYEEDTRHVNHFYSRSKSFLKIQPIHRTLEC 373          
BLAST of Alpha-2-macroglobulin vs. Ensembl Xenopus
Match: lrrc2 (leucine rich repeat containing 2 [Source:Xenbase;Acc:XB-GENE-962135])

HSP 1 Score: 290.426 bits (742), Expect = 8.658e-79
Identity = 216/729 (29.63%), Postives = 365/729 (50.07%), Query Frame = 1
Query: 2644 KQIREYFPESWVFSYFNKTT---KHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEI--NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNK-NEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQ-------SVSFGRYKYWPFDKESSDE---QKSNSADIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVC--FAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYY-DAFSYNDAGKDSCFRFKIEEKTKISNLQPAVV 4755
            + +R+YFPE+W++            L +TVPD++TTW+A  +C ++  G  ++ T  L    PF+  + +PYS    E+  L   VFNY      + + +  D+N+       ++    C   N + T+ + +  K +G++N T+ + +       E +         D++ + I+VE   +  +   ++ +C++  E + +     +P ++V GS R+Y +  GD++G    NL  LV MPYGCGEQNMV   P IY+ +YLN  N   P + +K  SY+  GY +QL+YKH DGS+SAFG+    G+TWLTAF +KSF  A  ++ I    +  A  +L   Q+ +GCF   GKLF++ M GG+      D   L AY+ I+L    L  T   +  A+ C    +      Y  AL +Y  +L        Q    Q LD+       +V   R ++   D    D    +++ SA++E   Y +LAL     ++ +DL+++ + V W+  Q+N  GG+ STQDTVVAL AL+++  ++ +S +    VS+ L++       +   NRL+ Q   L      Y++   +GSGC  +Q +  YN+  +   +  F +SV T+ ++  + +++   +    +Y+ +  NSNM +V +  PSG+         + ++ S    RI F  +  E +  +   + D      FRF +E++  I NLQPA V
Sbjct:  716 ETVRKYFPETWLWQLVETDADGKADLAVTVPDTITTWKAGMFCTSQGAGFGLSETISLVAFQPFFLELTLPYSAIRGEIFTLKATVFNYLSQTIRVGILLE-DSNQFLAKPTKVQEDGYCVTANGQVTLSWEVTLKSLGEVNFTMSAETLNGEGLCENEIVSPAQGRKDTITKHIIVEVGALWGKR--ADFLCSEITENIPL----KLPEKVVEGSARAYFSAVGDILGTAMQNLGNLVQMPYGCGEQNMVLFTPIIYISEYLNKTNQLTPEMKSKTLSYMSTGYQKQLSYKHPDGSYSAFGQRYGEGNTWLTAFTMKSFARARAHIYIEEKLITGALLWLSIRQKPNGCFHSVGKLFNNAMKGGVD-----DEVTLAAYITIALLEYPLPVTHPTVRNALFCLESALGGKNGIYTKALMAYAFTLAGRMDIRRQ--LLQSLDEQAIKKDGTVHLHRPEF--SDDSGVDRFPYRRAPSAEVEMNSYMLLALLSKHNVSDEDLTLATQVVSWMIKQQNPNGGFSSTQDTVVALQALSLYG-SLTLSHDAMRTVSLSLDKTPVAEFHVEDSNRLLLQRIALKEVPGDYLA-TVSGSGCLYLQTTLRYNV-PIPKEDAPFTISVTTDPETCDRKSLKTFTIVANVSYVGKRLNSNMAVVEVKLPSGY---------IPIKPSVKKVRISFIASGAEAHANEVILFKDI---QSFRFSVEQEIPIGNLQPATV 1413          

HSP 2 Score: 100.908 bits (250), Expect = 1.749e-20
Identity = 105/410 (25.61%), Postives = 178/410 (43.41%), Query Frame = 1
Query:  358 LTKNITGNFIN--ETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLE-YQLNKDPIFGIWKAKAVFDGQEEIIQ-FEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLE-------SKIVFILASSFRYSKAKSQI--NVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDG-RPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQI----SEVSSNLKPPMAATTVYQ----SLTNFQSKDGHYLQFMPINDKFKC 1521
            LT ++ G+ ++    R+I +      +F +TDKPIYKPG KV+ R  +                    LD+N   +S+                + P   R++QW NV + + +  E +QL+ +P  GI+K     +    +   F +++YVLP++ V+V  P  +   D+ I   VC +Y+ GKP+  +I    C  +S     C   +  +    C +I          S++V       R S  + +I  + T+ E+GT   ++ AV    IK     + F     +Y+ GLP FG++ L   +  P     + I +    YG N+     YT+ + G  EF+I    + +S S+QI     E  S  +    + + YQ    S+  F S+   YL+  PI    +C
Sbjct:   97 LTLDVQGDALHFKSQRKILIKPLQNPVFIQTDKPIYKPGQKVQFRIAS--------------------LDENFHPVSE----------------KDPQGNRISQWLNVELKKGLTQESFQLSSEPTLGIYKLTVGREKSAPVTHSFSVEEYVLPKYEVQVKLPPVVGIMDKGIKVTVCGRYTYGKPVLGRIKVRVCRKFSDRYNLCKGEEDGV----CEEINHRAGPNGCFSEVVSTRMFQMRRSGYEDKIRASATIIEDGTGVELTAAVSSE-IKKTLAKVSFRHLDSHYRKGLPLFGQLFLEDASGNPMANETVVIFV---GYGTNF----TYTTGQDGTAEFLIDTSNVQKS-SLQIRARYKEGESCYQYRWVSVS-YQGDERSVKEFYSRAKSYLKIQPIYKILEC 456          
BLAST of Alpha-2-macroglobulin vs. Ensembl Mouse
Match: Mug1 (murinoglobulin 1 [Source:MGI Symbol;Acc:MGI:99837])

HSP 1 Score: 330.872 bits (847), Expect = 1.064e-91
Identity = 278/990 (28.08%), Postives = 469/990 (47.37%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAYFINTDNEVVADAL--EIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIG------------LLRKHK-CIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARI-VNVKCMQY--LARGMPDRSY-ATFSNE-----RTQMSKSRNSVLK---ISDAKMKKQIREYFPESWVFSYFNKTTKHL---NLTVPDSMTTWRADSYCMT-EKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINV-IGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKT--DKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXX------XXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQ------KSNSADIETTGYAILALINHQ------DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVF-AKTIGVSQNVNLKVSVVLNRNKTYNGLITLD--NRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKT---EIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACN 4827
            + IP+  +M P   ++ Y I  D EV+AD++  EI   L N   L     +F+   ++P S+  L V     ++ C +R  D+++L     S    S++        +K    SR+             L  KH   +P           +G E D  + +   G TA TN  I + + C  Y  +    P   +   F+ E     RT +SK      +    S+  + + IR+YFPE+WV+      +  L    +TVPD++T W+A + C++ + GL ++    L+   PF+  + +PYS+   E   L   V NY  T  +++V++    +   V +G    + C   N   T  + + PK +G +N ++ + ++ SS     +   +      D+V + ++VEP G+  E TFS L C  + ++       +P  +V  S R++ +  GD++     N   L+ MPYGCGEQNMV   P+IYVL YLN        +  KA  ++  GY R+L YKH DGS+SAFG    ++ G+TWLTAFVLKSF  A  ++ I+ S +  A  +L + Q+ +GCF   G LF++ M GG+      D   L+AY+ ++L    L  T   ++KA++         E   N +  Y  AL +Y  +L    +   + +   L ++++      +W   ++S   +      +++SA++E   Y +LA +  Q      DL++SM T+ WL+ Q+NS GG+ STQDTVVAL+AL+ + A T   SQ   L   V +    +++    ++  NRL+ Q   L      Y ++  +G GC   Q    YN+H L      F + V+T     ++ K  N   I +  +Y      SNM++  +   SG+     +     L+    ++R +     + +Y D  +     +   F F I++   + NLQPA+VK+ DYY  +   E +++ ++  C+
Sbjct:  518 LEIPVEFSMVPMAKMLIYTILPDGEVIADSVNFEIEKCLRNKVDL-----RFSTSQSLPASQTRLQVT-ASPQSLCGLRAVDQSVLLLKPESELSPSWIYNLPGMQQNKFVPSSRLSEDQEDCILYSSWLAEKHTNLVP-----------HGTEKDVYRYVEDMGLTAFTNLMIKLPIICFDYGMVPISAPRVEFDLAFTPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSNDTGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVPVGDDQDSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDTVVKVLIVEPEGIKQEHTFSSLFCASDAEISEKMSLVLPPTVVKDSARAHFSVMGDILSSAIRNTQNLLHMPYGCGEQNMVLFAPNIYVLKYLNETQQLTQKIKTKALGFLRAGYQRELNYKHKDGSYSAFGDQNGEREGNTWLTAFVLKSFAQARAFIFIDESHITHAFTWLSQKQKDNGCFRSSGSLFNNAMKGGVD-----DEMTLSAYITMALLESSLPATHPVVSKALSCLESSWKTIEQERNASFVYTKALMAYAFALAGNQNKRDE-ILKSLDEEAIKENNSIHWKRPQKSRKSEHHLYKPQASSAEVEMNAYVVLARLTAQPAPSPEDLTLSMSTIMWLTKQQNSNGGFSSTQDTVVALDALSKYGAVTFSRSQKTTL---VTIQSTGSFSQKFQVENSNRLLLQQVALPDIPGDY-TISVSGEGCVYAQTMLRYNMH-LEKQLSAFAIWVQTVPLTCNNPKGHNSFQISLEISYTGSRPASNMVIADVKMLSGF--IPLKPTVKKLERLEHVSRTEVSNNNVLIYLDQVT----NQTLAFSFIIQQDIPVRNLQPAIVKVYDYYETD---EMAFAEYSSPCS 1470          

HSP 2 Score: 102.449 bits (254), Expect = 4.436e-21
Identity = 101/425 (23.76%), Postives = 174/425 (40.94%), Query Frame = 1
Query:  103 YFITSPNLLITETSHHFNVH--TSTDIVLTIESIHDPSQIKHQSSKFVIKKG-FQTIPYYVPFVGSHLGSK-IRLNILGDVCQ-SGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFD-GQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
            Y +  P+ L TET     +H     + V    S+   S  K+   + V+ K  FQ + + +P + S      + ++I G   + S  K  L KN                K  ++F +TDKP+YKPG  V+ R +++    ++R  +E+                             L  IE P   R+ QW+++     +  + + L  +PI G +K     + G++E   F + ++VLPRF V++  P+ +   DE +S   C KY+ GKP+   +    C     G   C    S L    C+    E  I  + +    Y      +N TVTE GT    S++      +  +  I      +++ G+P+F ++ LV     P     + I  Q  +Y +        T+++ G+ EF I
Sbjct:   31 YMVLVPSQLYTETPEKICLHLYQLNETVTVTASLVSQSGRKNLFDELVLDKDLFQCVSFIIPRLSSSDEEDFLYVDIKGPTHEFSKRKAVLVKN----------------KESVVFVQTDKPVYKPGQSVKFRVVSM--DKMLRPLNEL---------------------------LPLAYIEDPKKNRIMQWRDIKTENGLKQMSFSLAAEPIQGPYKIVVHKESGEKEEHSFTVMEFVLPRFNVDLKVPNAMSVNDEVLSVTACGKYTYGKPVPGHVKINVCRETETG---CREVNSQLDNNGCS--TQEVNITELQSKKRNYEVQLFHVNATVTEEGTGLEFSRSGTTKIERITNKLIFLKADSHFRHGIPFFVKVRLVDIKGDPIPNEKVFIKAQELSYTS------ATTTDQHGLAEFSI 399          
BLAST of Alpha-2-macroglobulin vs. Ensembl Mouse
Match: Gm7298 (predicted gene 7298 [Source:MGI Symbol;Acc:MGI:3648717])

HSP 1 Score: 330.102 bits (845), Expect = 1.978e-91
Identity = 280/984 (28.46%), Postives = 471/984 (47.87%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAYFINTDNEVVADAL--EIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQ-------KLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVK-CMQY--LARGMPDRSY-ATFSNE-----RTQMSKSRNSVLK---ISDAKMKKQIREYFPESWVFSYF--NKT-TKHLNLTVPDSMTTWRADSYCMT-EKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSF--TLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKT--DKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXX------XXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYW--PFDKESSDEQ----KSNSADIETTGYAILALINHQ------DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVF-AKTIGVSQNVNLKVSVVLNRNKTYNGLITLD--NRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKT---EIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKAC 4824
            + IP+  +M P   ++ Y I  D EV+AD++  EI   L N   L      F+   ++P S+  L V     ++ C +R  D+++L     +    S++         K I  +H +  D    +L    C+ +K    +    +G E D  + +   G  A TN +I +   C  Y  +    P   +   FS+E      T +SK      +    S+    + IR+YFPE+WV+     N T    + +TVPD++T W+A + C++ + GL ++    L+V   F+  +  PYS+   E   L   V NY  T  +++V++  D+ +   + +  +  + C    +  T  + + PK +G +N ++ + ++ S      +   +      D+V + ++VEP G+  E TFS L+C  + ++       +P  +V  S R++ +  GDV+     N   L+ MPYGCGEQNMV   P+IYVL YLN  +     +  KA  ++  GY R+L YKH DGS+SAFG    ++ G+TWLTAFVLKSF  A  ++ I+ S +  +  +L + Q+ +GCF+  G LF++ M GG+      D   L+AY+ ++L    L  T   ++KA++         E   N +  Y  AL +Y  +L        + +   L ++++      +W  P     S+      +++SA++E   Y +LA +  Q      DL++SM T+ WL+ Q+NS GG+ STQDTVVAL+AL+ + A T   SQ   L   V +  + +++    ++  NRL+ Q   L      Y +M  +G GC   Q +  YNIH L      F L V+T     +  K  N   I +  +Y      SNM++  +   SG+     +     L+   P+ R +     + LY D  + +       F F I++   + NLQPA+VK+ DYY  +   E +++ ++  C
Sbjct:  518 LEIPVEFSMVPLAKMLIYTILPDGEVIADSVNFEIEKCLRNKVDLS-----FSSSQSLPASQTRLQVT-ASPQSLCGLRAVDQSVLLLKPEAELSPSWIYNLPGMQHNKFISSSH-LPEDQEDCILCG-SCVAEKHTNSVP---HGREKDVYRYVEDMGLMAFTNLKIKHPTFCFDYDMVPILAPRVEFDLAFSHENTGSLHTVLSKRPEETPRKDPPSNDPFTETIRKYFPETWVWDIVTVNSTGVAEVEMTVPDTITEWKAGALCLSNDTGLGLSSVAPLQVFQDFFVEVSFPYSVVRGEAFMLKATVMNYLPTSMQMSVQLQ-DSPDFTAVPVGDYQDSYCLSAKERYTSSWLVTPKSLGNVNFSVSAEAQQSPEPCGSEVATVPETGRKDTVVKFLIVEPEGIKIEHTFSSLLCASDAEISEKLSLVLPPTVVKDSARAHFSVMGDVLSPAIKNTQNLLHMPYGCGEQNMVLFAPNIYVLKYLNETHQLTQTIKTKALGFLRAGYQRELNYKHKDGSYSAFGDQNGEREGNTWLTAFVLKSFAQARAFIFIDESHITHSLTWLSQQQKDNGCFQSSGSLFNNAMKGGVD-----DEMTLSAYITMALLESSLPATHPVVSKALSCLELSWKTIEQERNASFVYTKALMAYAFALVGNQDKRDE-ILKSLDEEAIKENNSIHWKRPQKPRKSEHHLYKPQASSAEVEMNAYVVLARLTAQPAPSPEDLTLSMSTIMWLTEQQNSNGGFSSTQDTVVALDALSKYKAVTFSRSQKTTL---VTIQSSGSFSQKFQVENSNRLLLQQVALPDIPGDY-TMSVSGEGCVYAQTTLRYNIH-LEKQPSAFALRVQTVPLTCNDPKGHNSFQISLEISYTGSRPASNMVIADVKMLSGF--IPLKPTVKKLESLAPVRRTEVSSNNVLLYLDQVNSHTLA----FSFIIQQDFLVRNLQPAMVKVYDYYETD---EVAFAEYSNPC 1469          

HSP 2 Score: 98.9821 bits (245), Expect = 6.123e-20
Identity = 83/334 (24.85%), Postives = 146/334 (43.71%), Query Frame = 1
Query:  364 KNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWK-AKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKS-QINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
            K  T NF ++   + + +K  ++F +TDKP+YKPG  V+ R ++                    +DKN + +++          F L  IE P   R+ QWK++     +  + + L  +PI G +K       G +E   F + ++VLPRF V +  P+ I   DE +S   C+KY+ GKP+   +    C     G   C    S L    C+  ++    +  L    R+ + +   +N TVTE GT    S++      +  +  I      +++ G+P+F ++ LV     P     + I  Q        G+    T++++G+ +F I
Sbjct:  108 KGPTHNF-SKKEAVLVRNKESVVFVQTDKPVYKPGQSVKFRVVS--------------------MDKNLRPLNE---------LFPLAYIEDPKKNRIMQWKDIKTENGLKQISFSLAAEPIQGPYKIVLQKQSGVKEKHSFNVMEFVLPRFDVALKVPNAISVNDEVLSVTACAKYTYGKPVPGYVEISVCHETEAG---CKEVNSQLDNNGCSTQEVN---ITELQPKKRHHRVQLFHVNATVTEEGTGLEFSRSGTTKIERTTNKLIFLKADSHFRHGIPFFVKVLLVDIKGDPIPNEKVFIKAQ------ELGYTSATTTDQQGLAKFCI 399          
BLAST of Alpha-2-macroglobulin vs. Ensembl Mouse
Match: A2ml1 (alpha-2-macroglobulin like 1 [Source:MGI Symbol;Acc:MGI:3039594])

HSP 1 Score: 298.13 bits (762), Expect = 2.419e-81
Identity = 263/973 (27.03%), Postives = 452/973 (46.45%), Query Frame = 1
Query: 2041 IPLMKNMGPDVHVIAYFINTDNEVVAD--ALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEA--LLQFGQSSNADLSYLVQKLIK----LNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIY-GLEY---------DSRKVLSTAGFTAITN-----ARIVNVKCMQYLARGM--PDRSYATFSNERTQMSKSRNSVLKISDAK--MKKQIREYFPESWVF---SYFNKTTKHLNLTVPDSMTTWRADSYCMT-EKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQC--KNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSN------SADIETTGYAILALINH--QDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVS-------VVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKT-EIDSVKQCNIR-NIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSM 4809
            I +  ++ P   +  Y ++   E+VAD   L+I     N   +      F++   +P S   + +     ++ CA+R  D++  LL  GQ    +  Y     I       + + LD +    +   CIPQK +       Y GL Y         D   +LS  G    TN       + + +  Q L R    P+     +       S   +SV  IS AK  +K+ +R  FP +W++   S  +  T +++  VPD++T W A ++C+    G  I+P   L++  PF+  +  P+S+  +E   + V VFNY  TC EI+V++    N    I  +  T  +     ++KT  + + PK +GK+NVT+ ++SK S  C     K+ ++   D+V + +LVE  G+  E T S LIC K  +    ++  +PS +V GS+RS++T  GD++G    NL+ L+ MPYGCGEQN+  +   +Y+LDYL + +     L +KA+  + +GY   L++K+ DGS+  F ++++ GSTWL+A   K+     +Y+ I  +  K+   +L K Q+S+GCF    K   +   G  +  D+ D   LTAYV+     V L  +   +   + C  E  +N   N         +         ++++ + L   +       YW  D++   +   +      S + E T Y +LA+++   QDL  + K V WL+ + NS GG+ + QDT V L AL  + K  G +    + +S         +NRNK          RL+ Q   +   +  Y ++   G GC+ IQ +  YN+     A+  F LSVKT + +S  +   +  + V   Y    ++S  +LV +   SG+  +     +  L+ ++ + + D +   +  Y +    N   + +   F IE+   ++N+QPA V +  Y   E Y+  SY++
Sbjct:  515 ISINADLAPSADLFVYTLHPSGEIVADNVRLQIEKCFKNKVSI-----NFSRDKDLPGSNTSVHLQ-AAPDSFCALRAVDKSALLLNHGQEMTPESVYFTLPYIHQYGYFYNGLNLDDQ----QAEPCIPQKDL------FYNGLYYTPTGNIWDGDLSNLLSNMGLKIFTNLHYRKPEVCSSQENQPLLRTFDHPNERIMMYGGGAPPSSAFHDSVDSISHAKVAIKETVRTNFPRTWIWNLVSVDSSGTANVSFLVPDTITQWEASAFCVNGNAGFGISPKVSLQISQPFFVEVTSPFSVVRSEQSDMVVTVFNYLTTCVEISVQLEASENYEASINTQRNTDSEVLQAGEQKTYVWTIIPKTLGKVNVTVVATSKQSRACPNDASKEQDVHWKDTVVKTMLVEAEGIEKEATQSFLICPKGTKASKQTLLELPSNVVEGSVRSFVTIVGDILGVAMQNLESLLQMPYGCGEQNIAQLASDVYILDYLKATDQLTEELKSKAQRLLSNGYQNHLSFKNYDGSYDVFCQSNQEGSTWLSALSFKTVEKMKEYIFIEETVPKQTLIWLVKKQKSNGCFRRDEKHVDTAQEG--REGDQED-IALTAYVVGVFLEVGLNASFPALRNGLYCLEEAFSNGVTNGYTQAILAYVFALAGKEQQAKSLLSILDKSATKTNNMIYWERDEKPETDNSPSFIPSALSGETEKTCYVLLAVLSQDTQDLDYASKIVQWLAQRMNSHGGFSAMQDTTVCLLALTQYMKLTGSNPQNTITLSSEESEEVFYVNRNK----------RLLVQHSKVSKGHQQY-TVDVEGDGCSFIQATLRYNVPLPKEASG-FSLSVKTGKSNSSDEFQTKFELTVTLTYTGARESSVTVLVDVKMLSGF--TPVVSSTEELKFNSQVTKTDIKNGHVLFYLE----NVPKEATSLTFSIEQTNHVANIQPAPVTVYSYEKGE-YAFDSYNI 1449          

HSP 2 Score: 87.0409 bits (214), Expect = 2.240e-16
Identity = 77/334 (23.05%), Postives = 137/334 (41.02%), Query Frame = 1
Query:  385 INETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNV-SINEAMNLEYQLNKDPIFG----IWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKA----KSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGR-PYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
            I+E R + +  +    F +TD P++KPGD V  R + +   N+  +P +                          + + LI ++ P +  + QW NV +      L +QL  +PI G    + K ++   G   +  F + + VLP+F VE+  P  I   D       C+KY+ G+P+  K     C    +    C + ++++ +Q   ++K       I    F+  ++       +N  VTE+GT   +SK      I      + F+   P+Y+ G+ YFG +     N  P     + + +     G       NYT+++ G   F I
Sbjct:  106 ISERRSVAIAAEENATFVQTDTPVHKPGDTVHFRVVTL---NIWLKPVD--------------------------DLYPLITVQDPQSNVIFQWINVTTFRNITQLSFQLTPEPILGDYTIVIKTQS---GTTVMDHFTVNRDVLPKFEVELTAPETITIADSQFQMVTCAKYTYGQPVQGKAQIKVCREL-FSPAHCESNENEICEQFTVQLKDGCASHIINTKVFQLDRSGLFMTLNVNEVVTESGTGVQMSKT-HSVFITSVLGTVSFENMDPFYRRGITYFGTLKFSGPNNTPLVDKLLQLELDGKPVG-------NYTTDENGEARFSI 398          
BLAST of Alpha-2-macroglobulin vs. Ensembl Mouse
Match: Cd109 (CD109 antigen [Source:MGI Symbol;Acc:MGI:2445221])

HSP 1 Score: 281.952 bits (720), Expect = 2.554e-76
Identity = 260/957 (27.17%), Postives = 448/957 (46.81%), Query Frame = 1
Query: 2029 RIISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKK--QIREYFPESWVF--SYF-NKTTKHLNLTVPDSMTTWRADSYCMTEK---GLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKIN--------VDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELI--CNKNEQLGILSV-FAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNN-TPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKES-SDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVV---LNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNI--------HRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSY 4803
            R  S+    +  P   +IAY+I  D E++ D L+I   L   +++   K  ++K T  P  KV L +     ++   I   D+++     S++  +  +V +L   N +  L                          G+  +S  V    G   +T+A ++         R   D  Y T         ++  +++   DA       +R+ FPE+W++  +Y  +K  +   +TVPDS+T+W A ++ ++E    GL   P + L+   PF+  + +PYS+   E   L V + NY     ++ + I         + +N+ N    +  T+   +++  T+ F +KP  +G++ +T+ ++S                  SD+V + I+V+P G+    + S L+   + N +    S+ F+ P + V GS R  +T  GD++G + + L  L+ MPYGCGEQNM+   P+IY+LDYL         L  KA SY+  GY R+L Y+ +DGSFSAFG  D  GSTWL+AFVL+ F +A  Y++I+   L     +L   ++ +G F E G++  S + GG K         LTAY++ S+ G       I++  +I       +   + NY   L     +L T  S  ++     L+ +S   G  ++W     + S   +  S DIE   YA+LA   H  +S  +  + WL  QRNSLGG+ STQDTVVAL AL+ F+  +   +N +++++V    + R+  +   I   N  +     L   +   V++  +GSG A  QL+  YN+         R     + F L V   +++    +  N+ VC ++L  ++ + M+L+ +N  SG+        S S+ +S  L ++++   ++ LY D  S N++    C         K+SN++   V ++DYY P   + +SY
Sbjct:  517 RTFSLTPEASWAPKACIIAYYIAEDGEIINDILKIPVQLVFENKV---KLFWSKPTVKPSDKVSLRISATQSDSLVGIVAVDKSVTLMENSNSITMETMVHELELYNTEYYL--------------------------GMFMNSFAVFQECGLWVLTDATLI---------RDSIDEVYDTEEYSERFAEENEANLVDFEDASSVNNVHVRKNFPETWIWLDAYMGSKIYEEFEVTVPDSITSWVASAFVISEDLGFGLTTVPAE-LQAFQPFFLFLNLPYSVIRGEEFALEVSIVNYLKDTIKVVILIEESDSFDILMTSNDTNGTIYRK-TVQVPRDNGVTLVFPIKPTHLGEIPITVTAASP---------------TASDAVTQTIVVKPEGIEKSYSKSVLLDLTDSNVESKQQSMRFSFPPDTVIGSERVQITAIGDILGSSINGLSSLIRMPYGCGEQNMIYFAPNIYILDYLTKQKQLTVNLKEKALSYMRQGYQRELLYQREDGSFSAFGDIDSSGSTWLSAFVLRCFLEADYYIDIDQDVLHRTYTWLNAHKKFNGEFWEPGRVIHSELQGGTK-----SPVTLTAYIVTSVLGYKKYQPNIDVQDSIKFLEFEFSRGISDNY--TLAIISYALSTVGSPKAEEALNLLMQRSEKEGDTQFWLSSGPALSGSWQPRSVDIEIAAYALLAHTLHH-VSEGIPVMRWLIQQRNSLGGFVSTQDTVVALKALSEFSALVH-KENTDIQLTVTGPGIPRSIHFR--IDSQNLFLLHQEELHALDPITVNVSAHGSGFAICQLNVDYNVKGSGSSKRRRSTENQEVFDLDVI--VNNEDDISHLNLNVCTSHLGSER-TGMVLMEVNLLSGF-----SASSDSIPLSETLKKVEYDNGKLNLYLD--SVNES--QFCVNIPTVRDYKVSNIRDGSVSVMDYYEPRRQAVRSY 1395          

HSP 2 Score: 67.3958 bits (163), Expect = 2.210e-10
Identity = 102/443 (23.02%), Postives = 181/443 (40.86%), Query Frame = 1
Query:  382 FINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSIN-EAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCV------------AFKSDLMKQNCNKIKLESKIVFILASSFRYSK------AKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIK-FDGRPYYKPGLPYFGRINLVRHNK---KPAKMVNISISIQSWAYGNN--------WGFIR--NYTSNKKGVIEFVIPYIPLAQSLSIQISEVSSNLKPPMAATTVYQSLTNFQSKDGHYLQFMPINDKFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIV 1611
            F N TR +    K+  +  +TDK  YKP  +V+ R + +  ++L                       KP +   D      I I+ P +  + QW +   +   ++  +QL+ +PIFG W  +   + Q+    F++ +YVLP+F V V  P     K + ++  V +KY+ GKP+   +S  F  L  +GKKK +            +F +  MK+  N   L         S   Y          ++I  TVTE+ T  S   A      K + + I+ FD     KP L +   + + R +     P ++ N  +++ +    N+          +I+  NYT  + G+I+   P + ++  L ++   +        ++ TV+   + F S    Y+Q    ++  K     +L +  N      S  V   S+GQ+V
Sbjct:  115 FSNRTR-LTFESKSISVLIQTDKAFYKPKQEVKFRVLTLC-SDL-----------------------KPYRTSVD------IFIKDPKSNVIQQWFSQKGDLGVVSKTFQLSSNPIFGDWSIQVQVNDQQYYQSFQVLEYVLPKFEVTVQTPLYCSLKSKQLNGSVIAKYTYGKPVKGSLSLTFLPLSFWGKKKNITKSFEINGFANFSFDNYEMKKVMNLKPLTD------VSEGSYENVDPSFPGPAEIIATVTESLTGIS-RMASTNVFFKQHDYIIEIFDYTTVLKPSLNFTATVKVSRSDGNQLTPEEIENDLVTVVTQRKNNHPESQRDQEMDYIQTVNYTIPQNGIIKIEFPVMSISGELQLKAYFLDGT-----SSVTVH---SMFTSPSKTYIQLKTRDEYIKVGSPFDLMVSGNRQFKDLSYMV--ISKGQLV 509          
BLAST of Alpha-2-macroglobulin vs. Ensembl Mouse
Match: Pzp (PZP, alpha-2-macroglobulin like [Source:MGI Symbol;Acc:MGI:87854])

HSP 1 Score: 263.462 bits (672), Expect = 1.821e-70
Identity = 183/621 (29.47%), Postives = 307/621 (49.44%), Query Frame = 1
Query: 2032 IISIPLM--KNMGPDVHVIAYFINTDNEVVADA--LEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSR---IGLLRKHK-CIPQKRVKR---MIQPIYGL-EYDSRKVLSTAGFTAITNARIVNVK-CMQY---------------LARGMPDRSYATFSNERTQM--SKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTK---HLNLTVPDSMTTWRADSYCMT-EKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINV-IGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGK---TDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL 3777
            + S+P+     M P+  ++ Y I  + E+VADA   EI     N   L      F    ++P S   L V      + CA+   D+++L       A LS   Q +  L    T+      + + + H+ CI  + +     +  P + L + D+  +  + G    TN++I   + C ++               +A   P  S+         +  S   N V+++     ++ +R+YFPE+W++            L + VPD++T W+A ++C++   GL ++ T  L+   PF+  + +PYS+   E   L   V NY   C +I V + +  + + V +G    + C C N+ KTV + + PK +G++N T  + +  S      K  ++  +   D+V + ++VEP G+  E T++ L+C ++ +L       +P  +V GS R+  +  GD++G    NL  L+ MPYGCGEQNMV  VP+IYVL+YLN       A+ +KA +Y+I GY RQL Y+H DGS+S FG     +  G+TWLTAFVLK+F  A  ++ I  + +  A  +L   Q+ +GCF++ G L ++ M GG+      D   L+AY+ I+L
Sbjct:  522 VFSLPIQVEPGMAPEAQLLIYAILPNEELVADAQNFEIEKCFANKVNL-----SFPSAQSLPASDTHLKVK-AAPLSLCALTAVDQSVLLL--KPEAKLS--PQSIYNLLPGKTVQGAFFGVPVYKDHENCISGEDITHNGIVYTPKHSLGDNDAHSIFQSVGINIFTNSKIHKPRFCQEFQHYPAMGGVAPQALAVAASGPGSSFRAMGVPMMGLDYSDEINQVVEV-----RETVRKYFPETWIWDLVPLDVSGDGELAVKVPDTITEWKASAFCLSGTTGLGLSSTISLQAFQPFFLELTLPYSVVRGEAFTLKATVLNYMSHCIQIRVDLEISPDFLAVPVGGHENSHCICGNERKTVSWAVTPKSLGEVNFTATAEALQSPELCGNKLTEVPALVHKDTVVKSVIVEPEGIEKEQTYNTLLCPQDTELQDNWSLELPPNVVEGSARATHSVLGDILGSAMQNLQNLLQMPYGCGEQNMVLFVPNIYVLNYLNETQQLTEAIKSKAINYLISGYQRQLNYQHSDGSYSTFGNHGGGNTPGNTWLTAFVLKAFAQAQSHIFIEKTHITNAFNWLSMKQKENGCFQQSGYLLNNAMKGGVD-----DEVTLSAYITIAL 1122          

HSP 2 Score: 108.997 bits (271), Expect = 5.307e-23
Identity = 86/283 (30.39%), Postives = 139/283 (49.12%), Query Frame = 1
Query: 4009 EQKSNSADIETTGYAILALINHQ-----------DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVF-AKTIGVSQNVNLKVSVVLNRNKTYNGLITLD--NRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKT---EIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            + ++ SA++E T Y +LA +  +           DLS + K V W+S Q+NS GG+ STQDTVVAL AL+ + A T   SQ    +V V +  + T++    ++  NRL+ Q   L     +YV+ K +GSGC  +Q S  YNI  +      F L V T     D         I++  +Y     +SNM++V +   SG+   +   K L  Q +  + R +     + +Y +  +    G    F F +E+   + NL+PA +K+ DYY  + ++ + YS
Sbjct: 1211 QPRAPSAEVEMTAYVLLAYLTSESSRPTRDLSSSDLSTASKIVKWISKQQNSHGGFSSTQDTVVALQALSKYGAATFTRSQK---EVLVTIESSGTFSKTFHVNSGNRLLLQEVRLPDLPGNYVT-KGSGSGCVYLQTSLKYNILPVADGKAPFALQVNTLPLNFDKAGDHRTFQIRINVSYTGERPSSNMVIVDVKMVSGFIPMKPSVKKLQDQPN--IQRTEVNTNHVLIYIEKLTNQTLG----FSFAVEQDIPVKNLKPAPIKVYDYYETDEFTVEEYS 1483          

HSP 3 Score: 92.0485 bits (227), Expect = 6.270e-18
Identity = 81/328 (24.70%), Postives = 142/328 (43.29%), Query Frame = 1
Query:  430 IFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMN-LEYQLNKDPIFGIWKAKAVFDGQEEIIQ-FEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKK---------CVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGT--------SSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
            +F +TDKPIYKPG  V+ R ++                V+I     N+              F ++ IETP   R+ QW+N+ +   ++ L + L+ +P  GI+K     D  ++I   FE+K+YVLP+F V +     +   +E +    C  Y+ GKP+   ++   C  YS  +           C  F      + C +  +++K VF L    +    K ++   + E GT        S  ++ A+    +K+   N        Y+PGLP+ G++ LV    KP    NI+  +      +  G++  +T+++ G+    I
Sbjct:  127 VFVQTDKPIYKPGQIVKFRVVS----------------VDISFRPLNE-------------TFPVVYIETPKRNRIFQWQNIHLAGGLHQLSFPLSVEPALGIYKVVVQKDSGKKIEHSFEVKEYVLPKFEVIIKMQKTMAFLEEELPITACGVYTYGKPVPGLVTLRVCRKYSRYRSTCHNQNSMSICEEFSQQADDKGCFRQVVKTK-VFQLRQ--KGHDMKIEVEAKIKEEGTGIELTGIGSCEIANALS--KLKFTKVNTN------YRPGLPFSGQVLLVDEKGKPIPNKNITSVV------SPLGYLSIFTTDEHGLANISI 408          
BLAST of Alpha-2-macroglobulin vs. UniProt/SwissProt
Match: sp|Q63041|A1M_RAT (Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 1.272e-98
Identity = 290/993 (29.20%), Postives = 472/993 (47.53%), Query Frame = 1
Query: 2032 IISIPLM--KNMGPDVHVIAYFINTDNEVVADA--LEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALL----QFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKR---MIQPIYGL-EYDSRKVLSTAGFTAITNARIVNVK-CMQYLA---------------RGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFN---KTTKHLNLTVPDSMTTWRADSYCMT-EKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINV-IGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGK---TDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXX---XXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQN-VFAQLLDQSVSFGRYKYWPFDK---ESSDEQKS-------NSADIETTGYAILAL-----------INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVF-AKTIGVSQNVNLKVSVVLNRNKTYNGLITLD--NRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKT---EIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            ++S P+     M P   +I Y I  + E++AD    +I     N   L      F    ++P S   LTV      + CA+   D+++L    +   S  +  + L QK  +  +   L  + G      CI  + +     +  P   L + D+  V  + G    TN R+   + C  Y A                 +P   Y + SN RT       +     + ++++ +R+YFPE+W++            L + VPD++T W+A ++C++   GL ++ T   KV  PF+  + +PYS+   E   L   V NY   C  I+V + +  + + V +G    + C C N+ KTV + + PK +G++N T  + +  S      K  ++  +   D+V + ++VEP G+  E T++ L+C ++ +L       +P+ +V GS R+  +  GD++G    NL  L+ MPYGCGEQNMV  VP+IYVL+YLN       A+ +KA SY+I GY RQL Y+H DGS+S FG        G+TWLTAFVLK+F  A  Y+ I  + +  A  +L   QR +GCF++ G L ++ M GG+      D   L+AY+ I+L  + L  T   +  A   +  A  +I+N+  ++         +     +   ++ V   L   +V+     +W   K   E+  E +S        SA++E T Y +LA            ++  DL+ + K V W+S Q+NS GG+ STQDTVVAL AL+ + A T   S   N +VSV +  + T +G + ++  NRL+ Q   L     +Y++ K +GSGC  +Q S  YNI         F L V T     D  +      I +  +Y+    NSNM++V +   SG+   +   K L  Q  + + R +     + +Y +  +    G    F F +E+   + NL+PA VK+ DYY  + ++ + YS
Sbjct:  522 VVSFPIRVEPGMAPVAKLIVYTILPNEELIADVQKFDIEKCFANTVNLS-----FPSAQSLPASDTHLTVK-ATPLSLCALTAVDQSVLLLKPEAKLSPQSIYNLLPQKAEQGAYLGPLPYKGG----ENCIKAEDITHNGIVYTPKQDLNDNDAYSVFQSIGLKIFTNTRVHKPRYCPMYQAYPPLPYVGEPQALAMSAIPGAGYRS-SNIRTSSMMMMGASEVAQEVEVRETVRKYFPETWIWDMVPLDLSGDGELPVKVPDTITEWKASAFCLSGTTGLGLSSTISHKVFQPFFLELTLPYSVVRGEAFILKATVLNYMPHCIRIHVSLEMSPDFLAVPVGSHEDSHCICGNERKTVSWAVTPKSLGEVNFTATAEALQSPELCGNKVAEVPALVQKDTVVKPVIVEPEGIEKEQTYNTLLCPQDAELQENWTLDLPANVVEGSARATQSVLGDILGSAMQNLQNLLQMPYGCGEQNMVLFVPNIYVLEYLNETQQLTEAIKSKAISYLISGYQRQLNYQHSDGSYSTFGDRGMRHSQGNTWLTAFVLKAFAQAQSYIYIEKTHITNAFNWLSMKQRENGCFQQSGSLLNNAMKGGVD-----DEVTLSAYITIALLEMPLPVTHSVVRNALFCLETAWASISNSQESHVYTKALLAYAFALAGNRAKRSEVLESLNKDAVNEEESVHWQRPKNVEENVREMRSFSYKPRAPSAEVEMTAYVLLAYLTSASSRPTRDLSSSDLTTASKIVKWISKQQNSHGGFSSTQDTVVALQALSKYGAATFTKS---NKEVSVTIESSGTVSGTLHVNNGNRLLLQEVRLADLPGNYIT-KVSGSGCVYLQTSLKYNILPEAEGEAPFTLKVNTLPLNFDKAEHHRKFQIHINVSYIGERPNSNMVIVDVKMVSGFIPVKPSVKKLQDQ--SNIQRTEVNTNHVLIYIEKLTNQTMG----FSFAVEQDIPVKNLKPAPVKVYDYYETDEFAIEEYS 1488          

HSP 2 Score: 103.605 bits (257), Expect = 1.474e-20
Identity = 81/321 (25.23%), Postives = 144/321 (44.86%), Query Frame = 1
Query:  364 KNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMN-LEYQLNKDPIFGIWKAKAVFDGQEEIIQ-FEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYS---------YGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPG---IKYNSFNIKF-DGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQS 1281
            K  T +FI + + + +      +F +TDKPIYKPG  V+ R ++                V+I     N+              F ++ IE P   R+ QW+NV +   ++ L + L+ +P  GI+K     D  ++I   FE+K+YVLP+F V+V  P  +   +E +    C  Y+ GKP+   ++   C  Y+         + K  C  F     ++ C +  +++K+       +     K ++   + E+GT   ++    G G   I      +KF     +Y+PGLP+FG++ LV    +P    N+++ + S
Sbjct:  106 KGPTHHFIKK-KSMWITKAESPVFVQTDKPIYKPGQTVKFRVVS----------------VDISFRPVNE-------------TFPVVYIENPKRNRIFQWQNVDLPGGLHQLSFPLSVEPALGIYKVVVQKDSGKKIEHSFEVKEYVLPKFEVQVKMPKTMAFLEEELVVTACGLYTYGKPVPGLVTMKVCRKYTQSYSNCHGQHSKSICEEFSKQADEKGCFRQVVKTKVFQPRQKGY---DMKIEVEAKIKEDGTGIELT----GTGSCEIANTLSKLKFTKANTFYRPGLPFFGQVLLVDEKGQPIPNKNLTVQVNS 389          
BLAST of Alpha-2-macroglobulin vs. UniProt/SwissProt
Match: sp|A8K2U0|A2ML1_HUMAN (Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3)

HSP 1 Score: 339.732 bits (870), Expect = 1.005e-93
Identity = 280/984 (28.46%), Postives = 458/984 (46.54%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVD--PGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLL------------RKHKC-------IPQKRVKRMIQ-----------PIYGLEYDSRKVLSTAGFTAITNARIVN-VKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSF-----TLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPF----DKESSDEQKSNSADIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGV-SQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAAN-DTFKLSV---KTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPL-NRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            +S+     + PD  ++ Y I     VVAD ++ +  +   +Q+  G   F+    +P ++V L +   PG   + CA+R  DE++L                L++ + +++  S  G+                +C        PQ  +  M Q           P +    D        G   ++NA+I   V C    +   P+  Y+T         ++  S   +  A+   Q+R+YFPE+W++  F   N   + +++TVPD++T W+A S+C ++ +G  ++PT  L    PF+ ++ +PYS+   E  +L   +FNY   C    +++  D  + +   L+S+     + C C +D KT ++N+    +G +N TI +    S+     +K  +     SD++ + +LV+P GV  E T S L+C K +         +P +IV  S ++Y+T  GD+MG    NLD LV MP GCGEQNMV   P IYVL YL    +    + ++A  ++  GY ++L YKH +GS+SAFG+ D  G+TWLTAFV K F  A K++ I+   +++A K++   Q   GC+   G L  + M GG+      D   LTAYV  +L   G D+      +        +N   +T N         +        +   +  QL  Q++  G   YW         +S   +  + D+E T YA+LA      +  ++++ +   V WL+ Q N+ GG+ STQDTVVAL ALA +A T  + S+ +NL V    N  +T+N  I   NRLV Q   L      Y +++ +G GC  +Q    YNI  L   N  TF LSV   K   +         + +  +Y+    +SNM +V +   SG+   E   + L  Q   PL  +++F    + +Y D    N       + F I +   ++NL+PA +K+ DYY P+  +   YS
Sbjct:  520 LSLTFTSRLAPDPSLVIYAIFPSGGVVADKIQFSVEMCFDNQVSLG---FSPSQQLPGAEVELQLQAAPG---SLCALRAVDESVL----------------LLRPDRELSNRSVYGMFPFWYGHYPYQVAEYDQCPVSGPWDFPQPLIDPMPQGHSSQRSIIWRPSFSEGTDLFSFFRDVGLKILSNAKIKKPVDC----SHRSPE--YSTAMGAGGGHPEAFESSTPLHQAE-DSQVRQYFPETWLWDLFPIGNSGKEAVHVTVPDAITEWKAMSFCTSQSRGFGLSPTVGLTAFKPFFVDLTLPYSVVRGESFRLTATIFNYLKDC----IRVQTDLAKSHEYQLESWADSQTSSCLCADDAKTHHWNITAVKLGHINFTISTKILDSNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTHSSLLCPKGKVASESVSLELPVDIVPDSTKAYVTVLGDIMGTALQNLDGLVQMPSGCGEQNMVLFAPIIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHSNGSYSAFGERDGNGNTWLTAFVTKCFGQAQKFIFIDPKNIQDALKWMAGNQLPSGCYANVGNLLHTAMKGGVD-----DEVSLTAYVTAALLEMGKDV---DDPMVSQGLRCLKNSATSTTNLYTQALLAYIFSLAGEMDIRNILLKQLDQQAIISGESIYWSQKPTPSSNASPWSEPAAVDVELTAYALLAQLTKPSLTQKEIAKATSIVAWLAKQHNAYGGFSSTQDTVVALQALAKYATTAYMPSEEINLVVKSTENFQRTFN--IQSVNRLVFQQDTLPNVPGMY-TLEASGQGCVYVQTVLRYNI--LPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQ---PLVKKVEFGTDTLNIYLDELIKN----TQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYS 1450          

HSP 2 Score: 90.5077 bits (223), Expect = 1.565e-16
Identity = 81/322 (25.16%), Postives = 139/322 (43.17%), Query Frame = 1
Query:  433 FAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCM---LYSYGK-------KKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINV--TVTENGTSSSVSKAVEGPGIKYNSFNIKF-DGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
            F +TDKP+Y PG +V  R                     + +D N  F+     ND     + ++ ++ P++ R+AQW  V   + + +L +QL  + + G +   AV +G+     F +++YVLP+F VEV+ P E+    ES   K+C +Y+ GKPM   +    C     Y Y +        KC        K  C    ++     ++  ++ +     QIN+  TV E GT    + A +   I     ++ F D   +Y P  P+ G+I +  H+    K   + + I    YG N  F +   ++  G+  F +
Sbjct:  123 FVQTDKPLYTPGQQVYFRI--------------------VTMDSN--FVPV---NDK----YSMVELQDPNSNRIAQWLEVVPEQGIVDLSFQLAPEAMLGTYTV-AVAEGKT-FGTFSVEEYVLPKFKVEVVEPKELSTVQESFLVKICCRYTYGKPMLGAVQVSVCQKANTYWYREVEREQLPDKCRNLSGQTDKTGCFSAPVDMATFDLIGYAYSH-----QINIVATVVEEGTGVE-ANATQNIYISPQMGSMTFEDTSNFYHPNFPFSGKIRVRGHDDSFLKNHLVFLVI----YGTNGTFNQTLVTDNNGLAPFTL 403          
BLAST of Alpha-2-macroglobulin vs. UniProt/SwissProt
Match: sp|P01023|A2MG_HUMAN (Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3)

HSP 1 Score: 334.724 bits (857), Expect = 4.349e-92
Identity = 276/984 (28.05%), Postives = 455/984 (46.24%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAYFINTDNEVVADAL--EIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYL-VQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEY---------DSRKVLSTAGFTAITNARIVNVK----CMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINV-IGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKT--DKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXX-----XXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSD------EQKSNSADIETTGYAILALINHQ------DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNAL-----AVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLD--NRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAAND-TFKLSVKT---EIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNK 4830
            ISIP+  ++ P   ++ Y +    +V+ D+   ++ + L N   L      F+   ++P S   L V     ++ CA+R  D+++L      +A+LS   V  L+           +       CI +  V      I G+ Y         D    L   G  A TN++I   K      QY   G P+     F  E   M +    ++ + +   +  +R+YFPE+W++      +     + +TVPD++T W+A ++C++E  GL I+ T  L+   PF+  + +PYS+   E   L   V NY   C  ++V++      + V +  +    C C N  +TV + + PK +G +N T+ + +  S      +   +      D+V + +LVEP G+  ETTF+ L+C    ++       +P  +V  S R+ ++  GD++G    N   L+ MPYGCGEQNMV   P+IYVLDYLN      P + +KA  Y+  GY RQL YKH DGS+S FG+      G+TWLTAFVLK+F  A  Y+ I+ + + +A  +L + Q+ +GCF   G L ++ + GG++     D   L+AY+ I+L  + LT T   +  A         T    ++  +               +    + V   L +++V      +W   ++         E ++ SA++E T Y +LA +  Q      DL+ +   V W++ Q+N+ GG+ STQDTVVAL+AL     A F +T   +Q       V +  + T++    +D  NRL+ Q  +L      Y SMK  G GC  +Q S  YNI  L    +  F L V+T     D  K      I +  +Y      SNM +V +   SG+     +     L+ S  ++R +     + +Y D  S     +     F + +   + +L+PA+VK+ DYY  +   E + + +N  C+K
Sbjct:  526 ISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDVENCLANKVDL-----SFSPSQSLPASHAHLRVT-AAPQSVCALRAVDQSVLLM--KPDAELSASSVYNLLPEKDLTGFPGPLNDQDNEDCINRHNVY-----INGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHG-PEGLRVGFY-ESDVMGRGHARLVHVEEPHTET-VRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVEKEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVIKPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVE-----DEVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGDHGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQ-------VTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEY-SMKVTGEGCVYLQTSLKYNI--LPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAIVDVKMVSGF--IPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVS----NQTLSLFFTVLQDVPVRDLKPAIVKVYDYYETD---EFAIAEYNAPCSK 1469          

HSP 2 Score: 90.5077 bits (223), Expect = 1.495e-16
Identity = 80/330 (24.24%), Postives = 154/330 (46.67%), Query Frame = 1
Query:  415 DKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKA--KAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYS-----YGKKK---CVAFKSDLMKQNCNKIKLESKIVFILASSFR---YSKAKSQINVTVTE--NGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
            +++ ++F +TDK IYKPG  V+ R ++                    +D+N   +++            L+ I+ P   R+AQW++  +   +    + L+ +P  G +K   +    G+ E   F ++++VLP+F V+V  P  I   +E ++  VC  Y+ GKP+   ++   C  YS     +G+     C  F   L    C   ++++K+  +    +    +++A+ Q   TV E     SS +++      I   SF +K D   +++ G+P+FG++ LV  + K   + N  I I+    GN   +  N T+++ G+++F I
Sbjct:  124 NEDSLVFVQTDKSIYKPGQTVKFRVVS--------------------MDENFHPLNE---------LIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEH-PFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRT-----ITKLSF-VKVDS--HFRQGIPFFGQVRLV--DGKGVPIPNKVIFIR----GNEANYYSNATTDEHGLVQFSI 409          
BLAST of Alpha-2-macroglobulin vs. UniProt/SwissProt
Match: sp|Q5R4N8|A2MG_PONAB (Alpha-2-macroglobulin OS=Pongo abelii OX=9601 GN=A2M PE=2 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 4.628e-92
Identity = 277/986 (28.09%), Postives = 456/986 (46.25%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAYFINTDNEVVADAL--EIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKH---KCIPQKRVKRMIQPIYGLEY---------DSRKVLSTAGFTAITNARIVNVKC----MQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINV-IGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKT--DKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXX-----XXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSD------EQKSNSADIETTGYAILALINHQ------DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNAL-----AVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLD--NRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAAND-TFKLSVKT---EIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNK 4830
            ISIP+  ++ P   ++ Y +    +V+ D+   ++ + L N   L      F+   ++P     L V     ++ CA+R  D+++L      +A+LS     +  L  +  L    G L       CI +  V      I G+ Y         D    L   G  A TN++I   K      QY   G        + ++      +R   L  ++    + +R+YFPE+W++      +     + +TVPD++T W+A ++C++E  GL I+ T  L+   PF+  + +PYS+   EV  L   V NY   C  ++V++      + V +  +    C C N  +TV + + PK +G +N T+ + +  S      +   +      D+V + +LVEP G+  ETTF+ L+C    ++       +P  +V  S R+ ++  GD++G    N   L+ MPYGCGEQNMV   P+IYVLDYLN      P + +KA  Y+  GY RQL YKH DGS+S FG+      G+TWLTAFVLK+F  A  Y+ I+ + + +A  +L + Q+ +GCF   G L ++ + GG++     D   L+AY+ I+L  + LT T   +  A         T    ++  +               +    + V   L +++V      +W   ++         E ++ SA++E T YA+LA +  Q      DL+ +   V W++ Q+N+ GG+ STQDTVVAL+AL     A F +T   +Q       V +  + T++    +D  NRL+ Q  +L      Y SMK  G GC  +Q S  YNI  L    +  F L V+T     D  K      I +  +Y      SNM +V +   SG+     +     L+ S  ++R +     + +Y D  S     +     F + +   + +L+PA+VK+ DYY  +   E + + +N  C+K
Sbjct:  526 ISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDVENCLANKVDL-----SFSPSQSLPALHAHLRVT-AAPQSLCALRAVDQSVLLM--KPDAELS--ASSVYNLLPEKDLTGFPGPLNDQGDEDCINRHNVY-----INGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKLCPQLQQYEMHGPEGLRVGFYESDVMGRGHAR---LVHAEEPPTETVRKYFPETWIWDLVVVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVEKEQAPHCICANGRQTVSWAITPKSLGNVNFTVSAEALESQELCGTEVASVPEYGKKDTVIKPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVE-----DEVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGDHGSHVYTKALLAYAFALAGNQDKRKEVLQSLHEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYALLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQ-------VTIQSSGTFSNKFQVDNNNRLLLQQVSLPELPGEY-SMKVTGEGCVYLQTSLKYNI--LPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAIVDVKMVSGF--IPLKPTVKMLERSNHVSRTEVSNNHVLIYLDKVS----NQTLSLFFTVLQDVPVRDLKPAIVKVYDYYETD---EFAIAEYNAPCSK 1469          

HSP 2 Score: 89.3521 bits (220), Expect = 2.961e-16
Identity = 79/329 (24.01%), Postives = 151/329 (45.90%), Query Frame = 1
Query:  415 DKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVF-DGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYS-----YGKKK---CVAFKSDLMKQNCNKIKLESKIVFILASSFR---YSKAKSQINVTVTE--NGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
            +++ ++F +TDK IYKP   V+ R ++                    +D+N   +++            L+ I+ P   R+AQW++  +   +    + L+ +P  G +K       G+     F ++++VLP+F V+V  P  I   +E ++  VC  Y+ GKP+   ++   C  YS     +G+     C  F   L    C   ++++K+  +    +    ++KA+ Q   TV E     SS +++      I   SF +K D   +++ G+P+FG++ LV  + K   + N  I I+    GN   +  N T+++ G+++F I
Sbjct:  124 NEDSLVFVQTDKSIYKPAQTVKFRVVS--------------------MDENFHPLNE---------LIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGRRTEHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASNCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKEYEMKLHTKAQIQEEGTVVELTGRQSSEITRT-----ITKLSF-VKADS--HFRQGIPFFGQVRLV--DGKGVPIPNKVIFIR----GNEANYYSNATTDEHGLVQFSI 409          
BLAST of Alpha-2-macroglobulin vs. UniProt/SwissProt
Match: sp|P20740|OVOS_CHICK (Ovostatin OS=Gallus gallus OX=9031 PE=1 SV=3)

HSP 1 Score: 331.643 bits (849), Expect = 5.210e-91
Identity = 274/954 (28.72%), Postives = 456/954 (47.80%), Query Frame = 1
Query: 2041 IPLMKN--MGPDVHVIAYFINTDNEVVADALE--IASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSS--NADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKR---MIQPIY-GLEYDSRKVLSTAGFTAITNARIVN-VKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAK--MKKQIREYFPESWVFS--YFNKTTK-HLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKS-----NSADIETTGYAILALI-----NHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTI--GVSQNVNLKVSVVLNRNKTYNGLITL--DNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSV--KQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSY 4803
            IPL+ N  M P + ++ Y ++   E+VAD++   I     N  QL     +F++K  +  S V L ++     + CA+R  D+++L     +  +A+  Y +  +  L   I     +    +  C+    +       +P+  GL  D  + L   G    TN++I     C +   R       A F+   T   K    V +    K  + + IRE+FPE+W++     N T K  ++ T+PD++T W+A ++C+ E  G  ++    L    PF+ ++ +PYS+   E   +   VFNY   C +INV +    +    +       C C    K+  +N+ PK  G +  +I + +     C E+  + I I   D+  R +LVEP G+  E T + LIC K++ +       +P+ +V GS R   +  GD+MG    N+ +L+ MP+G GEQNMV   P+IYVLDYL+     +  + +K   Y++ GY +QL+YKH DGS+S FG  DK G+TWLTAFV KSF +AS+++ I+ +   +   +L   Q++DGCF+  G L ++ M GG++         L+AY+ I+L     + +   I  A  C       N  +                + + ++   +L   +      KYW  ++ S+ E+        S D+E T Y +LAL+     + +DL+ +   V W+  Q+NS GG+ S QDTVVAL ALA +       V+QNV     + +N   T+  + T+  +NRL+ Q   L      Y S+  NG+GC  IQ +  YNIH L      F LSV+T   S    Q    +I +  +Y  +  +SNM+++ +   SG+   +     L    +  + +++++K  + LY          +     F +E+   +++ +PA V+I DYY  E Y+   Y
Sbjct:  532 IPLVVNEKMAPALRLLVYMLHPAKELVADSVRFSIEKCFKNKVQL-----QFSEKQMLTTSNVSLVIEAAAN-SFCAVRAVDKSMLLLKSETELSAETIYNLHPIQDLQGYIFNGLNLEDDPQDPCVSSDDIFHKGLYYRPLTSGLGPDVYQFLRDMGMKFFTNSKIRQPTVCTRETVRPPSYFLNAGFT-ASTHHVKLSAEVAREERGKRHILETIREFFPETWIWDIILINSTGKASVSYTIPDTITEWKASAFCVEELAGFGMSVPATLTAFQPFFVDLTLPYSIIHGEDFLVRANVFNYLNHCIKINVLLLESLDYQAKLISPEDDGCVCAKIRKSYVWNIFPKGTGDVLFSITAETNDDEACEEEALRNIRIDYRDTQIRALLVEPEGIRREETQNFLICMKDDVISQDVAIDLPTNVVEGSPRPSFSVVGDIMGTAIQNVHQLLQMPFGNGEQNMVLFAPNIYVLDYLDKTRQLSEDVKSKTIGYLVSGYQKQLSYKHPDGSYSTFGIRDKEGNTWLTAFVYKSFAEASRFIYIDDNVQAQTLIWLATKQKTDGCFQSTGILVNNAMKGGVENELS-----LSAYITIALLEAGHSMSHTVIRNAFYCLETASEKNITDIYTQALVAYAFCLAGKAEICESFLRELQKSAKEVDGSKYWEQNQRSAPEKSHLLDHVQSTDVEITSYVLLALLYKPNRSQEDLTKASAIVQWIIRQQNSYGGFASMQDTVVALQALAAYGAATYNSVTQNV-----IKINSKNTFEKVFTVNNENRLLLQQTPLPQVPGKY-SLTVNGTGCVLIQTALRYNIH-LPEGAFGFSLSVQTSNASCPRDQPGKFDIVLISSYTGKRSSSNMVIIDVKMLSGFVPVKSSLDQLIDDHT--VMQVEYKKNHVLLYLGNILQK---RRKEVTFSVEQDFVVTHPKPAPVQIYDYYETEEYAVAEY 1461          

HSP 2 Score: 109.768 bits (273), Expect = 2.111e-22
Identity = 90/340 (26.47%), Postives = 155/340 (45.59%), Query Frame = 1
Query:  385 INETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVS--INEAMNLEYQLNKDPIFGIWKAKAVF-DGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLY-SYGKKK----CVAFKSDLMKQNCNKIKLESKIVFILASSFRYS-------KAKSQI-NVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
            + E R + + +    +F +TDKPIYKPG  V  R +A                    LD N K + +          + LI ++ P N R+ QW+NV+  IN  + +E+ L ++PI G +K       G+     F +++YVLP+F V V  P  +   D  ++ K+C+ Y+ G+P+  K+    C  + SYG+ K    C +F  DL    C    L SK+  +    ++ +         K Q+ N+T T++ + + V  +++   + +           +Y+ G+PYFG+I LV  +  P      +  IQ +    N     N+T++  G+  F I
Sbjct:  125 LKERRSVMIWNMESFVFVQTDKPIYKPGQSVMFRVVA--------------------LDFNFKPVQE---------MYPLIAVQDPQNNRIFQWQNVTSEIN-IVQIEFPLTEEPILGNYKIIVTKKSGERTSHSFLVEEYVLPKFDVTVTAPGSLTVMDSELTVKICAVYTYGQPVEGKVQLSVCRDFDSYGRCKKSPVCQSFTKDLDTDGCLSHILSSKVFELNRIGYKRNLDVKAIVTEKEQVCNLTATQSISITQVMSSLQFENVDH-----------HYRRGIPYFGQIKLVDKDNSPIS----NKVIQLFVNNKN---THNFTTDINGIAPFSI 416          
BLAST of Alpha-2-macroglobulin vs. TrEMBL
Match: A0A4Y6HTR9 (Alpha-2-macroglobulin OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 2542.69 bits (6589), Expect = 0.000e+0
Identity = 1221/1855 (65.82%), Postives = 1516/1855 (81.73%), Query Frame = 1
Query:   85 FAVKDFYFITSPNLLITETSHHFNVHTSTDIVLTIESIHDPSQIKHQSSKFVIKKGFQTIPYYVPFVGSHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQISEVSSNLKPPMAATTVYQSLTNFQSKDGHYLQFMPINDKFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYPSVPVKCYPRDDFFGHYQCVNGTTLTCLSGWKGGNCREPICSGGCLNGACVEPNKCICKQYWTGKGCNQCTKAKYCKNGYCVNGGDCECYPGWMNFDCSKKGPIKHLYRNVTTVKPITKNETEIRKFEKQTIFERIISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGM--PDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKSDEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRRTVFVAEQSMFYEWNLELEPKNCSCLNSWESFNKSFVILSSRWRSLNEKLTLSNDSIMFPMTTLYSAYQFDLQAQCNIANNFYLMANRLIPDFANKTAKNDSCPKCILRNNYYSVIKNITEWYCANFTDWKLNISSTSPIVKGVLSSNVSSIPVELEFPHQFCYCYEHVRDTKKSFRIVDLNHKLQSLNQKPKDPIKLMLNKGFEVVDEEIFSSLKNIKCG 5643
            F +KDFYFIT+PNLL+ E  H FNVHTSTD+VLTI+SIH PS+I HQSS ++I+KGF +IPYYVPF+GSH+GSKI LN LGD C   +KC+   N+TGNFINETREIGLIDKNFIIFAETDKPIYKPG+K++ RFM IYPTNLMREP++IG Q EI+L+KNNKF     K+ N S  F+LI IE P   RVAQW NVS+ +AM+L YQL  DP+FG WK+KA FDGQEE+IQFE+K+YVLPRF+V V PP EILA  +SI FKVCSKYSTGK M A+I G FCM ++   + C  FKS L+KQ+CN+I +++K +F L S  R+++ KS INVTV ENGTSS VSK VEG GI Y SF IKF  + YYKPGLPYFG++ LVRHN KPA  +N+SI +++WAYG  WGF R YTSNK+G+++F++P IPL QS++++++EVS+++K PM+A T+YQS+ N++S D +Y+QF+P+N K KCP  LNLT++TNYDI+  ++YVQIFSRG+I  MIEYPS+PVKC+PR+DFFGHY+CVNGT L CL GWKGGNCREPIC GGCLNGACVEPNKCICK YW G+ C+QC  A YCKNGYC NG DC+CYPGW +FDCSKKGP  H Y N +T+ P +  +TEI+KFEKQT+FERII++PL+KNMGPDVH+I YFI  +NEVVAD++E+++GL NCS LGGGKFKF++KT +PK+KVVLT+DPGVK++ C++RIAD AL QFG+SSN DL+YL+QKLI LNHKIT+D+R     K  C+ + RVK+ I P Y   YDSRKVL+T+GFTAITNARI+N KC+ + ARG    DR  AT+             V K    ++ K+IRE FPESW+F+YFNKT K LNLTVPDSMTTW+AD+YCMTE+GLWIAPTQKLKVILPF++NIYVPYS+KL+E L +PVK+FNYA  C+EI VKINV++ EINVIGLKSFTLC C NDEKT+YF ++PKIIGKLN+T+DS SKYS+FCSE + K  NI MSDS+RRQ+LVEP GVPTETTFSELICNKNEQLGI++VF IP+ IV GSLRSY+TFNGDVMG+TFDNLDKLV MPYGCGEQNMVAVVPSIYVL+YL +L I NP L +KA+ YII+GY RQL YKH+DGSFSAFGK+DK GSTWLTAFVL+SF+ A+KYV +N S L +A KYLEKMQ+++GCF+E GKLFSSTMAGG+K+ND  D  LLTAYVLISL   D+ + TI I KAI C T NI+ N  NYRLAL++Y LS+Y  SS+ ++NV  QL  Q+   GRY+YW FDK++ +E K+ S+DIETTGYA+LA+ N Q L  S+KT+YWLSNQRNSLGGYYSTQDTVVAL+ LA FA+TIG+S NVNL +S+ LN  K YN LIT DNRLVS+TFNLG ENISY+S+KTNG+GC S+QL SLYNI +LY+A +TFKLSVK EI SV+QCNIR IK+CF+YLRRDK+SNMIL+IINYPSGWEL+E+E+KS+ LQI+TPLNRIDFQK++MELYYDAFSYNDAGKDSCFRF++EEK+KISNLQP+++K++DYYNP+IY+E SYSMFNK CN SD K P  P+VLLCPICVNDS+ ST+ FI +IC +WF GFVT + +  + R ++ ++QS F EW L++EP NCSCL +W++ N SF++LSS+W+ L+EKL LSNDS+M+P+ TLYS++++DLQ QC +A N Y+M NRL+PDFANKT +N+SCP CIL +NYY  I+N+T WYCAN+TDW L IS  SPI+ G+L +N+SSI VE+EF ++FCYC+E +RD KKSFRIVDL +++  ++ K   P KL+LN  +EV++  +F   K+IKCG
Sbjct:   35 FGIKDFYFITTPNLLLVEAPHQFNVHTSTDLVLTIDSIHTPSKINHQSSNYIIQKGFDSIPYYVPFIGSHVGSKITLNFLGDFCSDLLKCKSVTNVTGNFINETREIGLIDKNFIIFAETDKPIYKPGEKIKFRFMPIYPTNLMREPEDIGDQKEIILNKNNKFEWVLVKDKNMSQIFELIFIENPTGARVAQWINVSLAKAMDLRYQLTNDPVFGTWKSKATFDGQEELIQFEVKRYVLPRFVVTVNPPKEILANQKSIGFKVCSKYSTGKTMKAQIHGTFCMHHTDKTRNCEYFKSTLLKQSCNRIDIDTKSIFNLKSKSRFTRTKSVINVTVIENGTSSVVSKVVEGSGIMYTSFAIKFVSKLYYKPGLPYFGQLKLVRHNNKPASNINVSIDLENWAYGQGWGFHRIYTSNKEGIVDFIVPNIPLEQSVTVRVNEVSNDIKAPMSAATLYQSIANWESVDKYYMQFLPLNSKVKCPDDLNLTIVTNYDISEINMYVQIFSRGRITDMIEYPSIPVKCFPRNDFFGHYECVNGTVLVCLPGWKGGNCREPICVGGCLNGACVEPNKCICKAYWKGENCDQCIIAPYCKNGYCKNGNDCKCYPGWQSFDCSKKGPKVHSYENYSTIMPTSVKQTEIKKFEKQTVFERIITVPLLKNMGPDVHIIIYFITPNNEVVADSIELSNGLKNCSHLGGGKFKFDRKTTVPKTKVVLTLDPGVKDSSCSVRIADIALSQFGKSSNVDLAYLIQKLINLNHKITVDNRFSFGTKRLCVSKDRVKKSIWPGYRSGYDSRKVLATSGFTAITNARIINAKCLLFAARGSVNKDRVVATY-------------VQKTLKTEVNKKIRENFPESWLFAYFNKTNKLLNLTVPDSMTTWKADAYCMTERGLWIAPTQKLKVILPFFANIYVPYSIKLDEQLSVPVKIFNYASACYEIYVKINVESEEINVIGLKSFTLCVCSNDEKTLYFKIQPKIIGKLNITVDSISKYSTFCSEDQLKT-NIEMSDSIRRQLLVEPSGVPTETTFSELICNKNEQLGIVNVFTIPTTIVPGSLRSYVTFNGDVMGQTFDNLDKLVKMPYGCGEQNMVAVVPSIYVLEYLTNLKIVNPILISKAEGYIINGYNRQLLYKHEDGSFSAFGKSDKAGSTWLTAFVLRSFNAANKYVKLNSSMLTDAVKYLEKMQQNNGCFKENGKLFSSTMAGGVKKNDNTDEALLTAYVLISLK--DIKSKTIKIDKAIKCITANISQNPSNYRLALSAYALSIYQNSSNATENVIQQLRTQATEIGRYRYWLFDKDAMEESKTTSSDIETTGYALLAMQNSQSLFDSLKTIYWLSNQRNSLGGYYSTQDTVVALSVLATFAETIGLSNNVNLNLSITLNNEKNYNDLITTDNRLVSRTFNLGAENISYISIKTNGTGCVSVQLISLYNIQKLYSAKETFKLSVKPEIISVEQCNIRKIKICFSYLRRDKDSNMILLIINYPSGWELTEDEEKSVKLQITTPLNRIDFQKSKMELYYDAFSYNDAGKDSCFRFQLEEKSKISNLQPSLIKLMDYYNPDIYTETSYSMFNKDCNSSDVKIPEIPKVLLCPICVNDSLESTVNFIQSICQSWFQGFVTDDEDGIKNRIIYESKQSFFNEWKLDIEPMNCSCLKTWKNLNNSFIVLSSKWKYLSEKLILSNDSVMYPINTLYSSFKYDLQNQCRMAKNLYMMMNRLLPDFANKTEQNNSCPSCILGSNYYFKIQNLTSWYCANYTDWNLTISYLSPIITGILKNNISSINVEIEFSNRFCYCFEQIRDLKKSFRIVDLKNQIPVIDNKSNKPFKLLLNNDYEVIENNVFLWNKHIKCG 1873          
BLAST of Alpha-2-macroglobulin vs. TrEMBL
Match: A0A5J4NQR5 (Alpha-2-macroglobulin OS=Paragonimus westermani OX=34504 GN=DEA37_0001242 PE=4 SV=1)

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 491/1689 (29.07%), Postives = 779/1689 (46.12%), Query Frame = 1
Query:  418 KNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIG---KQVEIVLDKNNKFIS-KPSKND--NDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCML--------------------------YSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVN-----ISISIQSWA-------YGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQIS-----------EVSSNLKPPMAAT--------TVYQSLTNFQSKDGHYLQFMPINDKF--KCPGKLNLTLLTNYDIASTSIYVQIFSRGQIVKM---IEYPSVPVKCYPRDDFFGHYQCVNGTT--LTCLSGWKGGNCREPICSGGC--LNGACVEPNKCICKQYWTGKGCNQCTKAKYCKNGYCVNGGDCECYPGWMNFDCSKKGP--IKHLYRNVTTVKPITKNETEIRKFEK-----------QTIFERIISIPLMKNMGPDVHVIAYFINTDN-----EVVADALEIASGLNNCSQLGGG--------KFKFNKKTAMPKSKVVLTVDP----------GVKENG------CAIRIADEALLQFGQSSNA-DLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITN------ARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKH--------LNLTVPDSMTTWRADSYCMTEK-GLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVF-----------NYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI--------NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVF--AIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLN---SLNIKNPA-LSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSF---HDASKYVNINLSTL-KEATKYLEKMQRSD--GCFEEKGKLFSSTMAGGIKRNDKADGK-LLTAYVLISLNG------------VDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQ-----SVSFGRYK-YWPFDKESSDE--QKSNSADIETTGYAILALINHQDLSVS--MKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGV----SQNVNLKVSVVLNR-NKTYNGLITLDNRLVSQTF----------NLGTENISYVSMKTNGSG-CASIQLSSLYNIHRLYAAND-TFKLSV---KTEIDSVKQCNIRNIKVCF-----AYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRME------LYYDAFSYNDAGKDS-------CFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSM 4809
            +N ++  ETDKPIY+PG+ VR+RF+A+ P   +   + +    ++  I LD N  F+   P+  D  N   Y ++ ++++ DN RV QW   S   A NL Y L  D   G W AK  F G+ E+++F +K+YVLPRF+  + PP+ +  + +   F VC+KY+ G+PM   +    C+                            S+  + C+     L    C      ++ +      F +   +  +   V E GT S+V++   G  +     +I+    P +KPGLP  G +  V    +P  +V+     I ++ + +A         + + F+ +  ++  G   F IP I   + L ++ +           EVS +LKP    +          Y  +  + S+ G  LQ  P +     KCPG + L ++ N  +A  +IYVQ  +RG++++     E   V   C  RDD  GHY+CV+ T+  + CL GW G +C  P+C+ GC    G C +PN C C   WTG  C +C K   CK G CVNG DC C PGW+ F C  +    ++ +  ++ T +     E   R+ E+           +T++ER I+  +  + GP+  V+ YF N DN     E+V   +E+ + L+NC+                F++    P  +V LTV P           VKE        C +R++D +L  F Q  N  D++  ++++ +    I         + H  +P   ++              ++ +   FT I        AR+ +      +A  +P    +  S+      +  NSV      +   ++R++FPE W+F Y     +TT+H         NLTVPDS+TTWRA ++C T+  GLWI P+++L V +PF++ I +P  +   E+L LP+ +            N +  CFEI V   VD  +   + +  FT C C+ +++T    L P+ +G+LNVT+ + +   S   +     +        +  + D VRR + V P GVP  +   ++IC +  +L    VF   +   +V GSLR Y ++  +V+G    NL+ LV MP GCGEQNMV V P++YVLDYL    S+N++    L   A++YI  GY  Q  Y+ +DGS+SAFGK+D+ GSTWLTAFVL  F   H     + I  +TL  E   YL + Q S   GCF EKG++  + + GG+        + LLTAYVL +L G            V+ +               ++ N    Y LA  +Y  SL  P SS +  +  +LL++     S      K +W      S    + + + DIETT +A LAL     LS+S     + WL++Q+N+ GG+ STQDTV+ L  +A  AK +G+    +    L+V V+L+    + +  +TL+ R V   F           L   NI   S   N SG C ++Q    YN+    AA    F LS+   +      K C    + VC      A+++RD  S M+L+ I   SGW+  E+E   L    + P +    +   M       LY+DAF+ ++A           C   K+++   + N + AVV  +DYY  E    ++Y +
Sbjct:  141 RNVVVLGETDKPIYRPGEVVRMRFLALKPQFTVPLNETVSYPLRKPIITLDGNVTFVELTPADVDMLNGIEYEEISLVDSQDN-RVKQWLRASPRLAANLSYHLLNDAPEGEWHAKVHFSGKTEVLRFSVKQYVLPRFLTIIQPPNNLTFETKFSQFSVCAKYTDGQPMLGFVRAQLCVCERSSDGKITLDEQNSITTENICPKNHASFKPRPCIRLNELLRADGCAFFNTTTRPLEFDNIEFPH-WGQGLVCAEVEEEGTQSTVTRCELGASVSKKKASIELTIPPVFKPGLPIMGSV--VLRGVEPVHLVHGAELTIKVTEERFACWYPRFSVKDTYQFVTSVKTDSNGSARFYIPPINSTRRLFVKATYVPGDPNNTFEEVSHDLKPHSLLSFTSRNKEIEAYDFIRPWLSQSGSSLQLWPTDKPVVAKCPGVVTLNMIANTQLAKRAIYVQCIARGRLLQRYIPAELVEVSEMCRDRDDHLGHYKCVSTTSDRIVCLPGWVGNDCLHPVCANGCHPRGGVCYQPNTCTCIDGWTGLNCQECVKRTNCKQGRCVNGDDCVCDPGWVGFLCDTRKVHFVETVNADIQTNENNESPEKTFRELEEPDKTTEAVFSHRTLYERQINFSIDGDWGPEATVVVYFYNGDNDSRGVEIVPMVIELRN-LDNCTNPATAMQAESLVSGINFDQNHVSPGQQVQLTVRPVDQTFNPVTRAVKEREQIPDQVCFLRMSDISLDNFEQEKNVIDMTSFLKRIQQTQETI---------KWHSAVPDNVLE-------AFRSAGLQLTTLTDFTTIQQTFQPCLARMYSTVVDGPMASALPAPPMSLISSNAVTKEQEANSV----PIQTMPRLRDFFPEVWLFDYAPVEQQTTQHGQSFYGVQTNLTVPDSITTWRASAFCTTKSNGLWIPPSKRLTVSMPFFAEITLPKQVIRGEILYLPISIHVIDNEIKSAGDNGSKECFEIRVFTQVDEQDWVRVSISEFTGCACRGEKRTFQMGLLPRRLGQLNVTVIAQATSGSVICDSDTDDMLFKVNQEKHRMIQDMVRRSVRVVPEGVPRISAIGDIICLRAPELSKTQVFPLVMTENVVPGSLRVYWSYTDEVLGPALKNLNSLVQMPTGCGEQNMVLVAPNVYVLDYLKSSPSVNVRQTEKLIRSARTYIEAGYHGQSKYRLEDGSYSAFGKSDRVGSTWLTAFVLSVFSKAHRVDSSIRIEWTTLFNETVDYLIQHQDSQGAGCFVEKGRVIHTAIQGGLSVGTSVSKESLLTAYVLAALWGTRPIVGQTLSSRVNTSVNDGIRCLTEAIHPGSVINQMSTYELAQFAYTFSLIKPQSSDTVALIKELLNRRHSETSAGLADTKNFWSIRSNLSTNYPRMAEAIDIETTSFAYLAL-TQSGLSISELFPVIRWLASQQNANGGFRSTQDTVLGLEVIADGAKRLGLHTLNTTENQLEVEVLLDPLGYSISDTVTLEKRRVVNQFAVPYTEPHQAQLARWNI---SAPLNSSGQCLAVQTVLYYNVPDTDAAGQAAFDLSINVAQPRAPPAKACTTAAVTVCLRVPERAHMQRD--SGMLLIKIPMVSGWQPIEKEVFGLMS--AGPRDSELVRMVEMSDDGTLWLYFDAFTSSEATSAGGWSNLKRCAEVKLKQNVYVENTRSAVVTAMDYYATERSISRNYGL 1796          
BLAST of Alpha-2-macroglobulin vs. TrEMBL
Match: A0A1S8WUB0 (A-macroglobulin complement component OS=Opisthorchis viverrini OX=6198 GN=X801_06124 PE=4 SV=1)

HSP 1 Score: 583.178 bits (1502), Expect = 2.812e-171
Identity = 514/1892 (27.17%), Postives = 820/1892 (43.34%), Query Frame = 1
Query:  106 FITSPNLLITETSHHFNVHT-----STDIVLTIESIH----DPSQIKHQSSKFVIKKGFQTIPYYVPFVG-SHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAI-------------YPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCML--------------------------YSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQ---SW-------------AYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQISEVSSN---------LKPP------MAATTVYQSLTNFQSKDGHYLQFMPINDKFKCP--GKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYP--SVPVKCYPRDDFFGHYQCVNGTT--LTCLSGWKGGNCREPICSGGC--LNGACVEPNKCICKQYWTGKGCNQCTKAKYCKNGYCVNGGDCECYPGWMNFDCS----KKGPIKHLYRNVTT-----VKPITKNETEIRKFEKQTIFERIISIPLMKNMGPDVHVIAYFIN---TDNEVVADALEIASGLNNCS-------QLGGGKFKFNKKTAMPKSKVVLTVDPG----------------VKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYG----LEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSY-----FNKTTKH------LNLTVPDSMTTWRADSYCMTEK-GLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVF--------NYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELIC--NKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNS----LNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKY---VNINLSTL-KEATKYLEKMQ--RSDGCFEEKGKLFSSTMAGGI-KRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENIT----------------NNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSF-----GRYKYWPFDKESSDEQKS---NSADIETTGYAILALINHQDLSVS-MKTVYWLSNQRNSLGGYYSTQDTVVALNALA------VFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTE--NISYVSMKTN-----GSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDS----VKQCNIRNIKVCFAYLRRD---KNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKT-RMELYYDAFSYNDAGKDS-------CFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKS--DEKEP-----------------GRPEVLLCPIC-VNDSINSTLKFI--GTICNAWFNGFVT----ANSNASQRRTVFVAEQSMFYEWNLELEP---KNCSC 5055
            FIT P+ L  E  +  +V T     S  ++ +I S++    D  Q+   S+KF      Q I Y  PFV  +   + ++LN     C +    E T+    +   +TR   +  +  I+  ETDKPIY+PG+ VR RF+ +             YPT  +      G   E+ LD    F S+ ++      Y ++ + +   N R+ +W NVS  EA  L Y L  D   G W   A   G+ E + F +K +VLPRF+VE+ PP  +  +     + VC++Y+ G PM   +    C+                            S+  + CV     L K  C K    ++ + +    +R       +   V E GT S+V++   G  +      ++      YKPGLP    I++      P  + +  I+++   SW                  + +      +  G  + VIP       +S++     +N         + PP            Y  L+ + S  G  +Q  P    F     G + + LL N  +   ++ VQ   RG++VK I  P   V   C  RDD  GHY+C   T   + CL GW+G +C +PIC+ GC    G C  P  C C++ WTG  C  C K + C +G CV+G DC C  GW    C     +   I+ +   V+T     V  +    TE     ++T++ R IS P+  + GP+  VI YF     +  E++   LE+    N  S       Q      +F++K   P   V LTV P                 + E  C IR++D AL  F  + N                      I L    K + Q     M +P         + +  +  T+ F A    R   + C        P  S     ++      + N+V+  S   +K ++R++FPE W+F        N ++         +LT PDS+TTWRA ++C T+  GLWI  +  + V +PF+  + +P  +K  E++ LPV VF             C+E+ V   V   +   +G+  ++ C C  +++T    L P+ +G+LNVT ++ +   S   ++ +      +SD +RRQI V P GVP E TF +++C  +      + +  ++PS ++ GSLR YLT+  +V+G    NLD LV +P GCGEQNMV V P++YVL+YL S     + +   L   A+++I+ GY  QL Y+ DDGS+SAFG++DK GSTWLTAFVL+ F  A +    +NI+   L  E   +L++ Q     GCF EKG++  S+M GG+    +K D  LLTAYVL SL  + +T    +     +  T  I                 +N   Y LA  SY L +Y P    ++    +L+ +  +      G   YWP ++ S D + S   ++ D+ETT YA L L   ++ ++  +  V WLS Q+ S GG+ STQDT++A+ A+A      ++  T   + N++L   V+ +  K  + L     ++V+Q     T+   +  +  + N      + C ++Q +  YN+    +  D       T + S       C    +  C     R    + S M+LV +   SGW+  +EE   L       + +++F     + LY++ F+ N+A           C    + + T + + QPA++  +DYY  E      Y +  + C  +   E EP                   P+ LLCP C V+ S+ S L  I    IC+ + + FV     ++ NA     + V+       WN  ++     NCSC
Sbjct:   25 FITVPSTLYVEHENLISVRTLQQIPSAQLITSIPSLNHKVVDTKQLDL-STKFPDNLYGQDISYKAPFVPITEKSADVQLNFSLTFCTNP---ECTEKTVKHLTADTR---IARRPVIVLGETDKPIYRPGENVRFRFLTLTPQFTVPLNGPINYPTQQLVGGATDG---ELTLDT---FTSEHAETLTRVVYDEIYVKDDKGN-RLKRWLNVSPAEAAKLSYSLLADAQEGKWAVVANVLGETETLSFSVKHFVLPRFVVEISPPKGLTFESNFTEYSVCARYTNGPPMGGSVRSYLCVCDGPGRPETDLSIEDDVLITGTCPGDSGSHAARPCVQQNDILQKDGCVKFSPSTEKLHLKNRDYRIWGQHVIVCAEVKEEGTGSNVTRCEVGEALLRRQATMEITAPSVYKPGLP----ISIALKINGPV-LADAEITVECSESWNSCFRMWHPLSRRPDQGRYQYSTKVKPDSTGFAQLVIPPPSTTSGISVKAIYSLNNTNKRAKRWVVMPPWNEDQSTQQIVAYAHLSAWDSLSGTSMQVWPNEKAFSLSPSGLVTVNLLGNVPLLDKTLIVQTMVRGKVVKHIVRPLDGVTEYCEDRDDNLGHYKCQKNTADGIKCLRGWQGKDCLQPICAAGCNSRGGFCEVPGVCTCRKGWTGSNCEICLKREGCVHGQCVDGNDCVCDKGWQGHLCQLAQVEVESIEEVTEPVSTEETEAVGNLPDTTTEASTVPRRTLYRRNISFPVDGSWGPEAIVIIYFYTEYESTAEIIPAVLELKDLENYTSPAMALQAQTDKAGIQFDRKRVSPGQAVELTVSPAGVDTSALENNLLSGETLSEQVCFIRLSDVALDNFDGNRNL---------------------INLETYAKSVEQLNSANMWRPTVAKTVEEAFQAAGMFHTSVF-AKERIRPDIIAC--------PLMSMMRSGSQMDSDMPAPNAVMANSIPSVKPRLRDFFPEVWLFEAVPIGKINSSSGQPTVGVQQSLTAPDSITTWRASAFCTTKSNGLWIPDSNTVTVSMPFFLELTLPKQVKRGEIIYLPVSVFVARKEELDPKEKGCYEVRVSTRVAREDWLRVGVSDYSGCVCSGEKQTFQLGLVPQRLGQLNVTAEAYAISGSQLCDESQVH---TLSDMIRRQIRVIPEGVPKEATFGDILCLPDGVSHNVLTTPVSVPSSMIPGSLRVYLTYTDEVLGPALSNLDNLVRLPTGCGEQNMVLVAPNVYVLEYLKSGAQVSSKEREKLIHSARTHIMTGYKGQLKYRLDDGSYSAFGQSDKVGSTWLTAFVLRVFSKAYRVDPTLNIDWDRLFNETFTFLKQRQDLEGSGCFVEKGRVIQSSMQGGLGGSKEKNDQALLTAYVLSSLYDLKVTKAATDPKAYESIITNGIRCIKAGVPRDILLPEPLSNVATYGLAQVSYALQMYQPERYDTELYLQELIRRRRTISDALRGPRSYWPANESSDDAESSKWADALDVETTSYAYLTLAERREQAIELLPIVRWLSTQQTSTGGFRSTQDTILAMQAIAHAATGLLYNGTNPGNTNISLSAKVIPSGYKIDDVLNDQKRQVVNQIAIPHTDPNEVQEIMWEVNTDAMSATHCVALQTALFYNVPEPTSTTDDIFTVTATVVQSNPPPGNSCTTAMLTTCLRPASRTDPVQESGMLLVRVQMVSGWKPVQEEILKLVGTDEESVRKVEFDDDGTVSLYFNGFTSNEAEVAGGWSQLKRCVELSLRQTTYVDSTQPALISAMDYYATERSVMIKYQL--EECKPAWLTENEPPVTTTLSATTTEPPLSTPTPKPLLCPKCQVDSSLTSNLSDILYSMICSGYGSMFVMNLYESDENAFNVTMIVVSANGFASTWNATVDRPALSNCSC 1862          
BLAST of Alpha-2-macroglobulin vs. TrEMBL
Match: A0A074ZT72 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13202 PE=4 SV=1)

HSP 1 Score: 581.252 bits (1497), Expect = 1.581e-170
Identity = 515/1895 (27.18%), Postives = 822/1895 (43.38%), Query Frame = 1
Query:  106 FITSPNLLITETSHHFNVHT-----STDIVLTIESIH----DPSQIKHQSSKFVIKKGFQTIPYYVPFVG-SHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAI-------------YPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCML--------------------------YSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQ---SW-------------AYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQISEVSSN---------LKPP------MAATTVYQSLTNFQSKDGHYLQFMPINDKFKCP--GKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYP--SVPVKCYPRDDFFGHYQCVNGTT--LTCLSGWKGGNCREPICSGGC--LNGACVEPNKCICKQYWTGKGCNQCTKAKYCKNGYCVNGGDCECYPGWMNFDCS----KKGPIKHLYRNVTT-----VKPITKNETEIRKFEKQTIFERIISIPLMKNMGPDVHVIAYFIN---TDNEVVADALEIASGLNNCS-------QLGGGKFKFNKKTAMPKSKVVLTVDPG----------------VKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYG----LEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSY-----FNKTTKH------LNLTVPDSMTTWRADSYCMTEK-GLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVF--------NYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXIN---IAMSDSVRRQILVEPPGVPTETTFSELICNKN--EQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNS----LNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKY---VNINLSTL-KEATKYLEKMQ--RSDGCFEEKGKLFSSTMAGGIKRN-DKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENIT----------------NNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSF-----GRYKYWPFDKESSDEQKS---NSADIETTGYAILALINHQDLSVS-MKTVYWLSNQRNSLGGYYSTQDTVVALNALA------VFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTE--NISYVSMKTN-----GSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDS----VKQCNIRNIKVCFAYLRRD---KNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKT-RMELYYDAFSYNDAGKDS-------CFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKS--DEKEP-----------------GRPEVLLCPIC-VNDSINSTLKFI--GTICNAWFNGFVT----ANSNASQRRTVFVAEQSMFYEWNLELEP---KNCSC 5055
            FIT P+ L  E  +  +V T     S  ++ +I S++    D  Q+   S+KF      Q I Y  PFV  +   + ++LN     C +    E T+    +   +TR   +  +  I+  ETDKPIY+PG+ VR RF+ +             YPT  +      G   E+ LD    F S+ ++      Y ++ + +   N R+ +W NVS  EA  L Y L  D   G W   A   G+ E + F +K +VLPRF+VE+ PP  +  +     + VC++Y+ G PM   +    C+                            S+  + CV     L K  C K    ++ + +    +R       +   V E GT S+V++   G  +      ++      YKPGLP    I++      P  + +  I+++   SW                  + +      +  G  + VIP       +S++     +N         + PP            Y  L+ + S  G  +Q  P    F     G + + LL N  +   ++ VQ   RG++VK I  P   V   C  RDD  GHY+C   T   + CL GW+G +C +PIC+ GC    G C  P  C C++ WTG  C  C K + C +G CV+G DC C  GW    C     +   I+ +   V+T     V  +    TE     ++T++ R IS P+  + GP+  VI YF     +  E++   LE+    N  S       Q      +F +K   P   V LTV P                 + E  C IR++D AL  F  + N                      I L    K + Q     M +P         + +  +  T+ F A    R   + C        P  S     ++      + N+V+  S   +K ++R++FPE W+F        N ++         +LT PDS+TTWRA ++C T+  GLWI  +  + V +PF+  + +P  +K  E++ LPV VF             C+E+ V   V   +   +G+  ++ C C  +++T    L P+ +G+LNVT ++ +   S   ++ + + N     +SD +RRQI V P GVP E TF +++C  +      + +  ++PS ++ GSLR YLT+  +V+G    NLD LV +P GCGEQNMV V P++YVL+YL S     + +   L   A+++I+ GY  QL Y+ DDGS+SAFG++DK GSTWLTAFVL+ F  A +    +NI+   L  E   +L++ Q     GCF EKG++  S+M GG+  + +K D  LLTAYVL SL  + +T    +     +  T  I                 +N   Y LA  SY L +Y P    ++    +L+ +  +      G   YWP ++ S D + S   ++ D+ETT YA L L   ++ ++  +  V WLS Q+ S GG+ STQDT++A+ A+A      ++  T   + N++L   V+ +  K  + L     ++V+Q     T+   +  +  + N      + C ++Q +  YN+    +  D       T + S       C    +  C     R    + S M+LV +   SGW+  +EE   L       + +++F     + LY++ F+ N+A           C    + + T + + QPA++  +DYY  E      Y +  + C  +   E EP                   P+ LLCP C V+ S+ S L  I    IC+ + + FV     ++ NA     + V+       WN  ++     NCSC
Sbjct:   25 FITVPSTLYVEHENLISVRTLQQIPSAQLITSIPSLNHKVVDTKQLDL-STKFPDNLYGQDISYKAPFVPITEKSADVQLNFSLTFCTNP---ECTEKTVKHLTADTR---IARRPVIVLGETDKPIYRPGENVRFRFLTLTPQFTVPLNGPINYPTQQLVGGATDG---ELTLDT---FTSEHAETLTRVVYDEIYVKDDKGN-RLKRWLNVSPAEAAKLSYSLLADAQEGKWAVVANVLGETETLSFSVKHFVLPRFVVEISPPKGLTFESNFTEYSVCARYTNGPPMGGSVRSYLCVCDGPGRPETDLSIEDDVLITGTCPGDSGSHAARPCVQQNDILQKDGCVKFSPSTEKLHLKNRDYRIWGQHVIVCAEVKEEGTGSNVTRCEVGEALLRRQATMEITAPSVYKPGLP----ISIALKINGPV-LADAEITVECSESWNSCFRMWHPLSRRPDQGRYQYSTKVKPDSTGFAQLVIPPPSTTSGISVKAIYSLNNTNKRAKRWVVMPPWNEDQSTQQIVAYAHLSAWDSLSGTSMQVWPNEKAFSLSPSGLVTVNLLGNVPLLDKTLIVQTMVRGKVVKHIVRPLDGVTEYCEDRDDNLGHYKCQKNTADGIKCLRGWQGKDCLQPICAAGCNSRGGFCEVPGVCTCRKGWTGSNCEICLKREGCVHGQCVDGNDCVCDKGWQGHLCQLAQVEVESIEEVTEPVSTEETEAVGNLPDTTTEASTVPRRTLYRRNISFPVDGSWGPEAIVIIYFYTEYESTAEIIPAVLELKDLENYTSPAMALQAQTNKAGIQFGRKRVSPGQAVELTVSPAGVDTSALENNLLSGETLSEQVCFIRLSDVALDNFDGNRNL---------------------INLETYAKSVEQLNSANMWRPTVAKTVEEAFQAAGMFHTSVF-AKERIRPDIIAC--------PLMSMMRSGSQMDSDMPAPNAVMANSIPSVKPRLRDFFPEVWLFEAVPIGKINSSSGQPTVGVQQSLTAPDSITTWRASAFCTTKSNGLWIPDSNTVTVSMPFFLELTLPKQVKRGEIIYLPVSVFVARKEELDPKEKGCYEVRVSTRVAREDWLRVGVSDYSGCVCSGEKQTFQLGLVPQRLGQLNVTAEAYAISGSQLCDESQDESNKQVHTLSDMIRRQIRVIPEGVPKEATFGDILCLPDGVSHNVLTTPVSVPSSMIPGSLRVYLTYTDEVLGPALSNLDNLVRLPTGCGEQNMVLVAPNVYVLEYLKSGAQVSSKEREKLIHSARTHIMTGYKGQLKYRLDDGSYSAFGQSDKVGSTWLTAFVLRVFSKAYRVDPTLNIDWDRLFNETFTFLKQRQDLEGSGCFVEKGRVIQSSMQGGLGGSKEKNDQALLTAYVLSSLYDLKVTKAATDPKAYESIITNGIRCIKAGVPRDILLPEPLSNVATYGLAQVSYALQMYQPERYDTELYLQELIRRRRTISDALRGPRSYWPANESSDDAESSKWADALDVETTSYAYLTLAERREQAIELLPIVRWLSTQQTSTGGFRSTQDTILAMQAIAHAATGLLYNGTNPGNTNISLSAKVIPSGYKIDDVLNDQKRQVVNQIAIPHTDPNEVQEIMWEVNTDAMSATHCVALQTALFYNVPEPTSTTDDIFTVTATVVQSNPPPGNSCTTAMLTTCLRPASRTDPVQESGMLLVRVQMVSGWKPVQEEILKLVGTDEESVRKVEFDDDGTVSLYFNGFTSNEAEVAGGWSQLKRCVELSLRQTTYVDSTQPALISAMDYYATERSVMIKYQL--EECKPAWLTENEPPVTTTLSATTTEPPLSTPTPKPLLCPKCQVDSSLTSNLSDILYSMICSGYGSMFVMNLYESDENAFNVTMIVVSANGFASTWNATVDRPALSNCSC 1868          
BLAST of Alpha-2-macroglobulin vs. TrEMBL
Match: A0A4S2M4B3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002792 PE=4 SV=1)

HSP 1 Score: 575.859 bits (1483), Expect = 2.717e-168
Identity = 518/1899 (27.28%), Postives = 830/1899 (43.71%), Query Frame = 1
Query:  106 FITSPNLLITETSHHFNVHT-----STDIVLTIESIH----DPSQIKHQSSKFVIKKGFQTIPYYVPFV-GSHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAI-------------YPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGK--------------------------KKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISI---QSW-------------AYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQISEVSSN---------LKPPM------AATTVYQSLTNFQSKDGHYLQFMPINDKFKC--PGKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYP--SVPVKCYPRDDFFGHYQCVNGTT--LTCLSGWKGGNCREPICSGGC--LNGACVEPNKCICKQYWTGKGCNQCTKAKYCKNGYCVNGGDCECYPGWMNFDCS----KKGPIKHLYRNVT-----TVKPITKNETEI---RKFEKQTIFERIISIPLMKNMGPDVHVIAYFIN---TDNEVVADALEIASGLNNCS-------QLGGGKFKFNKKTAMPKSKVVLTVDP-GVKENG---------------CAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGF---TAITNAR----IVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSY-----FNKTTK------HLNLTVPDSMTTWRADSYCMTEK-GLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVF--------NYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINI---AMSDSVRRQILVEPPGVPTETTFSELICNKNE-QLGILSV-FAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNI----KNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDA---SKYVNINLSTL-KEATKYLEKMQ--RSDGCFEEKGKLFSSTMAGGI-KRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENIT----------------NNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSF-----GRYKYWPFDKESSDEQKS---NSADIETTGYAILALINHQDLSVSM-KTVYWLSNQRNSLGGYYSTQDTVVALNALA------VFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTE--NISYVSMKTN-----GSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVK----QCNIRNIKVCFAYLRRD---KNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKT-RMELYYDAFSYNDAGKDS-------CFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKSDEKEPGR-----------------PEVLLCPICVNDS---INSTLKFIGTICNAWFNGFVTANSNASQR---RTVFVAEQSMFYE-WNLELEP---KNCSC 5055
            FIT P+ L  E  +  +V T     S  ++ +I S++    D  Q+   S++F      Q I Y  PFV  +   + ++LN     C +    E T+        +TR   +  +  I+  ETDKP+Y+PG+ VR RF+ +             YPT  +      G   E+ LD    F S+ ++      Y ++ + +   N R+ +W NVS  EA NL Y L  D   GIW   A   G+ E + F +K YVLPRF++E+ PP+ I  +     + VC++Y+ G PM+  +    C+    G+                          + CV     L K  C +  L ++ + +    +R       +   V E GT S+V++   G  +      ++      YKPGLP    I++    K P  + +  I++   +SW                  + +      ++ G  + VIP       +S++     +N         + PP            Y  L+ ++S  G  +Q  P    F     G + + L+ N  + + ++ VQ   RG++V+ I  P   V   C  RDD  GHY+C N TT  + CL GW+G +C +PIC+ GC    G C  P +C C++ WTG  C  C K + C +G CV+G DC C  GW    C     ++  I+ +    T     TV  +T + TE+       ++T+++R IS P+  + G +  VI YF +   +  E+V   L +    N  S       Q      +F++K   P   V LTV P GV  N                C IR++D AL  F    N                      I L    K + Q  V  M +P      +  +    AG    +   N R    IV    M  +  G       + SN+    S +  +V       +K ++R++FPE W+F        N ++        L+L+ PDS+TTWRA ++C T+  GLWI  +  + V +PF+  + +P  +K  E++ LPV VF             C+E+ V  +V   +   +G+  ++ C C  +++T    L P+ +G+LNVT ++ +   S   ++ +   N     +SD +RRQI V P GVP E TF +++C  +    G+++   ++P  I+ GSLR YLT+  +V+G    NLD LV +P GCGEQNMV V P++YVL+YL S  +    +   L   A+ +I+ GY  QL Y+ +DGS+SAFG++DK GSTWLTAFVL+ F  A    + + I+   L  E   +L++ Q     GCF EKG++  S+M GG+    +K D  LLTAYVL SL  + +T+   +     +  T  I                 +N   Y LA  SY+L +Y P    ++    +L+ +  +      G   YWP ++ S D + S   ++ D+ETT YA L L   ++  V +   V WLS Q+ S GG+ STQDT++A+ A+A      ++  T   + N++L   V+ +  K  + L     ++V+Q     T+  ++  +    N      + C ++Q +  YNI    +  D       T   S       C    +  C     +    + S M+LV +   SGW+  +EE   L       + +++F     + LY++ F+  +A           C +  +++ T + + QPA++  +DYY  E      Y +         E EP                   P+  LCP C  DS    N +      IC+ + N F+     + +     T+ V   S F   WN  +      NCSC
Sbjct:   96 FITVPSTLYVEHENLISVRTLENIPSAQLITSIPSLNHTIVDTKQLDL-STQFPDNLYGQDISYKTPFVPTAEKSTNVQLNFSLTFCANP---ECTEKTVKYLTADTR---IARRPVIVLGETDKPVYRPGENVRFRFLTLTPQFTVPLNGPVNYPTQQLVGSATDG---ELALDT---FTSEHAEKLIRVVYDEIYVKDDKGN-RLKRWLNVSPAEAANLSYSLLADAREGIWTIVAHVLGETETLSFSVKHYVLPRFVMEISPPNNITFESNFTEYSVCARYTNGPPMSGSVRSYLCVCDKPGRSETDLPTEGDVLITGTCPGGSGSQPPRPCVQQNDILQKDGCVRFGLSTEKLHLKNRDYRIWGQHVIVCAEVEEEGTGSNVTRCEVGDELLRREVTMEITAPSVYKPGLP----ISIALKIKGP-NLADAEITVECSESWNSCFRMWRPLPREPEQGRYQYSTKVKPDRTGFAQLVIPPPSTTNGISVKAIYSLNNTNKRVKRWVIMPPWNDDQSNQQIVAYAHLSAWESLSGTSMQTWPNEKAFSLSPSGLVTVNLMANVPLLNKTVIVQTMVRGKVVQHIIRPLNGVTEYCEDRDDSLGHYRCQNNTTDGIECLHGWQGKDCLQPICAPGCSLRGGFCEMPWQCKCRKGWTGSNCEICLKQEGCVHGQCVDGNDCVCDEGWQGHLCQLARVQQERIEEVMEPDTTEKTETVDSLTDSTTEVLWPSTVPRRTLYQRNISFPVDGSWGSEATVIIYFYSKYESTAEIVPAVLHLKDLENYTSPAMALQTQTNTTGIRFDRKRVSPGQAVKLTVSPAGVDTNALQNSLLSSDTLSEQVCFIRLSDVALDNFDGEKNL---------------------INLETYAKSVEQLSVANMWRPTVAKTVE--EAFQAAGMYHTSFFANERIRPDIVACPLMSMMRSG-------SQSNQMEVDSPAARAVTANLMPGVKPRLRDFFPEVWLFEAAPIGTINSSSGQPTVGVQLSLSAPDSITTWRASTFCTTKSNGLWIPDSNTVAVSMPFFLEMTLPKQVKRGEIIYLPVSVFVVREEELDPKEKGCYEVRVSTSVAREDWLPVGVNDYSGCVCSGEKQTFQLGLVPQRLGQLNVTAEAYAISGSQLCDESQDVSNRQVHTLSDMIRRQIRVIPEGVPKEATFGDILCLPDGVSHGVVTTPVSVPPSIIPGSLRVYLTYTDEVLGPALSNLDNLVRLPTGCGEQNMVLVAPNVYVLEYLKSGALVSSKEREKLMHSARMHIMTGYKGQLKYRLEDGSYSAFGQSDKVGSTWLTAFVLRVFTKAYRVDRTLKIDWDRLFNETFTFLKQRQDLEGSGCFVEKGRVIQSSMQGGLGGSKEKNDQALLTAYVLSSLYDLRVTSAARDYDAYESVITNGIRCIKAGVPRDILLPEPLSNVATYGLAQVSYVLQMYQPERYDTELYLQELMRRRHTISDALRGPRSYWPANEPSEDTESSKWADALDVETTSYAYLTLAERREQVVELFSIVRWLSTQQTSTGGFRSTQDTILAVQAIAHAATRLLYNGTNPGNTNISLSAKVIPSGYKIDDVLSDQKRQVVNQIAIPHTDPKDVQEIMWDVNTDAMSATHCVALQTALFYNIPEPTSTTDGIFTMTATVAQSRPPPGNSCTTATVTTCLRPASKTDPVQESGMLLVRVQMVSGWKPVQEEILKLVGSEEESVRKVEFDDDGTVSLYFNGFTSGEAKVAGGWSQLKRCVQLNLQQTTYVDSTQPALISAMDYYATERSVMIKYQLEECKSAWLTENEPSVITNVSTATTETPLSTSIPKPRLCPKCQLDSGLKSNLSDSLYAMICSGYNNMFMMDLYESDEEVFNVTMIVVSASGFASTWNATVNRAALSNCSC 1945          
BLAST of Alpha-2-macroglobulin vs. Ensembl Cavefish
Match: ENSAMXT00000031363.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:15733406:15761969:1 gene:ENSAMXG00000010565.2 transcript:ENSAMXT00000031363.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 335.88 bits (860), Expect = 1.077e-93
Identity = 233/735 (31.70%), Postives = 387/735 (52.65%), Query Frame = 1
Query: 2650 IREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKS----FTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSV--KTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPL-NRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            +R++FPE+W++      +  +  + +TVPD++TTW  D++C++ +G+ +AP  +L+V  PF+  + +PYS+   E  +L   VFNY   C  I VK+    +    +   S    ++ C C N  KT  + L P ++G LNVT+ ++++ S      +   + +    D+V R +LV+  G     + S L+C +   +       +P +++ GS R+ ++  GD++G+   N+D L+ MPYGCGEQN+  + P+IY+L YL S     PA+  KA  ++  GY RQL YKH  G +S FG  ++  +TWLTAFV+++F  A +Y+ I+   +  A K+L   Q+S+GCF  +G LF++ M GG+     +D   +TAY+  SL  ++L  T   + K ++C    + +    Y  AL +Y  +L   +    Q +  QL   ++S     +W      S  + S+S  +E + Y +LA+     ++  DL  + + V WL  Q+N  GG+ STQDTVVAL ALA++A  +  S + +  V+V     +T++  +  +N+L+ Q  +L      Y S+  NGS C S+Q++  YNI       DT  LSV  KTE D  K     +I     Y+    ++NM++V I   SG+        + S     PL  R+D +   + +Y +    N   K   ++  I++   + NL+PAV+K+ DYY P   SE  YS
Sbjct:  685 VRKFFPETWIWQLVKVGDSGSAQVPVTVPDTITTWEMDTFCLSSRGVGVAPAAQLRVFQPFFLELSLPYSIIRGEEFELKATVFNYLSKC--IMVKVTPAPSSDYTLKASSSDEQYSSCLCANGRKTFRWTLVPSVLGVLNVTVSAAAEPSQTVCNNEIVSVPDRGRIDTVTRSLLVQAEGTEQTKSQSWLLCPQGNSVS--EELTLPEDVIEGSARASVSVLGDILGRALKNIDGLLKMPYGCGEQNIALLSPNIYILQYLESTEQLTPAIREKATGFLKSGYQRQLNYKHITGGYSTFGTGEE--NTWLTAFVMRTFGKAQRYIFIDPENINSAKKWLISKQKSNGCFVRQGSLFNNRMKGGV-----SDDVTMTAYITASL--LELGQTDPVVRKGLSCLKLFVNSRKTTYTTALLAYTFTLAGENEIRGQ-LLKQLDRSAISGDGRLHW----SQSASEDSDSLSVEISSYVLLAVLSTDKLSAADLGYANRIVSWLVRQQNPYGGFSSTQDTVVALQALALYATKV-YSPDGSSTVTVQSANKETHSFEVNQNNKLLYQEKSLQNVPGEY-SVIVNGSNCVSVQMALFYNIP---TPTDTSTLSVKAKTEGDCKKNPQTLSINFTVKYIGLLDSTNMVIVDIKILSGFTADPSTSGTRS---GMPLVERVDSKDDHVIMYINKILKN---KPLNYQLHIKQLLPVKNLKPAVIKVYDYYQPNDQSETEYS 1390          

HSP 2 Score: 85.8853 bits (211), Expect = 4.062e-16
Identity = 88/337 (26.11%), Postives = 141/337 (41.84%), Query Frame = 1
Query:  382 FINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEA-MNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLY-SYGKKKCVAFKSDLMKQNCNKIKLESKIV--FILASSFRYSKAKSQI------NVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRP-YYKPGLPYFGRINLVRHNKKPAKMVNISI-SIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
             + ETR++     N + F +TDKPIY PG    L F+   P   + E D++                     DN+ N             R+ QW NVS  +  + L +QLN +   G +  KA+   +     F +KKYVLPRF + V  P E    +E +   VC KY+ G+P++ K   + C  + S      + F  D     C + K +   V      S+F  ++ +  +       VTVTE GT  S+ K+ E   + Y    ++    P Y++ G    G+I ++  + KP    ++ +   Q W     W      T++  G+  F I
Sbjct:  110 LMAETRKVMFKSYNPLTFIQTDKPIYNPGQTGNLTFLHFVPK--ITEHDKV--------------------TDNNGN-------------RIGQWTNVSSTDLILELSHQLNSEAPEGQYTLKAITGDRSITHHFTVKKYVLPRFEITVNAPKEHSVGEEELKIDVCGKYTYGQPVSGKALILVCRPFKSRSPIYSIPFI-DPQTLLC-RTKTDGGCVSATFTVSTFTNTELEHHLKDFLDAKVTVTEEGTDISMVKS-ETISLTYQIGKVELLDLPKYFEYGTYIDGKIKVLTFSGKPVPHRSVYLFKHQMW----QWNEHLTLTTDINGLANFTI 404          
BLAST of Alpha-2-macroglobulin vs. Ensembl Cavefish
Match: ENSAMXT00000010848.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:15733307:15761838:1 gene:ENSAMXG00000010565.2 transcript:ENSAMXT00000010848.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 332.798 bits (852), Expect = 9.477e-93
Identity = 229/726 (31.54%), Postives = 382/726 (52.62%), Query Frame = 1
Query: 2650 IREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKS----FTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSV--KTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPL-NRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNP 4779
            +R++FPE+W++      +  +  + +TVPD++TTW  D++C++ +G+ +AP  +L+V  PF+  + +PYS+   E  +L   VFNY   C  I VK+    +    +   S    ++ C C N  KT  + L P ++G LNVT+ ++++ S      +   + +    D+V R +LV+  G     + S L+C +   +       +P +++ GS R+ ++  GD++G+   N+D L+ MPYGCGEQN+  + P+IY+L YL S     PA+  KA  ++  GY RQL YKH  G +S FG  ++  +TWLTAFV+++F  A +Y+ I+   +  A K+L   Q+S+GCF  +G LF++ M GG+     +D   +TAY+  SL  ++L  T   + K ++C    + +    Y  AL +Y  +L   +    Q +  QL   ++S     +W      S  + S+S  +E + Y +LA+     ++  DL  + + V WL  Q+N  GG+ STQDTVVAL ALA++A  +  S + +  V+V     +T++  +  +N+L+ Q  +L      Y S+  NGS C S+Q++  YNI       DT  LSV  KTE D  K     +I     Y+    ++NM++V I   SG+              S PL  R+D +   + +Y +    N   K   ++  I++   + NL+PAV+K+ DYY P
Sbjct:  673 VRKFFPETWIWQLVKVGDSGSAQVPVTVPDTITTWEMDTFCLSSRGVGVAPAAQLRVFQPFFLELSLPYSIIRGEEFELKATVFNYLSKC--IMVKVTPAPSSDYTLKASSSDEQYSSCLCANGRKTFRWTLVPSVLGVLNVTVSAAAEPSQTVCNNEIVSVPDRGRIDTVTRSLLVQAEGTEQTKSQSWLLCPQGNSVS--EELTLPEDVIEGSARASVSVLGDILGRALKNIDGLLKMPYGCGEQNIALLSPNIYILQYLESTEQLTPAIREKATGFLKSGYQRQLNYKHITGGYSTFGTGEE--NTWLTAFVMRTFGKAQRYIFIDPENINSAKKWLISKQKSNGCFVRQGSLFNNRMKGGV-----SDDVTMTAYITASL--LELGQTDPVVRKGLSCLKLFVNSRKTTYTTALLAYTFTLAGENEIRGQ-LLKQLDRSAISGDGRLHW----SQSASEDSDSLSVEISSYVLLAVLSTDKLSAADLGYANRIVSWLVRQQNPYGGFSSTQDTVVALQALALYATKV-YSPDGSSTVTVQSANKETHSFEVNQNNKLLYQEKSLQNVPGEY-SVIVNGSNCVSVQMALFYNIP---TPTDTSTLSVKAKTEGDCKKNPQTLSINFTVKYIGLLDSTNMVIVDIKILSGFTADPSTVS------SMPLVERVDSKDDHVIMYINKILKN---KPLNYQLHIKQLLPVKNLKPAVIKVYDYYQP 1366          

HSP 2 Score: 84.3445 bits (207), Expect = 1.306e-15
Identity = 90/346 (26.01%), Postives = 139/346 (40.17%), Query Frame = 1
Query:  382 FINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKN------DNDSNYFDLIIIETPDNVRVAQWKNVSINEA-MNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLY-SYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYS-----------KAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRP-YYKPGLPYFGRINLVRHNKKPAKMVNISI-SIQSWAYGNNWGFIRNYTSNKKGVIEFVI 1356
             + ETR++     N + F +TDKPIY PG  V  R                      V+  ++K I    K       DN+ N             R+ QW NVS  +  + L +QLN +   G +  KA+   +     F +KKYVLPRF + V  P E    +E +   VC KY+ G+P++ K   + C  + S      + F  D     C    LE      ++++F  S           K      VTVTE GT  S+ K+ E   + Y    ++    P Y++ G    G+I ++  + KP    ++ +   Q W     W      T++  G+  F I
Sbjct:   84 LMAETRKVMFKSYNPLTFIQTDKPIYNPGQTVNFR----------------------VVTMDSKLIPLEQKVRGIFNCDNNGN-------------RIGQWTNVSSTDLILELSHQLNSEAPEGQYTLKAITGDRSITHHFTVKKYVLPRFEITVNAPKEHSVGEEELKIDVCGKYTYGQPVSGKALILVCRPFKSRSPIYSIPF-IDPQTLLCRTKTLEMSDGGCVSATFTVSTFTNTELEHHLKDFLDAKVTVTEEGTDISMVKS-ETISLTYQIGKVELLDLPKYFEYGTYIDGKIKVLTFSGKPVPHRSVYLFKHQMW----QWNEHLTLTTDINGLANFTI 388          
BLAST of Alpha-2-macroglobulin vs. Ensembl Cavefish
Match: ENSAMXT00000005486.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:30175654:30201397:1 gene:ENSAMXG00000005291.2 transcript:ENSAMXT00000005486.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 318.546 bits (815), Expect = 3.577e-88
Identity = 259/930 (27.85%), Postives = 432/930 (46.45%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMP--KSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLS-TAGFTAITNARIVN-VKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKS--FTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLD-QSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQ-----DLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQIST-PLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYN 4776
            I +  +KNM P   V+ Y I  + E VAD+ + A  L   +Q+      F   T +P  ++ ++L   PG   + C+++  D +LL        D+ Y    L    + I  +        + CI +  ++    PI G         S   G   +TNA +   V C   +    PD +                        +  + IR YFPE+W++            +  TVPD++TTW A ++CM+  G  IAP  +L    PF+ ++ +PYS+   EVL L   VFNY   C  + V +   + +      +   +T C C ++  T  + ++   +GKL V    + + +  C  +          D+V + +LV+  G     T++EL+C   ++L             S     +L   GD+MG+   NL  L+ MPYGCGEQNM+   P+I++L YL S     P + +KA ++++ GY R+LTYKHDDGS+SAFG +D  G+TWLTAFV+KSF  A KY+ ++   + +A  +L   Q+ +GCF   G+LF S M GG+     +D   LTAY+  ++  ++L      + K++ C   N T     Y +AL SY  +L        +++   +LD Q++     ++W      +D +  +S ++E T Y +LA+++       DL      V WL+ Q+N+ GG+ STQDTVVAL ALA ++          +      + N      +   NRL+ Q  +L   + +Y S++  G+GC  +Q +  YNI    A   +F +                + V   Y      +NM+++ +   SG+ L E+     +   +   + R+D ++  + +Y D  +    G+   +   I ++T +  L+PAV+K+ DYY 
Sbjct:  493 IQLEHVKNMAPFAQVVVYTILPNGEAVADSRDFAVDLCLTNQV---SLIFPSPTELPGGQTSLILKAQPG---SLCSVKAIDRSLLLLKPEKELDIDYCDHTLSGYPYNIYDE------EPNPCISRPPIR---PPIIGYTVTISACSSQNIGIKILTNAEVRKPVDCSGPIFLAPPDVA-----------------------VQSDQTIRTYFPETWIWDLVPVGKSGIMGVKKTVPDTITTWSARAFCMSAVGFGIAPKAELTTFQPFFVSLTLPYSIIRGEVLPLKATVFNYLSGCIMVKVTL-AHSEQFTAQQCERCIYTRCLCADESWTFKWTVQASALGKLCVA--EALQTNVLCGSRSVTVPEKGRMDTVVQTLLVKAEGTKQTNTYNELLCMTGQKL-------------SPHFELHLLSTGDLMGRALKNLQSLLAMPYGCGEQNMLLFAPNIFILLYLESSGQLTPEIRSKATTFLVSGYQRELTYKHDDGSYSAFGMSDPSGNTWLTAFVMKSFSSAMKYIFVDQQYVDKAKDWLGLQQQENGCFASVGQLFHSDMKGGV-----SDELTLTAYITAAM--LELGTPDPVVEKSLTCLKSNFTQLNSTYSIALLSYAFTLAEDHQMRLESL--NILDEQAIVTAGGRHW---SRLNDGKTLDSLEVEMTSYVLLAILSGPQLQGFDLGYCASIVRWLAQQQNAFGGFASTQDTVVALQALAKYSAVTYSPAGTTVVTVTGPSGNTLTTFTVNQSNRLLVQESSLQQTSGNY-SIRAEGNGCVLVQFTLNYNIPPP-ANYLSFNIFANISAKCSDLIPSAELSVTVRYNGNRVETNMVIIEVRLLSGFRLDEKSLFLSNDTSAVGAIKRVDQKQDTVFIYLDGLT---RGEFKTYHLVILQQTVVQKLKPAVIKVYDYYQ 1351          

HSP 2 Score: 95.1301 bits (235), Expect = 6.087e-19
Identity = 100/441 (22.68%), Postives = 179/441 (40.59%), Query Frame = 1
Query:  382 FINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVS-INEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQ-FEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFC------MLYSYGKKK----CVAFKSDLMKQNCNKIKLESKIVFILASSFR----YSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPY-YKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVI-PYIPLAQSLSIQISEVSS-----NLKPPMAATTVYQSLTNFQSKDGHYLQFMPINDKFKC--PGKLNLTLLTNYDI-----ASTSIYVQIFSRGQIVK 1614
            F+N+T +I +     +   +TDKPIYKPG  V++R  ++                                    ++ F     + P++ R+ QW N S  +  ++L Y LN +   G +      +  E+I Q FEI +YVLP F V V  P  I   D   + KVC  Y+ GKP+N  +  + C        + Y  K     C  +     K  C    L  +   + A+ +           +    V  NGT S+         I  N  NI F+  P  ++ G+P+ G+I +   N  PAK  ++ + ++   Y ++        ++  G   F +   +  ++S+S+++SE        +++ P    + Y  +  F S+   +L+  P    F C  P  +N   + N ++      S + +  + S+G +V+
Sbjct:   84 FLNKTTKILITPPVRLTIIQTDKPIYKPGQTVKIRIASL------------------------------------TSSFQTYDQQDPNSNRIGQWLNQSTFSGILDLSYPLNSEAQHGFYIITVWNERNEQITQDFEINEYVLPTFEVIVQLPPVITILDTEATLKVCGNYTYGKPVNGSVIAVVCRKHYVWWWFGYDSKSNLDICKTYSMTTDKAGCGSAVLNLEEYALTATEYEDVINVEAQLEEAGTGVVLNGTGSTT--------ITINMLNINFEETPASFRLGMPFNGKIKVTGPNSVPAKDEHVYLIVR---YDDDKNVTWTLVTDANGTAPFSLNTALWGSKSVSLEVSESVEQYGYMSVRKP-TYFSAYLWVQPFYSESNCFLELQPSPRPFYCNKPAVVNARYIINSNVLTQCQKSMTFFYMVMSKGSMVQ 476          
BLAST of Alpha-2-macroglobulin vs. Ensembl Cavefish
Match: ENSAMXT00000010844.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:15710065:15729202:1 gene:ENSAMXG00000010515.2 transcript:ENSAMXT00000010844.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 307.375 bits (786), Expect = 1.556e-84
Identity = 221/752 (29.39%), Postives = 380/752 (50.53%), Query Frame = 1
Query: 2635 KMKKQIREYFPESWVFS---YFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKS----FTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQ-----SVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQC-----NIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYN-----DAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
            +  ++  E F   ++F+   + +  +  + +TVPD++TTW  D++C++ +G+ +AP  +L+V  PF+  + +PYS+   E  +L   VFNY   C  I VK+    +    +   S    ++ C C N  KT  + L P ++G LNVT+ ++++ S    + +   +      D+V R +LV+  G     + S L+C +   +       +P +++ GS R+ ++  GD++G+   N+D L+ MPYGCGEQN+  + P+IY+L YL S     PA+  KA  ++  GY RQL YKH +G++S FG     G+TWLTAFV+++F  A +Y+ I+   +  A K+L + Q  DGC+  +G+LF++ M GG+      D   +TAY+  SL  ++L +T   ++K ++C   +I +    +     +  L  YT S +    +  QLL +      V  GR  +W      S  + S+S  +E + Y +LA+     +++ DL  + + V WL  Q+N  GG+ STQDTVVAL ALA+++  +  S N +  V+V     +T++  +  +N+L+ Q  +L      Y S+   GS CAS+Q+S  YNI      N+   L ++ + D    C     ++ ++     Y  +  ++NM++V I   SG+                  N +     R    +                  ++  I++   + NL+PAV+K+ DYY P   SE  YS
Sbjct:  686 RFHRRYGERFDRLYMFALLFHSDSGSAQVPVTVPDTITTWEMDTFCLSSRGVGVAPAAQLRVFQPFFLELSLPYSIIRGEEFELKATVFNYLSKC--IMVKVTPAPSSDYTLKASSSDEQYSSCLCANGRKTFRWTLVPSVLGVLNVTVSAAAEASQTVCDNEIVSVPERGRIDTVTRSLLVQAEGTEKSKSQSWLLCPQGNSVSEELELTLPGDVIEGSARASVSVLGDILGRALQNIDGLLKMPYGCGEQNIALLSPNIYILQYLESTEQLTPAIREKATGFLKSGYQRQLNYKHYNGAYSTFGTGQ--GNTWLTAFVMRTFGKAQRYIFIDPENINSAKKWLLENQTPDGCYIRQGRLFNNRMKGGVN-----DNVTMTAYITASL--LELGHTDPVVSKGLSCIKSSIGDL--KHLKHTYASALLAYTFSLAGENEIRGQLLKKLDTVAIVGDGRL-HW----SRSATEDSDSLSVEISSYVLLAVLSTDKLSNADLGYANRIVSWLVRQQNPYGGFSSTQDTVVALQALALYSTKV-YSSNGSSTVTVQSADKETHSFEVNQNNKLLYQEKSLQNVPGKY-SVSVKGSTCASVQMSLFYNIP---TPNEVRTLGIEAKADG--NCTKSFGHVLSVNFTVKYNGKLNSTNMVIVDIKILSGFTGDP--------------NEVSISGKRFYCMFTVLCLMCVHQVPTNSPVHYQLHIKQVLPVKNLKPAVIKVYDYYQPSDQSETEYS 1398          

HSP 2 Score: 79.337 bits (194), Expect = 4.042e-14
Identity = 89/340 (26.18%), Postives = 139/340 (40.88%), Query Frame = 1
Query:  382 FINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVS-INEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKS-----DLMKQNCNKIKLESKIVFI---LASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIK----FDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWG--FIRNYTSNKKGVIEFVI 1356
             + ETR++       + F +TDKPIY PG KV  R + +   N +    E+ K    V D N        KN                  R+ QW NVS     + L +QLN +   G +  KA+ +       F +KKYVLP+F V +  P E    +E +  +VC KY+ G+P+        C        + V   S      L  +N     + +  VFI    A +FR S     I+VT+TE GT  S+ ++    G    +F +      D   +++      G+I +  H+ KP     + +       G +W    + N T++  G+  F I
Sbjct:  110 LMTETRKVVFKSYKPLTFIQTDKPIYNPGQKVNFRIVTM-NANFVPLRQEVSK----VFDSN--------KN------------------RIGQWTNVSSTGLILQLSHQLNSEASEGQYTLKAIIEDTWITHHFTVKKYVLPKFEVTLKAPKEHSVGEEELKIEVCGKYTFGQPVPGTALVQVCRKSRQRYFQGVQVVSPCLYETLTVENGCASHIYNMSVFIGSEFAHNFRESL---DIDVTMTEEGTGISMVQS----GRTEFTFVLGKAEFLDLPKHFERDTVIQGKIKVTTHSGKPIPNKEVYL-----LNGYSWQSKLLLNLTTDDNGLASFTI 406          
BLAST of Alpha-2-macroglobulin vs. Ensembl Cavefish
Match: ENSAMXT00000010840.2 (alpha-2-macroglobulin-like [Source:NCBI gene;Acc:103040601])

HSP 1 Score: 305.449 bits (781), Expect = 7.767e-84
Identity = 216/705 (30.64%), Postives = 361/705 (51.21%), Query Frame = 1
Query: 2383 LRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYF---NKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKS----FTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILAL-----INHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDS 4458
            +R+ +C+  K V+   +  YG  YDSR  ++  G   +  A  V    M Y +    D SY T                          +R++FPE+W++         +  + +TVPD++TTW  D++C++ +G+ +AP  +L+V  PF+  + +PYS+   E  +L   VFNY   C  I VK+    +    +   S    ++ C C N  KT  + L P ++G LNVT+ ++++ S    + +   + +    D+V R +LV+  G     + S L+C +   +       +P  +++GS R+ ++  GD++G+   N+D L+ MPYGCGEQN+  + P+IY+L YL +     PA+  KA  ++  GY RQL YKH +G++S FG+ +  G+TWLTAFVL++F  A +Y+ I+   + +  ++L   Q  DGCF  +G+LF++ M GG+      D   +TAY+  SL  +        + K ++C   ++   T  Y  AL +Y  SL   +    Q +  +L   ++S     +W      S  + S+S  +E + Y +LA+     +++ DL    + V WL  Q+N  GG+ STQDTVVAL ALA+++  +  S +    V+V     +T++  +  +N+L+ Q  +L      Y S+  NGS CAS+QL+  YNI      +    LSVK E D+
Sbjct:  676 VREPQCLVYKGVEYH-RGGYGWRYDSRVGMAGPGAPPVALAMGV---AMSYESEDS-DNSYET--------------------------VRKFFPETWIWQLAEVGGSGSAQVPVTVPDTITTWEMDTFCLSSRGVGVAPAAQLRVFQPFFLELSLPYSIIRGEEFELKATVFNYLSKC--IMVKVTPAPSSDYTLKASSSDEQYSSCLCANGRKTFRWTLVPSVLGVLNVTVSAAAEASQTVCDNEIVSVPDRGRIDTVTRSLLVKAEGTENSKSQSWLLCPQGNSVSEELELTLPENVIAGSARASVSVLGDILGRALKNIDGLLKMPYGCGEQNIALLSPNIYILQYLENTQQLTPAIREKATGFLKSGYQRQLNYKHFNGAYSTFGRGE--GNTWLTAFVLRTFGKAQRYIFIDPENIDQTKQWLISKQGPDGCFIRQGRLFNNRMKGGVN-----DNVTITAYITASLLELGHKAEDPLVIKGLSCLKSSLGTITNTYATALLAYTFSLAGENEIRGQ-LLKKLDGDAISGDGRLHW----SQSASEDSDSLSVEISSYVLLAVLSTDKLSNADLGYGNRIVSWLVRQQNPYGGFSSTQDTVVALQALALYSTKV-YSPDGFSTVTVQSADKETHSFEVNQNNKLLYQEKSLQNVPGKY-SVSVNGSTCASVQLALFYNIPTPIVPS---TLSVKVEADA 1330          

HSP 2 Score: 80.4925 bits (197), Expect = 1.858e-14
Identity = 82/334 (24.55%), Postives = 144/334 (43.11%), Query Frame = 1
Query:  385 INETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVS-INEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLE-SKIVFILA----SSFRYSKAKS-QINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPY-YKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWG--FIRNYTSNKKGVIEFVI 1356
            + E R++     N + F +TDKPIY PG  V  R + +            G  +  + ++ N      +  DN  N             R+ QW NVS     + L +QLN +   G +K +A+ + +     F +KKYVLPR+ + V  P E    +E +  +VC KY+ G+P+  K     C  +     + V   +  + +N    +   +  VF ++    S F ++   S  INV +TE GT  S+ K+ E   + Y     +F   P  ++      G+I +V +  +P +   + +       G +W    + N T++  G+ +F +
Sbjct:  112 MTEKRKVMFKSYNPLTFIQTDKPIYNPGQTVHFRVVTM------------GADLVPLEEEYNIL----TLADNKGN-------------RIGQWTNVSSTGLILQLSHQLNSEASEGQYKLEAITEDRSITHFFTVKKYVLPRYEITVKVPKEQSVGEEDLKIEVCGKYTYGQPVPGKARVEVCRKFERYYYEGVQMITPCLHENVEMDEDGCATHVFNMSLFSNSEFEHNFRDSLDINVVMTEEGTGISMVKS-ERTSVTYEIGKAEFLDLPKNFERDTVIEGKIKVVTYGGEPIRNKEVYL-----LKGPSWSPTLLLNLTTDDDGLAKFAV 410          
BLAST of Alpha-2-macroglobulin vs. Ensembl Sea Lamprey
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:ZFIN;Acc:ZDB-GENE-050208-428])

HSP 1 Score: 284.648 bits (727), Expect = 8.666e-78
Identity = 227/769 (29.52%), Postives = 377/769 (49.02%), Query Frame = 1
Query: 2632 AKMKKQIREYFPESWVFSYFNKTT---KHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANE--INVIGLKSFT--LCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXX--XXXXXINIAMSDSVRRQILVEPPGVPTETTFSELIC-------NKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKL-LTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKES----------SD--EQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVV---LNRNKTYNGLITLDNRLVSQTFNLGTENISYVS---MKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVK-TEIDSVKQCNIRN--------------IKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNP 4779
             +  K+ R +FPE+W++  FN        L + VPDS+T+W A++  ++  +GL +AP + L+   PF+ +  +PY++   E  ++P+ V NY   C E++VK+ V      +   G +  T  +C   ++ KT    L    +G+ N+T+      +   S   ++ + +    +D+  RQ+ ++  G+P E T+S   C       N NE        A+P  +V GS R+  +  GDVMG T +NLD L+ +P+GCGEQNM+   P+++VL YL         +  +A  Y++ GY RQLTYK  DGS+SAFG+ D  GS WLTAFVLKSF  +  ++ I+   L  A  ++   Q+ DG F   G++ +  + GGI       GK+ LTAYVL +L   G D       + +A      N+ +    Y  AL++Y L+L   S +       +L + +++    K+W     +          SD   Q   SA++E T YA+L      D++ ++  V WLS QRN+ GG+ STQDT VAL +L+ +A  +     VNL +S+    L+  +++   +  DN+ + QT  + ++N+ + +   +   G GC  +Q+   YN+    AA   F+L+V+ TE  S +    +N              +  C     +  +SNM ++ +   SG+    E  + + L     L R +    ++  Y+D          +C +F  + +  +    P  VKI DYY P
Sbjct:  752 GRADKRKRTFFPETWIWHCFNTRATGEARLQVEVPDSITSWVAEALAISPAQGLGLAPARSLRTFKPFFVDFTLPYALIRGEQAKVPLTVHNYMPLCAEVHVKVTVPKGVKFVGHHGKQHLTRKMCVEADETKTTSLVLSFAELGQTNITVMPVCSPACSASVCVRRGELLRGGGADAQGRQLRMQAEGMPREYTYSVFFCPNENTKGNHNEAF----TLAVPHSVVPGSERATASMIGDVMGPTLNNLDNLLKLPFGCGEQNMIHFAPNVFVLKYLQQTKQLVADVRTEATDYLLQGYQRQLTYKRQDGSYSAFGERDSSGSMWLTAFVLKSFAQSRAFIYIDPKELAAAKAWIINHQKEDGSFPAVGRILNKDIQGGIH------GKISLTAYVLAALMETGTDNEGEKTAVARAKMFLESNMYSAEDPYTTALSAYALTLLHSSYAPV--ALRRLNNVAITQDGLKHWSLSGTTVTNDDTFMGFSDGLSQSVVSAEVEMTAYALLTYTALGDVATALPIVKWLSQQRNAQGGFSSTQDTCVALQSLSEYA-ILSYIGGVNLTISLASTNLDFQESFE--LNKDNKKILQTATV-SQNVLFQTKSPICAKGEGCCLMQIDVSYNVPDP-AAKPAFQLTVELTEPRSTRAQIKKNKHGRHSCVHRCTCCVFTCACRWLQTGSSNMAVLEVPLLSGFRADVESLEQVLLDKKLGLKRYELDGRKVLFYFDEIPNQCM---TCVKFHADREYIVGQTAPVPVKIYDYYEP 1500          

HSP 2 Score: 79.7221 bits (195), Expect = 5.783e-15
Identity = 91/353 (25.78%), Postives = 145/353 (41.08%), Query Frame = 1
Query:  379 NFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVS--INEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKIS-GMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSF-----------NIKF--DGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTS---NKKGVIEFVIPYIP-LAQ 1377
            +F N T  I +  K   +  +TDKP+YKP  +V   F+ I P     E   I ++VE                         I+I+ P   R+ QW ++       MN+ + +++ PIFG W              FE++KYVLP+F V++  PS I   +     +V ++Y+ GKP+  K +  M      Y       ++ DL        +++    F +       K     NV     G  S  +  V   G K  +F           +IK+  + R  +KPGLPY G++ +   +  PA  V + I  +  A  N       YTS   ++ G++ F I  IP +AQ
Sbjct:  111 SFQNST-TITVEQKGSTVLIQTDKPVYKPKQRVLANFIIISP-----ELRPINEKVEA-----------------------YIVIQDPRGSRMVQWSDLHPICCGIMNVSFPISEQPIFGEWMIFVELHSHTYNKSFEVQKYVLPKFEVDISTPSFIRNLNVCDKARVRARYTFGKPVRGKATVNMTVNGVGY-------YRQDLGMPVLKTFEVDGAASFDIC-----VKDLMPPNVPEHFRGALSVWATVVASDGSKQITFDDSTLVHKQLVDIKYSRETRKQFKPGLPYHGKLEVTYPDGSPADGVTVRIKAELAAKDN------IYTSELVSRDGIVAFQIHSIPTMAQ 416          
BLAST of Alpha-2-macroglobulin vs. Ensembl Sea Lamprey
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:ZFIN;Acc:ZDB-GENE-050208-428])

HSP 1 Score: 280.796 bits (717), Expect = 9.462e-77
Identity = 225/767 (29.34%), Postives = 368/767 (47.98%), Query Frame = 1
Query: 2632 AKMKKQIREYFPESWVFSYFNKTT---KHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFE-----------INVKINVDANE--INVIGLKSFT--LCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILS---VFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKL-LTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFA-----QLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVV---LNRNKTYNGLITLDNRLVSQTFNLGTENIS-YVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVK-TEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACN 4827
             +  K+ R +FPE+W++  FN        L + VPDS+T+W A++  ++  +GL +AP + L+   PF+ +  +PY++   E  ++P+ V NY   C E           ++VK+ V      +   G +  T  +C   ++ KT    L    +G+ N+T+            ++   I + +S        ++  G+P E T+S   C   E  G  +     A+P  +V GS R+  +  GDVMG T +NLD L+ +P+GCGEQNM+   P+++VL YL         +  +A  Y++ GY RQLTYK  DGS+SAFG+ D  GS WLTAFVLKSF  +  ++ I+   L  A  ++   Q+ DG F   G++ +  + GGI       GK+ LTAYVL +L   G D                E +   + N   A   Y  +L   + +L  + +A     +L + +++    K+W     S   +   SA++E T YA+L      D++ ++  V WLS QRN+ GG+ STQDT VAL +L+ +A  +     VNL +S+    L+  +++   +  DN+ + QT  + +     +VS K  G GC  +Q+   YN+    AA   F+L+V+ TE   V +C    +  C     +  +SNM ++ +   SG+    E  + + L     L R +    ++  Y+D          +C +F  + +  +    P  VKI DYY P    +  Y + N  C 
Sbjct:  694 GRADKRKRTFFPETWIWHCFNTRATGEARLQVEVPDSITSWVAEALAISPAQGLGLAPARSLRTFKPFFVDFTLPYALIRGEQAKVPLTVHNYMPLCAETAFVVGLSIMQVHVKVTVPKGVKFVGHHGKQHLTRKMCVEADETKTTSLVLSFAELGQTNITV---CASRRTQRPQRMTVITVKLS--------MQAEGMPREYTYSVFFCPNEESDGNHNEAFTLAVPHSVVPGSERATASMIGDVMGPTLNNLDNLLKLPFGCGEQNMIHFAPNVFVLKYLQQTKQLVADVRTEATDYLLQGYQRQLTYKRQDGSYSAFGERDSSGSMWLTAFVLKSFAQSRAFIYIDPKELAAAKAWIINHQKEDGSFPAVGRILNKDIQGGIH------GKISLTAYVLAALMETGTD---------------NEVMVETSSNMYSAEDPYTTALSAYALTLLHSSYAPVALRRLNNVAITQDGLKHWSL---SGRARLVVSAEVEMTAYALLTYTALGDVATALPIVKWLSQQRNAQGGFSSTQDTCVALQSLSEYA-ILSYIGGVNLTISLASTNLDFQESFE--LNKDNKKILQTATIPSIPTGLFVSAK--GEGCCLMQIDVSYNVPDP-AAKPAFQLTVELTEHSCVHRCTC-CVFTCACRWLQTGSSNMAVLEVPLLSGFRADVESLEQVLLDKKLGLKRYELDGRKVLFYFDEIPNQCM---TCVKFHADREYIVGQTAPVPVKIYDYYEPGSSRDHQYKL-NITCG 1414          

HSP 2 Score: 75.8702 bits (185), Expect = 9.652e-14
Identity = 81/322 (25.16%), Postives = 130/322 (40.37%), Query Frame = 1
Query:  379 NFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVS--INEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKIS-GMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSF-----------NIKF--DGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGN 1296
            +F N T  I +  K   +  +TDKP+YKP  +V   F+ I P     E   I ++VE                         I+I+ P   R+ QW ++       MN+ + +++ PIFG W              FE++KYVLP+F V++  PS I   +     +V ++Y+ GKP+  K +  M      Y       ++ DL        +++    F +       K     NV     G  S  +  V   G K  +F           +IK+  + R  +KPGLPY G++ +   +  PA  V + I  +  A  N
Sbjct:   28 SFQNST-TITVEQKGSTVLIQTDKPVYKPKQRVLANFIIISP-----ELRPINEKVEA-----------------------YIVIQDPRGSRMVQWSDLHPICCGIMNVSFPISEQPIFGEWMIFVELHSHTYNKSFEVQKYVLPKFEVDISTPSFIRNLNVCDKARVRARYTFGKPVRGKATVNMTVNGVGY-------YRQDLGMPVLKTFEVDGAASFDIC-----VKDLMPPNVPEHFRGALSVWATVVASDGSKQITFDDSTLVHKQLVDIKYSRETRKQFKPGLPYHGKLEVTYPDGSPADGVTVRIKAELAAKDN 308          
BLAST of Alpha-2-macroglobulin vs. Ensembl Sea Lamprey
Match: cd109 (CD109 molecule [Source:ZFIN;Acc:ZDB-GENE-120215-253])

HSP 1 Score: 261.536 bits (667), Expect = 8.634e-71
Identity = 258/968 (26.65%), Postives = 422/968 (43.60%), Query Frame = 1
Query: 2062 GPDVHVIAYFINTDNEVVADAL--EIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHK---------CIPQKRVKRMIQPIYGLE--YDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFS---YFNKTTKHLNLTVPDSMTTWRADSYCMTEK-GLWIAPT-QKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKIN--------VDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSE-LICNKNEQLGILS---VFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYL-EKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKL-LTAYVLIS-LNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWP--FDKES------SDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVF-AKTIGVSQNVNLKVSVVLNRNKTYNGLITLD----NRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNI-------HRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYS 4806
             P  HV+ +++  D EVV  ++  ++A    N   L      +  + A P S V L V     E    + + D+++L                L+K  + IT DS    +              +P  R      P++ L    DS    + AG   +T+A + + +       G      + F      M+     V   + A   +++R  FPE+W+++        +K    TVPDS+T+W A ++ ++   GL +A T Q+L    PF+ ++ +PYS+   E   +   VFNY  T  ++ V ++        VD NE+  I  +     + + D  TV F + P ++G + +T+               +      +D++ +Q+LV+  GV  E +FS+ L+  ++    +     VF  PS +V GS R+ LT  GD+MG +   L++LV MPYGCGEQNM+   P+IYV+ YL +       +  +A S++  GY R+LTY+  DGSFSAFG  D  GSTWL+AFVL+ F  A  YV I+   + E   +L  ++  S G F E G++  + M GG      + G L LTAY L++ L           +        +     + N R+  T         S + ++    +L  +SV     KYWP   + ES        E +    D+      +L    H +   +++   W    R  L G  S  DTVV L AL+ F A+T G   N+ ++ +     +K   G ++      N LV Q   +    I+ V++   G+G A  QL+  YN+        R     D F+L++   I      N  ++ VC  +     +S M L+ +N  SG+    +  K         + R++    ++ LY D+ +    G   C   +      + + Q A V I DYY P   +E+SYS
Sbjct:  423 APSAHVVVHYVRDDGEVVPASVTFDVAGIFENKVVL-----NWTAEMATPASSVSLKVSASDAEAFVGVLVVDKSVL----------------LLKTGNDITADSVTSAVSAMASTSRGGPFDAVPWGR----FMPLFWLPNPSDSLSTFTEAGLVLLTDAYVHHPEFFLVYKEGESGAGASYFRPLGGAMNMM--PVATGAGAAPAERVRTLFPETWIWADGETGKNRSKTFTATVPDSITSWVASAFSVSSSLGLGVADTAQQLLAFQPFFVSLNLPYSVVRGEQFVVQALVFNYLDTDLQVRVTLDPSDAYVVLVDTNEVGAIPNEQLVTVRSQ-DAATVSFPVSPALLGLVPITV---------------RARAATAADAMTQQLLVKAEGV--ERSFSKTLLLQRSGGDAVTQGSLVFPFPSGVVEGSQRATLTIIGDIMGPSISGLERLVQMPYGCGEQNMINFAPNIYVIKYLTATGQGGGEIRQRALSFMNTGYQRELTYQRQDGSFSAFGNEDASGSTWLSAFVLRCFLQALPYVFIDPVVVAETHVWLMSQLNGSTGVFAEPGRVIHADMQGG------SSGPLSLTAYALVALLEQPSHMTAHKRVLTLTQSERDKRVIRSGNLRILSTVTYALSRKHSPTENERK-TRLCIRSVKLDSLKYWPERGNNESMLVQLRPHETRPPGKDVRKISRLLLLTSVHLNKKNNVQITKWNLQSRTRLEGQSSLLDTVVGLQALSEFAARTTGSRSNLQVRAT-----SKLLTGPLSFTVNSANALVLQRAEVKACEIN-VALSATGAGFAVAQLNVFYNLKMSGGRAKRSADQTDAFELTIDPHI---LDLNNVDVNVCVRW-AGTGSSGMALLQVNMLSGFVADSDFPKPQV------VKRVEVDGGKVNLYLDSLN----GTLVCVTIRSTRVQTVGSAQEAQVSITDYYEPRRRTERSYS 1318          

HSP 2 Score: 62.3882 bits (150), Expect = 1.227e-9
Identity = 93/435 (21.38%), Postives = 178/435 (40.92%), Query Frame = 1
Query:  382 FINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNV-SINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQ---FEIKKYVLPRFIVEVIPPSEILAKD-ESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVF---------ILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPY-YKPGLPYFGRINLVRHNKKP--------AKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQI--SEVSSNLKPPMAATTVYQSLTNFQSKDGHYLQFMPINDKFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIV 1611
            F+N +  I    +  ++F +TDK +YKPG  V  R  ++                              S   +    +D I I+ P   RV QW+ + S +  ++ ++ ++  P+ G W+   +  G++ + +   F + +YVLP+F V +  PS +  +D + +S  + +KY+ GK     + G   +    G  +   ++  L       +KL+    F         ++A SF       + +VT    G + S   +V+ P  +    +++F   P  +K GL Y   ++L   +  P          +V +S S  S A  ++W   +NYT    GV+      +P A S+ + +   +  +NL+    ++T          + G  +Q    N K +    L  ++ +   +     + Q+ SRG IV
Sbjct:   24 FVNSSTLI-FDSQALLLFVQTDKAVYKPGQTVHFRAFSV----------------------------DSSLRPHLGGAYD-IEIQDPVGNRVQQWRGLTSASGVVSADFPVSDQPLLGQWQI--IVHGEQGVDKEQPFTVAEYVLPKFEVLLKLPSFVAREDGQGVSGTIEAKYTYGK----LVRGNATVTLIIGNPRPWEWQPSL-NLTIRNLKLDGNAGFAFSSDEVKALVADSFVPDTYTIEAHVTELLTGITQSGGGSVKTPEYR---VDVQFVNSPLSFKAGLNYTAYVHLSLPDDSPLLPRDLESPLLVQVSQSNLSSALLSSWE--QNYTVPASGVVAVHFSVLPDADSVYVNVVYKQQKNNLQLNKESST----------RSGESIQLSSANSKAQAGEPLQFSVTSTEHV--EEFFYQVVSRGNIV 404          
BLAST of Alpha-2-macroglobulin vs. Ensembl Sea Lamprey
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:ZFIN;Acc:ZDB-GENE-050208-428])

HSP 1 Score: 202.986 bits (515), Expect = 1.922e-52
Identity = 183/625 (29.28%), Postives = 290/625 (46.40%), Query Frame = 1
Query: 3205 NKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKL-LTAYVLISL--NGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKES----------SD--EQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVV---LNRNKTYNGLITLDNRLVSQTFNLGTENIS-YVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIR------------------------------------NIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKSDEKEPGRPEVLLCPICVNDSINSTLKF 4914
            N NE        A+P  +V GS R+  +  GDVMG T +NLD L+ +P+GCGEQNM+   P+++VL YL         +  +A  Y++ GY RQLTYK  DGS+SAFG+ D  GS WLTAFVLKSF  +  ++ I+   L  A  ++   Q+ DG F   G++ +  + GGI       GK+ LTAYVL +L   G D       + +A      N+ +    Y  AL++Y L+L   S +       +L + +++    K+W     +          SD   Q   SA++E T YA+L      D++ ++  V WLS QRN+ GG+ STQDT VAL +L+ +A  +     VNL +S+    L+  +++   +  DN+ + QT  + +     +VS K  G GC  +Q+   YN+    AA   F+L+V  E+   ++ + R                                     ++VC  +L+   +SNM ++ +   SG+    E  + + L     L R +    ++  Y+D          +C +F  + +  +    P  VKI DYY P + + + Y   N + N    +E          +C   S N  L+ 
Sbjct: 1088 NHNEAF----TLAVPHSVVPGSERATASMIGDVMGPTLNNLDNLLKLPFGCGEQNMIHFAPNVFVLKYLQQTKQLVADVRTEATDYLLQGYQRQLTYKRQDGSYSAFGERDSSGSMWLTAFVLKSFAQSRAFIYIDPKELAAAKAWIINHQKEDGSFPAVGRILNKDIQGGIH------GKISLTAYVLAALMETGTDNEGEKTAVARAKMFLESNMYSAEDPYTTALSAYALTLLHSSYAPV--ALRRLNNVAITQDGLKHWSLSGTTVTNDDTFMGFSDGLSQSVVSAEVEMTAYALLTYTALGDVATALPIVKWLSQQRNAQGGFSSTQDTCVALQSLSEYA-ILSYIGGVNLTISLASTNLDFQESFE--LNKDNKKILQTATIPSIPTGLFVSAK--GEGCCLMQIDVSYNVPDP-AAKPAFQLTV--ELTEPQRPHSRRHPQPLPLPHPGSASGSSDNDDDDPAAHHDSKEYKVTLEVCARWLQTG-SSNMAVLEVPLLSGFRADVESLEQVLLDKKLGLKRYELDGRKVLFYFDEIPNQCM---TCVKFHADREYIVGQTAPVPVKIYDYYEPALEATRFY---NASANSPLARE----------LCEGKSCNELLQL 1675          

HSP 2 Score: 92.4337 bits (228), Expect = 9.359e-19
Identity = 101/435 (23.22%), Postives = 186/435 (42.76%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEA-LLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRK--HKCIPQKRVKRMIQPIYGLEYD----SRKVLSTAGFTAITNARIVNVKCMQ----YLARGMP---DRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTK----HLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANE--INVIGLKSFT--LCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMS--------------DSVRRQILVEPPGVPTETTFSELICNKNEQLGI 3228
            + IP+   M P   ++ Y +  + E VAD+++I    +  +++     + ++    P  KV + V        C   +     LL+ G   +       +K+ K   +  +    G  ++  H   P    +R    I+   +D    +R   + AG T +T+  IV +   Q    +     P     + A FS      + SR            K+ R +FPE+W++  FN +       L + VPDS+T+W A++  ++  +GL +AP + L+   PF+ +  +PY++   E  ++P+ V NY   C E++VK+ V      +   G +  T  +C   ++ KT    L    +G+ N+T  + +   + C E+  + +  A                D + R +LVE  G+P E T+S   C  NE++ I
Sbjct:  531 LRIPVTHAMVPSSRLLVYHVRANGEGVADSVQIPVKPSFENEV---SLELSQNETSPGDKVDIVVRAAKGSCACVAAVDKSVHLLKPGYQLS------TEKVFKELAEFDVSESYGTSKEDSHFWWPGISSRRRRSSIFPWHWDITKDTRFAFTEAGLTVMTD--IVRLNHRQNGGMFTEEAGPAFQPHTGAFFSATAHGRAASR----------ADKRKRTFFPETWIWHCFNTSAATGEARLQVEVPDSITSWVAEALAISPAQGLGLAPARSLRTFKPFFVDFTLPYALIRGEQAKVPLTVHNYMPLCAEVHVKVTVPKGVKFVGHHGKQHLTRKMCVEADETKTTSLVLSFAELGQTNITARAFAYGEASCCEEGAQTLKGAKYVEEVAPERRTPMGLDYIMRSVLVEAEGMPREYTYSVFFC-PNERIHI 943          

HSP 3 Score: 79.337 bits (194), Expect = 9.176e-15
Identity = 93/360 (25.83%), Postives = 147/360 (40.83%), Query Frame = 1
Query:  361 TKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVS--INEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKIS-GMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYS-KAKSQINVTVTENGTSSSVSKAVEGPGIKYNSF-----------NIKF--DGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTS---NKKGVIEFVIPYIP-LAQ 1377
            +K+   +F N T  I +  K   +  +TDKP+YKP  +V   F+ I P     E   I ++VE                           I  P   R+ QW ++       MN+ + +++ PIFG W              FE++KYVLP+F V++  PS I   +     +V ++Y+ GKP+  K +  M      Y       ++ DL        +++       A+SF    K     NV     G  S  +  V   G K  +F           +IK+  + R  +KPGLPY G++ +   +  PA  V + I  +  A  N       YTS   ++ G++ F I  IP +AQ
Sbjct:   79 SKSDAFSFQNST-TITVEQKGSTVLIQTDKPVYKPKQRVLANFIIISP-----ELRPINEKVEAY-------------------------IVDPRGSRMVQWSDLHPICCGIMNVSFPISEQPIFGEWMIFVELHSHTYNKSFEVQKYVLPKFEVDISTPSFIRNLNVCDKARVRARYTFGKPVRGKATVNMTVNGVGY-------YRQDLGMPVLKTFEVDG------AASFDICVKDLMPPNVPEHFRGALSVWATVVASDGSKQITFDDSTLVHKQLVDIKYSRETRKQFKPGLPYHGKLEVTYPDGSPADGVTVRIKAELAAKDN------IYTSELVSRDGIVAFQIHSIPTMAQ 388          
BLAST of Alpha-2-macroglobulin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004103.1 (pep scaffold:Pmarinus_7.0:GL476516:13600:100895:-1 gene:ENSPMAG00000003674.1 transcript:ENSPMAT00000004103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.022 bits (445), Expect = 1.167e-44
Identity = 194/817 (23.75%), Postives = 369/817 (45.17%), Query Frame = 1
Query: 2650 IREYFPESWVFSYFN--KTTKH--LNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKT---------VYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDN------LDKLVVMPYGCGEQNMVAVVPSIYVLDYLNS--------LNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKM-QRSDGCFEEKGKLFSSTMAGGIKRNDKADGKL-LTAYVLISLN------GVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSF---GRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGL-ITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYN-IHRLYAANDTFKLSVK-TEIDSVKQCNIR------------------------NIKVCFAYLRR----DKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKSDEKEPGRPEVLLCPICVND 4890
            +R YFP+SW ++ +    + KH  + L +PD++TTW   +  +++ +G+ +A    L     F+  +++PYS+K  E  ++ V ++NY      I  ++++      V  + S +    K  +K+         V F + P  IG+  ++I             + +       D V++ + V P GV    + S ++  +      +     P  + +  + ++++  GD + +T  N      +  L+ +P GCGEQNM+ + P+   L YL+S        LN +  A+      ++  GY+R+L+Y+  D S++AF  T    STWLTAFV+K +  A   + ++   L    +++ K  Q SDG + E   ++   M GG+      +G + +TA++LI +       G  + N   ++ +A+      ++     Y +A+T+Y L+L  P S  + + + + L+  V+F   GR +YW  D+ S   Q S +  +E T Y +L  + H+D   +   V WL+ QRN  GG+ STQ T++AL A+A +         +N+++ +   +N     + IT + R V +   +       +++K  G G  ++ + S++N +     +  TF L V  TE +  +    R                         + +C  Y  R     K S M ++ +N  +G+   + +   L   +   ++  +   + + +Y D      + ++ CF FKI++  +   +QP    + DYY+P+    + Y++            PG   V L P+C ND
Sbjct:  106 MRSYFPQSWGWNKYKIPASGKHPQIRLQLPDTITTWNMQAVSISKTRGVCLADPLLLVSTKDFFIKLHLPYSVKRGEQTEIRVILYNYMEESLTILTEMDI------VDSICSTSKSGAKPSQKSTVKAKGAMVVSFPIVPLKIGEHQISI-------------RSRVYGRTFGDGVQKVLRVAPEGVRDILSESRIVHVEERDTFFIKNEISPDIVPNSEVLTFISVKGDELAETMVNTLDAKSISHLIRIPLGCGEQNMIYMAPTTLTLIYLDSVQEWEKIGLNRREEAI-----EFLKQGYSRELSYRKADHSYAAFLNTP--SSTWLTAFVVKVYSLAKSIIIVDNKELCGPVEWVIKHRQNSDGSYREDAPVYHREMQGGV---GGLEGHVSMTAFILIGIQQAQEYCGGTVLNYQQSMNRAVQFLASKVSGLQRMYTIAITAYALALQDPGSEAAHSSWKK-LESRVTFELNGR-RYWKADEASHGLQMS-TISVEATAYGLLTYLQHKDHESARGVVDWLTEQRNYGGGFGSTQSTILALQAMAQYKMDSSSQIPINVQLEITSPKNNFEKKMKITEETRFVQEPHKIPPGG--NITVKALGKGTFTLSIMSVFNKVAPSSKSCSTFDLKVTMTESNDGESPQGRFGWFDGKRRRKRDIGDEGGVEAVYRMNLCTRYKPRKEDLSKESGMTIIEVNMLTGFLPDKNDLIQLKDSVDKYISYYEITDSVLIIYLDKVP---STENYCFAFKIKQMLRSDMIQPVTASVYDYYSPQDKCTRFYNL------------PG-GYVELSPLCQND 872          
BLAST of Alpha-2-macroglobulin vs. Ensembl Nematostella
Match: EDO33391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSB9])

HSP 1 Score: 215.312 bits (547), Expect = 1.321e-59
Identity = 173/581 (29.78%), Postives = 290/581 (49.91%), Query Frame = 1
Query: 3151 LVEPPGVPTETTFSELICNK------NEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL--NGVDLXXXXXXXXXXXXXXXEN-ITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFG-RYKYWPFDKESSDEQ-----KSNSADIETTGYAILALINHQDLSVS----MKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNK-TYNGLITLDNRLVSQTFNLG-------------TENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKT------RMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYN 4776
            + +P GV  E T+S  IC +      N+++ +    ++P+ IV GS+ + ++  GD+MG +   LD L+ +P GCGEQNMV   P+I+V+ YLNS       +S KA  Y+  GY RQLTYK  DGS+SAFG  DK GS WLTAFVL+SF  A +++ I+ +      +++ K Q+  GCF+  GKLF++ + GG+     +    LTA+V++SL   GV  ++  I        + +N +T++  N  LA    +         +++     + + + +FG  +++    K   + Q     +  S  IE T YA++ALI     S +    +  V WL+ QRN+LGG+ STQDT VAL AL+ +A  +   ++  +++ V  +  + ++   I+ +NRLV Q   +              + ++SY   +        +++S    +H+      TF  S     + +  C    + +C     ++  SNM ++     SG+++ EE            L R+ F ++      ++ LY+D        K  C RF IE+   + N +PA VK+ DYY+
Sbjct:    1 IFQPEGVRKEYTYSSFICPRDTAGMFNDKIEV----SLPTNIVDGSVHATVSAIGDLMGPSLSGLDGLLRLPTGCGEQNMVKFAPNIFVMQYLNSTRQMTDDVSTKAVGYLRTGYQRQLTYKRKDGSYSAFGDRDKEGSLWLTAFVLRSFAQARQFIFIDDNETNGTKEWIMKKQQETGCFQPHGKLFNNALKGGV-----STPVTLTAFVVVSLLEAGVAPSDPVITKAMKCISSKKNSVTDSYSNAILAFAHTIAGHADRDVYIARLKAKAIFEGTPTFGFGFRFLTPSKSIKNTQIIVFVRHASTKIEMTSYALMALIGDGSDSNAVADVLPVVRWLTQQRNALGGFSSTQDTCVALQALSRYAGHV-FGESTRMRIDVGFSGGQFSHQFRISDNNRLVLQRVVVSPYGNDNNRNDNDDSTDVSYNVFEVKEEPAFDLKVS----VHQ--RTGQTFTTSATETGEEL--CYPLELNIC----AKEDASNMAVIETKLVSGFKVDEES-----------LERVSFIQSYTLDGKKVVLYFDEVGI----KHVCVRFGIEQTNVVKNTKPASVKVYDYYD 544          
BLAST of Alpha-2-macroglobulin vs. Ensembl Nematostella
Match: EDO32956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STJ8])

HSP 1 Score: 181.415 bits (459), Expect = 3.509e-48
Identity = 109/345 (31.59%), Postives = 179/345 (51.88%), Query Frame = 1
Query: 2818 PFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDA-----NEINVIGLK--------SFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELI----------CNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTW--LTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL 3777
            PF+ ++ +PYS+   E + +   VFNY     E+ + +         NE++  G           + +    N+ + V F + PK +G + + + +                +++ +D+V+R ++VEP GV  E +++ L+            K +++ +L     PS           +  GD+MG +F NLD L+ MPYGCGEQNMV   P+I+VL YL ++    PA+  KA+ ++I GY R+ TY+H +GS+SAFG+ DK GS W  LTAFV+KSF  A KY+ I+   L ++  ++   Q   G F + G + SS + GG++         LTA+V+I+L
Sbjct:    3 PFFVSLDLPYSVIRGEEVAIKALVFNYLQQPQEVTITLKASKHWTIINELSPRGAPDQGEPKDTEYKMTVPANEGRAVSFPITPKTLGTIPIIVQAQ---------------SVSAADAVQRILIVEPEGVEQEYSYTVLVDLNQSKYDHVTEKRKKIYMLFFHEFPS----------FSCTGDIMGSSFSNLDNLLRMPYGCGEQNMVNFAPNIFVLKYLTAVKQLTPAIRNKAEVFMIKGYQREQTYRHPEGSYSAFGERDKEGSMWYVLTAFVVKSFAQARKYIYIDEKALDQSIFWMVSKQSPSGAFPKVGTVHSSYLKGGLQSEIA-----LTAFVVIAL 317          

HSP 2 Score: 73.9442 bits (180), Expect = 3.287e-13
Identity = 38/90 (42.22%), Postives = 59/90 (65.56%), Query Frame = 1
Query: 4015 KSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLD 4284
            +  SADIE T YA+LA+ +++D+   +  V WLS QRNSLGGY STQDTVV + A++ FA  I  S +++  V++    + T++   T++
Sbjct:  406 RPRSADIEITAYALLAIGHNKDVQTGLPVVRWLSQQRNSLGGYSSTQDTVVGIQAMSEFASFI-YSPSMDYTVTLTNTDDNTFSKTFTVN 494          
BLAST of Alpha-2-macroglobulin vs. Ensembl Nematostella
Match: EDO38193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDN3])

HSP 1 Score: 186.808 bits (473), Expect = 2.649e-47
Identity = 158/590 (26.78%), Postives = 274/590 (46.44%), Query Frame = 1
Query: 2035 ISIPLMKNMGPDVHVIAYFINTDNEVVADA--LEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPI-----YGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTK---HLNLTVPDSMTTWRADSYCMT-EKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIG----LKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELI-----CNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNL-----DKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKY--VNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIK 3723
            ++ P+   M P   V+AY++   NEVVAD+  +E+ +   N   L   +     K  +P S V + +     E G  +     ALL                         +D  + LLRK+  +  K+V + ++ +      G   DS  V + AG + I+N  +        L  G     Y      R + +K +N+ ++  D + + QIR+YFPE+W+F  +         L  T+PD++TTW   +  ++ E G  +    ++     F+  + +PYS +  E + +   VFNY     E+ V +  D    +  G     +  TL    ND  +V F + P  +G++ + I + ++ +    +           D+V + +LV P GV     +S +I      +  +Q+  +   A+P   V GS+ + L F G+++G    NL     + L+ +P GCGEQNM+ + P++Y+L +L++       + AKA   I  GY +QL ++  D SFSAFG++ + GSTWLTAFV+K F  A ++  V I+   ++++  +L   QR DG F E   +   ++ G +K
Sbjct:  601 LAFPVTLAMIPRARVLAYYVTHTNEVVADSALMEVENWFPNKVWL---QVPTPAKGHLPGSTVEVKLH---AEAGSRV-----ALL------------------------GVDESVYLLRKNSRLTAKQVFQAVRDLDLGCGVGPGKDSSHVFNNAGLSIISNNNLA-------LKFGHEIEVY------RERQTKEKNARVE-EDIENQGQIRKYFPETWIFDEYQTGLDGKLALRYTLPDTITTWAVQALAVSNETGFGVTELSRVTTFKNFFIALLLPYSAQRGEQISVKAAVFNYGEQESEVEVHLTGDPTYCSSSGPGASSQPITLRIAGNDAISVSFVVVPVRLGRIPIRIVAKARLAGSHGDDWTM-------DAVEKDLLVVPEGVERRVVYSLVIDPQDVTHDGKQISNVE-LAVPKGAVPGSIFASLYFTGNLIGSAVYNLMTGGVEHLLRIPIGCGEQNMITLAPNVYILAFLSNSKQVTAEIEAKAYRLIQQGYQQQLGFRRKDKSFSAFGES-RPGSTWLTAFVIKVFCTAKRFDGVAIDNDLIRDSITWLLANQREDGAFPEVMDVVHVSLMGSLK 1132          

HSP 2 Score: 83.5741 bits (205), Expect = 7.990e-16
Identity = 77/314 (24.52%), Postives = 127/314 (40.45%), Query Frame = 1
Query:  382 FINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAM-NLEYQLNKDPIFGIWKAKAVFDG----QEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFR---YSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNI-KFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGN 1296
            FI ETR + +  ++ ++  + DKPIY P   V++R + +         D   + +++ +D                     II++ P  +R   W+ +S    + +    L    + G W   +   G        + FE+K+YVLPRF V +I P  IL K  SI   V SKY+ GK     ++    +  + G    + F S   K    K  L+    FI     R       + QI   V E  T    S            F++   D   ++KPGLP+  +I +   NK+PA+ + + +S     + N
Sbjct:  120 FIRETRVL-ISYRSMMLLVQIDKPIYTPSQTVKMRVIPL---------DFDLQSLKVKVD---------------------IIVKNPQGIRTQNWQKLSSEHGIISKALSLGPRAMLGNWTIISYHHGYGNKTNTTVHFEVKQYVLPRFSVRIIGPDYILPKTRSIKIAVISKYTYGKAAQGSVTVRLSV--TGGGSPSIRFYSTTEKLIDGKSTLDVDSGFIKKHPSRPWFPDGRRLQIECDVIEEATGMRESAVDNSVYFVSTPFHVTTADTALFFKPGLPFVVKIAIHYPNKQPARGIPVDVSAMGKKHNN 400          
BLAST of Alpha-2-macroglobulin vs. Ensembl Nematostella
Match: EDO33393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSC1])

HSP 1 Score: 159.073 bits (401), Expect = 1.455e-43
Identity = 79/179 (44.13%), Postives = 115/179 (64.25%), Query Frame = 1
Query: 3241 AIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISL 3777
            ++P+ IV GS+ + ++  GD+MG +   LD L+ +P GCGEQNMV   P+I+V+ YLNS       +S KA  Y+  GY RQLTYK  DGS+SAFG  DK GS WLTAFVL+SF  A +++ I+ +      +++ K Q+  GCF+  GKLF++ + GG+     +    LTA+V++SL
Sbjct:   32 SLPTNIVDGSVHATVSAIGDLMGPSLSGLDGLLRLPTGCGEQNMVKFAPNIFVMQYLNSTRQMTDDVSTKAVGYLRTGYQRQLTYKRKDGSYSAFGDRDKEGSLWLTAFVLRSFAQARQFIFIDDNETNGTKEWIMKKQQETGCFQPHGKLFNNALKGGV-----STPVTLTAFVVVSL 205          
BLAST of Alpha-2-macroglobulin vs. Ensembl Nematostella
Match: EDO33392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSC0])

HSP 1 Score: 82.0333 bits (201), Expect = 5.911e-18
Identity = 45/141 (31.91%), Postives = 79/141 (56.03%), Query Frame = 1
Query: 2644 KQIREYFPESWVFSYFN----KTTKHLNLTVPDSMTTWRADSYCMTE-KGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKI-NVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKL 3048
            +++R+ FPE+W+++  N       K +   VPD++T+W A ++ M+   G+ +AP+  L V  PF+ +  +PYS+   E + + V VFNY   C  I + +   D  E++    +S  +C C N+ K+V F L PK +G +
Sbjct:    1 ERVRKNFPETWLWTEENVNNVTGEKVITAQVPDTITSWYASAFAMSSTHGIGVAPSSSLTVFKPFFVSFTLPYSVIRGERVSVIVSVFNYLSQCLTIRINLAKSDFFELHSADNRS--VCVCGNEAKSVQFTLTPKKLGPM 139          
BLAST of Alpha-2-macroglobulin vs. Ensembl Medaka
Match: ENSORLT00000030023.1 (alpha-2-macroglobulin-like protein 1 [Source:NCBI gene;Acc:101161539])

HSP 1 Score: 369.007 bits (946), Expect = 2.060e-104
Identity = 285/954 (29.87%), Postives = 466/954 (48.85%), Query Frame = 1
Query: 2035 ISIPL--MKNMGPDVHVIAYFINTDNEVVADA--LEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRM-IQPIYGLEYDSRKVLSTAGFTAITNA-RIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVF---SYFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKI-NVDANEI-NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQD-----LSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFA-KTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNI-RNIKVCFAYLR---RDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNK 4830
            I IPL  + ++ P   V+ Y I +  EVVAD+    I   LNN   L     KF+    +P +K  LT+      + C++R  D+++L         + Y+  +L  +      D ++     + C P+   + + ++P +       K  S   F    +   I  V     LA+       A  +    QMS   N+ ++ SD + K+ +R YFPE+W++   S  +  +  L  TVPD++T W A ++C++  G  +AP   L    PF+ ++ +PYS+   EV  L   VFNY   C  +   + N D     N  G    ++C C  + KT  + + P  +G + + + + ++ S+    K    +  +   D+V   +LVE  GVP   + + L+C        +S+  +P + V+GS R+ ++  GD+MG+   NLDKL+ MPYGCGEQNM+   P+I++LDYL S      +    A  Y+  GY R+L YKHDDGS+SAFG +D  G+TWLT FV+KSF+ A +Y+ ++   +KEA K+L  +Q+ DGC +  GKLF S M GG+     +D   LTAYV  ++  +D   T   +   + C    + +   N                  +   +F  L  +S + G  ++W   ++ + E   +S ++E T Y +LAL++        L  +   V WL+ Q+N  GG+ STQDTVVAL ALA +A  T     +  + V+ V   NK +   +  DNRL+ Q   L TE     +++  G  C   Q+S  YNI    +    F++S  T      +C+I R   + F ++    R + +NM+++ I   SG+ L +   K L    +  + R+D ++  + +Y D       G+   F   +EE  ++ NL+PAVVK+ DYY     S+++ + +   CNK
Sbjct:  479 IKIPLTNVIDLAPIAQVVVYTIVSSGEVVADSRDFPIQLCLNNKVSL-----KFSAVQELPGAKTTLTLR-AQPSSLCSVRAIDQSVLLLKSEEELTVDYVYNQL-PIKKMSGYDYQVEDNSFNPCFPRPWPRPIPLEPEFQPRGRRDKRASIFPFYEGDDVYTIFKVNYFTSLAK-------ADLAPAPEQMSS--NTDVQPSDTQKKETVRTYFPETWIWDLVSVGSNGSTSLVKTVPDTITKWAAGAFCVSPAGFGVAPNVGLTAFQPFFVSLTLPYSVVRGEVFTLKATVFNYLPKCIMVKATLANSDQFTFKNCDGCVYSSVCLCAEESKTFSWIVTPTALGDVTLKVSAEAEKSNKKCGKGVVTVPTVGQVDTVITTLLVEAEGVPQMVSHNALLCPARPVSKNISL-ELPEDFVNGSERASVSVVGDLMGRAMKNLDKLLAMPYGCGEQNMLLFAPNIFILDYLKSTGQLKESTRKTAVGYLESGYQRELNYKHDDGSYSAFGMSDPSGNTWLTTFVMKSFNAAKQYIFVDQMYIKEARKWLSGLQKPDGCIQSVGKLFHSGMKGGV-----SDDVSLTAYVAAAMLELDGNATDTVVQNCLECVKTAVADEITNLYTVALLSYTFTLAGDQDVRSKLFTLLDQKSTNEGGTRHW--KRDDAPETGLDSVEVEMTSYVLLALLSGPSLPGFGLDYAAGIVRWLAQQQNPFGGFSSTQDTVVALQALAKYATATFSPEGSTTVTVTSVGGLNKRFT--VNEDNRLLYQEEKL-TEIPGEYTIEAEGQSCVLAQISLFYNIPPP-SDFSAFQISTNTS----GRCDIPRPEFMLFVHVEFQGRREETNMVVINIKLLSGYILQDNSLKMLKE--NRLVKRVDVEEGYINIYLDGLK---KGQKETFDVILEEDQQVGNLKPAVVKVYDYYQT---SDEAVTDYTSPCNK 1392          

HSP 2 Score: 70.4774 bits (171), Expect = 2.203e-11
Identity = 73/292 (25.00%), Postives = 126/292 (43.15%), Query Frame = 1
Query:  424 FIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEA-MNLEYQLNKDPIFGIWKAKAVFDGQEEI-IQFEIKKYVLPRFIVEVIPPSEILAKDESI-SFKVCSKYSTGKPMNAKISGMFC------MLYSYGKKK--CVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRP-YYKPGLPYFGRINLVRHNKKPAKMVNI 1263
            F+   +TDKPIYKPG  V+ R +++  TN M     + + V  +LD                          P++ R+AQW + +++   ++L +    +   GI+   A  D  E I   FEIK+YVLP+F V V  PS I   D+ +    +  +Y+ GKP+   +   FC      + +S  ++K  C  F+    K  C    +E     + +  F   +   ++   + E GT   + K             I F+  P  +KPGLP  G++ ++   +   +++ I
Sbjct:   93 FVHIVQTDKPIYKPGQTVQFRIVSM-DTNFM----PVNRTVCFLLD--------------------------PNSNRIAQWLDKNVDGGILDLSHPTIPEAAQGIYVISAETDEGETISYNFEIKEYVLPKFEVTVNLPSVITILDKELCPCALSCRYTYGKPVVGSVKAEFCRRSYQFIWFSLSEQKDICKTFQLTTDKSGCATQTVELADFALDSYGF---QDTFEVTTELEEFGT-GVILKGSGSASFTTQIRTISFEDVPSSFKPGLPLNGKVIVLIKIRNDNRIIQI 349          
BLAST of Alpha-2-macroglobulin vs. Ensembl Medaka
Match: ENSORLT00000001261.2 (alpha-2-macroglobulin-like protein 1 [Source:NCBI gene;Acc:101161037])

HSP 1 Score: 345.125 bits (884), Expect = 1.223e-96
Identity = 276/967 (28.54%), Postives = 459/967 (47.47%), Query Frame = 1
Query: 2035 ISIPLMK--NMGPDVHVIAYFINTDNEVVADALE--IASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYL-----VQKLIKLNHKITLDS----------RIGLLRKHKCIPQKRVKR-MIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKH---LNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEI----NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQD-----LSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFA-KTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNI-RNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNK 4830
            I IPL    N+ P   V+ Y I +  EVVAD+ +  I   LNN   L     KF+    +P +K  LT+      + C++R  D+++L         + Y+     ++K+   ++++  DS          R   L     + ++R KR  I P Y  E D    +      AI  A + +V     +   +P  +                      + +  + IR YFPE+W++   +  +     L  TVPD++T W A ++C++  G  +AP   L    PF+ ++ +PYS+   EV  L   VFNY   C  I VK  +  ++     N  G    ++C C  + KT  + + P  +G + + + + ++ S+     +   +  +   D+V   +LVE  GVP   + + L+C        +S+  +P + V+GS R+ ++  GD+MG+   NLDKL+ MPYGCGEQNM+   P+I++LDYL S      +    A  Y+  GY R+L YK DDGS+SAFG +D  G+TWLT FV+KSF+ A +Y+ ++ + +++A  +L  +Q+ DGC +  GKLF + M GG+     +D   LTAYV  ++  +D   T   +   + C    ++    N                  +   +   L  +S++ G  ++W   ++ + E   +S ++E T Y +LAL++        L  +   V WL+ Q+N  GG+ STQDTVVAL ALA +A  T     +  + V+ V   NK +   +  +NRL+ Q   L TE     ++K  G  C   Q+S  YNI    +    F++S  T      +C+I R     F +  R + +NM+++ I   S   L   + K   L     + R+D ++  + +Y D       G+   F   +E+  ++ NL+PAVVK+ DYY     S+++ + +   CNK
Sbjct:  497 IKIPLTNVINLAPIAQVVVYTIVSSGEVVADSRDFPIQLCLNNKVSL-----KFSAVQELPGAKTTLTLR-AQPSSLCSVRAIDQSVLLLKSEEELTVDYVYNQLPIKKMWGYDYQVEDDSSNPCFPRPWPRPIPLEPEILLRERRDKRSRILPFY--EGDDVYTIFKVKPLAINAANLESV-----MNEPVPAPA---------------------PEGQKTETIRTYFPETWIWDLVSVGSSGSTSLVKTVPDTITKWAAGAFCVSPAGFGVAPNVGLTAFQPFFVSLTLPYSVVRGEVFTLKATVFNYLPKC--IMVKATLAKSDQFTFKNCDGCVYSSVCLCAEESKTFSWIVTPTALGDVTLKVSAEAERSNKKCGTEVVTVPTVGHVDTVITTLLVEAEGVPQMVSHNALLCPARPVSKKISL-ELPEDFVNGSERASVSVVGDLMGRAMKNLDKLLAMPYGCGEQNMLLFAPNIFILDYLKSTGQLKESTRKMAVGYLESGYQRELNYKRDDGSYSAFGMSDPSGNTWLTTFVMKSFNAAKQYIFVDQTYIEDARTWLSGLQKPDGCIQSVGKLFHNGMKGGV-----SDDVSLTAYVAAAMLELDGNATNPVVQNCLKCLRTAVSGKITNLYTVALLSYTFTLAGDQDMRSKLITLLDQKSINEGGTRHW--KRDGAPETDLDSVEVEMTSYVLLALLSGPSLPGFGLDYAAGIVRWLAQQQNPFGGFSSTQDTVVALQALAKYATATFSPEGSTTVTVTSVGGLNKRFT--VNKNNRLLYQEEKL-TEIPGEYTIKAEGQSCVLAQISLFYNIPPP-SDFSAFEISTNTR----GRCDIPRPEFTLFVFQGRREETNMVVINIKLLSACVLFVSQLKENRL-----VKRVDVEEGYINIYLDGLK---KGQKETFNVILEKDQQVGNLKPAVVKVYDYYQ---TSDEAVTDYTSPCNK 1400          

HSP 2 Score: 91.2781 bits (225), Expect = 8.053e-18
Identity = 100/392 (25.51%), Postives = 166/392 (42.35%), Query Frame = 1
Query:  175 IVLTIESIHDPSQIKHQSSKFVIKKGFQTIPYYVPFVGSHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEA-MNLEYQLNKDPIFGIWKAKAVFDGQEEIIQ-FEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFC-----MLYSYGKKK---CVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRP-YYKPGLPYFGRINLVRHNKKP----AKMVNISISIQSWAYGNNWG 1305
            + +T++     ++I   S K  I + FQ   + VP V S   + I + I G +               + +N+  ++ +    F+   +TDKPIYKPG  V+ R +++  TN +     +G  + ++            K D +SN             R+AQW + SI+   ++L +    +   GI+   A  D  E I   FEIK+YVLP+F V V  PS I   D+ ++ K+C KY+ GKP+   +   FC       +    K+   C  F+    K  C    +      I A ++  S    ++   + E GT   + KA            + F+  P  YKPGLP  G+I +   +  P    A  + +  S++S  Y +  G
Sbjct:   41 LTITLDVDSSSTKIGQLSFKTEIYRCFQ---FLVPIVSSTTVASISVKIQGKM---------------DSLNQETKVLIEPPAFVHIVQTDKPIYKPGQTVQFRIVSM-DTNFIPVNRMVGFYIHVL------------KQDPNSN-------------RIAQWLDKSIDGGILDLSHPTIPEAAQGIYVISAETDKGETISHNFEIKEYVLPKFEVTVNLPSVITILDDEVTLKICGKYTYGKPVLGSVKAEFCRRANQFFWLPPPKQDDICKTFELSTDKSGCATQNVALAGFAINAYNYFDS---FEVTAELEEFGT-GVILKASGSASFTTQIRTVSFEDVPSSYKPGLPLKGKIKVTGADGSPIANQAVYLYVVDSLESTLYTDQKG 384          
BLAST of Alpha-2-macroglobulin vs. Ensembl Medaka
Match: ENSORLT00000012489.2 (alpha-2-macroglobulin-like protein 1 [Source:NCBI gene;Acc:101159604])

HSP 1 Score: 343.969 bits (881), Expect = 4.848e-96
Identity = 273/973 (28.06%), Postives = 477/973 (49.02%), Query Frame = 1
Query: 2056 NMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMP--KSKVVLTVDPGVKENGCAIRIADEALL--QFGQSSNADLSYLVQKLIK--LNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIY------GLEYDSRKVLSTAGFTAITNARIVNVKCMQYLAR----GMPDRS--YATFSNERTQMSK----------------SRNSVLKISDAKMK--KQIREYFPESWVFSYFN------KTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDAN-EINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALIN----HQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAK---TIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEID-SVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPL-NRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFN 4815
            +M P V ++ Y I    E +A  + +++G  +C +      +F+  +A+P  ++++ LT  P   ++ C +   D+++L  + G + +AD  Y +  L +  + ++I            +C+P  R KR I P Y      G + D+  +   AG    TN  +    C+++  R    GM      Y    N    MS+                +  SV    DA  +  + +R +FPE+W++          KT  H   TVPD++TTW  +++C++ +G  +AP QK+ V  PF+  + +PYS+   E  +L   VFNY  +C  + V     ++  +  +    +T C C N+ KT+ +NL    +G +NVT+ + +  S    + +  K+      D V + ++V+  GV     ++ L+C     L   +   +P  ++ GS R  ++  GD++G+   NLD L+ MPYGCGEQNM  + P IY+L YL S     P ++ K   ++  GY RQL YK  +G+++ FG     G+TWLTAFVL+SF+ A  ++ I+   +KE+ ++LE  Q  +GCFE+ GKLF++ M GG+     +D   L+AY+  +   + ++     + K++ C   ++++ +  Y        +           ++  QL + ++  G + +W      +  +KS+S  +E T Y ++A +      +DL  +   V WLS Q+N  GG+ STQDTVVAL ALA+++    T G S  V L+     +   T++  +  DN+L+ Q   L     SY +++  GS CAS+Q+S  YNI      N T  + V  E D S K+  +  +K+   Y  ++ N+NM+++ I   SG+  + +   S+      PL +R++ +   + +Y              +   +E++  + NL+PAVV + DYY P   +E  Y+  N
Sbjct:  540 DMAPTVQIVVYAILPSQEFIAHYVSLSTG--DCFK-NEVSVEFSPSSAVPGEEAEMQLTAHP---DSLCGVSAIDQSVLIKEPGGTLDADKIYNLLPLRRTYIPYEIQ--------EVPECLP-VRPKRYISPDYIHPPNIG-QSDAYSMFQNAGLKVATNLILQVPTCLKFKGRMYHTGMAGGIGLYRDGLNGPPLMSRMGAPPGLPGAVGAAPEAMASVAYDYDAGPEPVETVRTFFPETWIWDLVEVGESGKKTVAH---TVPDTITTWETETFCLSSQGFGLAPRQKITVFQPFFLELTLPYSIIRGENFELKATVFNYLSSCIMVEVTPTPSSDYTLTALSSDQYTSCLCGNERKTLRWNLASIALGVMNVTVSAEAVPSHASCDNEIVKVPERGRIDKVTKSLIVKAEGVEVTKAYNWLLCPNGNTLTETTEIQLPDNVIEGSARGTVSVLGDILGRALKNLDGLLQMPYGCGEQNMALLAPDIYILHYLKSTKQLTPEINEKVSQFLKSGYQRQLNYKDSEGAYTTFGSGP--GNTWLTAFVLRSFYKAQSFIYIDEEKIKESRRWLEGKQMQNGCFEQSGKLFNNRMKGGV-----SDEVTLSAYITAAFLEMKISPNDHVLNKSLLCLKSSLSDLSNTY-TTALLAYVFTLAEDMETRDHLLKQLDNSAIREGGFLHW----SQTGTEKSDSLSVEITSYVLMAKLGASPTSEDLGYASSIVRWLSGQQNYYGGFSSTQDTVVALQALALYSSLVFTPGGSSTVTLQSP---SGQLTFH--VNPDNKLLYQESVLQKMTGSY-NLEVKGSACASVQISLFYNIPTPQETN-TLSIKVLPEADLSTKKPRVI-LKLNSLYTGKETNTNMVIIDITILSGFVPNVKSLDSIK---KAPLVDRVEHKDGHVLVYLRELVKELPMN---YSLVLEQQHVVQNLKPAVVTLYDYYQPSERAEAEYTFQN 1467          

HSP 2 Score: 66.6254 bits (161), Expect = 2.707e-10
Identity = 75/301 (24.92%), Postives = 124/301 (41.20%), Query Frame = 1
Query:  433 FAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKN-VSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFC---MLYSYGKKKCVAFKSDLMKQNC-NKIKLESK-----IVFILASSFRYS----KAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRP-YYKPGLPYFGRINLVRHNKKP-AKMVNISISIQSWA 1287
            F +TDKPIY PG  V  R  A+                              SK    S  F++I ++ P   R+ QW N  S  + + L Y L+ +   G+ +        +    F+++KYVLP+F V +    E+    E I+ +VC+KY+ G+P+   IS   C     + YG        S ++ + C  KIK   K     + F +++  R      + + ++   V E GT  S+ +A +   + Y    + F   P  Y       G++  V +N  P A M    +S + W+
Sbjct:  128 FVQTDKPIYLPGQMVNFRVFAL-----------------------------DSKLRPASLLFNVIELQDPHGNRIGQWLNETSDGKILALSYSLSSEAREGVHQIVLSVGDDKISHSFKVEKYVLPKFEVTLNVKEEVSIGQEEITAEVCAKYTFGQPVPGTISVKMCRPSQPFYYGVTVKKEDGSPVITEPCVGKIKQTDKSGCTTLEFSMSTFTRMDAKILRDELKVEALVEEEGTEISLGQA-KTIQLSYVIGKLSFTDTPKLYNQNSTLEGKVKAVYYNDTPIAGMQLHVLSGRMWS 398          
BLAST of Alpha-2-macroglobulin vs. Ensembl Medaka
Match: ENSORLT00000000908.2 (pep primary_assembly:ASM223467v1:2:10066528:10081498:1 gene:ENSORLG00000025635.1 transcript:ENSORLT00000000908.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 339.732 bits (870), Expect = 6.152e-95
Identity = 264/956 (27.62%), Postives = 459/956 (48.01%), Query Frame = 1
Query: 2020 IFERIISIPL--MKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKH---LNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEI---NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQD-----LSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFA-KTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNI-RNIKVCFAYLR---RDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNK 4830
            + +  I IPL  + ++ P   V+ Y + +  EVVAD+ +    L  C  L      F+    +P +K  LT+      + C++R  D+++L         + Y+  +L  +      D ++     + C  +   + +      L    R  +S        N      K   ++       + +T+  E   M    +      + +  + IR YFPE+W++   +  +     L  +VPD++T W A ++C++  G  +AP  +L    PF+ ++ +PYS+   EV  L   VFNY   C  +   + V +++    N  G    ++C C  + KT  + + P  +G + + + + ++ S+     +   +  +   D+V   +LVE  GVP   + + L+C        +S+  +P + V+GS R+ ++  GD+MG+   NLDKL+ MPYGCGEQNM+   P+I++LDYL S      +    A  Y+  GY R+L+YK  DGS+S FG +D+ G+TWLT FV+KSF+ A +Y+ ++ + +++A  +L  +Q+ DGC +  GKLF + M GG+  ND +    LTAYV  ++  +D   T   +   + C    ++    N                  +   +   L  +S++ G  ++W   ++ + E   +S ++E T Y +LAL++        L  +   VYWL+ Q+N  GG+ STQDTVVAL ALA +A  T  +  +  + V+ V   NK +   +  DNRL+ Q   L TE     ++K  G  C   Q+S  YNI    +    F++S  T      +C+I R   + F ++    R + +NM+++ I   SG+ L +   K      S  + R+D ++  + +Y D       G+   F   +EE  ++ NL+PAVVK+ DYY     S+++ + +   CNK
Sbjct:  472 VIKGTIKIPLANVTDLAPIAQVVVYTMISSGEVVADSRDFPIQL--C--LNNKVLNFSAVQELPGAKTTLTLR-ARSGSLCSVRAIDQSVLLLKSEEELTVDYVYNQL-PIKKMWGYDYQVKDHPFNHCFSRPWPRPIPLEPALLPRGRRDTVSHHSPFKKGNDVYTIFKVNGFIVFFC---ALSTWPLEIFGMQSGMSMPAPAPEGEKTETIRTYFPETWIWDLVSVGSSGSTSLVKSVPDTITKWAAGAFCVSPAGFGVAPNVRLTAFQPFFVSLTLPYSVVRGEVFTLKATVFNYLPKCIMVKATL-VKSDQFTFKNCDGCVYSSVCLCAEESKTFSWIVTPTALGDVTLKVSAEAEKSNKKCGTEVVTVPTMGQVDTVITTLLVEAEGVPQMVSHNALLCPARPVSKKISL-ELPEDFVNGSERASVSVVGDLMGRAMKNLDKLLAMPYGCGEQNMLLFAPNIFILDYLKSTGQLKESTWKMAVGYLESGYQRELSYKRYDGSYSPFGMSDRSGNTWLTTFVMKSFNAAKQYIFVDQTYIEDARTWLSGLQKLDGCIQSVGKLFHNGMKGGVS-NDVS----LTAYVAAAMLELDGNATNPVVQNCLKCLRTAVSGKITNLYTVALLSYTYTLAGDQDMRSKLVTLLDQKSINEGGTRHW--KRDGAPETGLDSVEVEMTSYVLLALLSGPSLPGFGLDYAAGIVYWLAQQQNPFGGFSSTQDTVVALQALAKYATATFSLEGSTTVTVTSVGGLNKYFT--VNKDNRLLYQEEKL-TEIPGEYTIKAEGQSCVLPQISLFYNIPPP-SDFSAFQISTNTS----GRCDIPRPEFMLFVHVEFQGRREETNMVVINIKLLSGYILQDNSLKME----SRLVKRVDVEEGYINIYLDGLK---KGQKETFDVILEEDQQVGNLKPAVVKVYDYYQT---SDEAVTDYTSPCNK 1391          

HSP 2 Score: 73.9442 bits (180), Expect = 1.533e-12
Identity = 62/216 (28.70%), Postives = 96/216 (44.44%), Query Frame = 1
Query:  634 ETPDNVRVAQWKNVSINEA-MNLEYQLNKDPIFGIWKAKAVFDGQEEIIQ-FEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCM---LYSYGKKK-----CVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKS-QINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRP-YYKPGLPYFGRINLVRHNKKP 1245
            + P++ R+AQW + SI+   ++L +    +   GI+   A  D  E I   FEIK+YVLP+F V V  PS I   D+ ++ K+C KY+ GKP+   +   FC     YS+         C  F+    K  C        +     +   Y+   S ++   + E GT   + KA            + F+  P  YKPGLP  G+I +   +  P
Sbjct:  125 QDPNSNRIAQWLDKSIDRGILDLSHPTIAEAAQGIYVISAKTDKGETISHNFEIKEYVLPKFEVTVNLPSVITILDDEVTLKICGKYTYGKPVLGSVKAEFCRHLNQYSWLPSPKQDYICKTFELSTAKNGCAT----QNVALAGFAMNTYNDFDSFEVKAELEEFGT-GVILKASGSASFTTQIRTVSFEDLPSSYKPGLPLEGKIKVTGADGSP 335          
BLAST of Alpha-2-macroglobulin vs. Ensembl Medaka
Match: ENSORLT00000037305.1 (alpha-2-macroglobulin-like protein 1 [Source:NCBI gene;Acc:111948476])

HSP 1 Score: 332.798 bits (852), Expect = 4.586e-93
Identity = 266/955 (27.85%), Postives = 450/955 (47.12%), Query Frame = 1
Query: 2035 ISIPL--MKNMGPDVHVIAYFINTDNEVVADA--LEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYL-----VQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRM-IQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKH---LNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEI---NVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQD-----LSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFA-KTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNK 4830
            I IPL  + ++ P   V+ Y I +  EVVAD+    I   LNN   L     KF+    +P +K  LT+      + C++R  D+++L         + Y+     ++K+ + ++++  DS       + C P+   + + ++P    E   R++  T             V  +  L  G  D  Y  F  +      +        + +  + IR YFPE+W++   +  +     L  TVPD++T W A ++C++  G  +AP  +L    PF+ ++ +PYS+   EV  L   VFNY   C  +   + V +++    N  G    ++C C  + KT  + + P  +G + + + + ++ S+     +   +  +   D+V   +LVE  G P     S                 +P + V+GS  + ++  GD+MG+   NLDKL+ MPYGCGEQNM+   P+I++LDYL S      +    A  Y+  GY R+L YK DDGS+SAFG  D  G+TWLT FV+KSF+ A +Y+ ++   +++A  +L  +Q+ DGC +  GKLF + M GG+     +D   LTAYV  ++  +D   T   +   + C    ++    N                  +   +   L  +S++ G  ++W   ++ + E   +S ++E T Y +LAL++        L  +   V WL+ Q+N  GG+ STQDTVVAL ALA +A  T     +  + V+ V   NK +   +  DNRL+ Q   L T+     ++K  G  C   Q+S  YNI    +    F++S  T      QC+I   +       R + +NM+++ I   SG+ L +   K L    +  + R+D ++  + +Y D      + +   F   +EE  ++ NL+PAVVK+ DYY     S+++ + +   CNK
Sbjct:  403 IKIPLTNVIDLAPIAQVVVYTIVSSGEVVADSRDFPIQLCLNNKVSL-----KFSAVQELPGAKTTLTLR-AQPSSLCSVRAIDQSVLLLKSEEELTVDYVYNQLPIKKMWEYDYQVEDDSF------NPCFPRPWPRPIALEP----ELLPRELRDT-------------VSHIFPLYEG--DDVYTIFKVKSFTFLINFCMAAPAPEGEKTETIRTYFPETWIWDLVSVGSSGSTSLVKTVPDTITKWTAGAFCVSPAGFGVAPNVRLTAFQPFFVSLTLPYSVVRGEVFTLKATVFNYLPKCIMVKATL-VKSDQFTFKNCDGCVYSSVCLCAEESKTFSWIVTPTALGDVTLKVSAEAEKSNKKCGTEVVTVPTLGQVDTVITTLLVEVKG-PVSKKIS---------------LELPEDFVNGSEGASVSVVGDLMGRAMKNLDKLLAMPYGCGEQNMLLFAPNIFILDYLKSTGQLKESTQKMAVGYLESGYQRELNYKRDDGSYSAFGMGDPSGNTWLTTFVMKSFNAAKQYIFVDQKYIQDARTWLSGLQKPDGCIQSLGKLFHNGMKGGV-----SDDVSLTAYVAAAMLELDGNATNPVVQNCLKCLRTAVSGKITNLYTVALLSYTFTLAGDQDMRSKLITLLDQKSINEGGTRHW--KRDGASETDLDSVEVEMTSYVLLALLSGPSLPGFGLDYAAGIVRWLAQQQNPFGGFSSTQDTVVALQALAKYATATFSPEGSTTVTVTSVGGLNKRFT--VNKDNRLLYQEEKL-TQIPGEYTIKAEGQSCVLAQISLFYNIPP-PSDFSAFEISTNTR----GQCDIPRPEFTLFVEGRREETNMVVINIKLLSGYILQDNSLKMLKE--NRLVKRVDVEEGYINIYLDGVR---SFEKETFNVILEEDQQVGNLKPAVVKVYDYYQ---TSDEAVTDYTSPCNK 1286          

HSP 2 Score: 69.3218 bits (168), Expect = 4.161e-11
Identity = 47/163 (28.83%), Postives = 79/163 (48.47%), Query Frame = 1
Query:  424 FIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEA-MNLEYQLNKDPIFGIWKAKAVFDGQEEIIQ-FEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPM 906
            F+   +T+KPIYKPG  V+ R +++                                   D+N+  +  ++ P++ R+AQW + SI+   ++L +    +   GI+   A  D  E +   FEIK+YVLP+F V V  P+ I   D+ ++ K+C KY+ GKP+
Sbjct:  104 FVHIVQTEKPIYKPGQTVQFRIVSM-----------------------------------DTNFIPVNRMD-PNSNRIAQWMDKSIDGGILDLSHSTIPEAAQGIYVITAETDKGETVSHNFEIKEYVLPKFEVTVNLPTVITILDDEVTLKICGKYTYGKPV 230          
BLAST of Alpha-2-macroglobulin vs. Planmine SMEST
Match: SMESG000037203.1 (SMESG000037203.1)

HSP 1 Score: 3580.8 bits (9284), Expect = 0.000e+0
Identity = 1804/1853 (97.36%), Postives = 1819/1853 (98.17%), Query Frame = 1
Query:   85 FAVKDFYFITSPNLLITETSHHFNVHTSTDIVLTIESIHDPSQIKHQSSKFVIKKGFQTIPYYVPFVGSHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQISEVSSNLKPPMAATTVYQSLTNFQSKDGHYLQFMPINDKFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYPSVPVKCYPRDDFFGHYQCVNGTTLTCLSGWKGGNCREPICSGGCLNGACVEPNKCICKQYWTGKGCNQCTKAKYCKNGYCVNGGDCECYPGWMNFDCSKKGPIKHLYRNVTTVKPITKNETEIRKFEKQTIFERIISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKSDEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRRTVFVAEQSMFYEWNLELEPKNCSCLNSWESFNKSFVILSSRWRSLNEKLTLSNDSIMFPMTTLYSAYQFDLQAQCNIANNFYLMANRLIPDFANKTAKNDSCPKCILRNNYYSVIKNITEWYCANFTDWKLNISSTSPIVKGVLSSNVSSIPVELEFPHQFCYCYEHVRDTKKSFRIVDLNHKLQSLNQKPKDPIKLMLNKGFEVVDEEIFSSLKNIKCG 5643
            FAVKDFYFITSPNLLITETSHHFNVHTSTDIVLTIESIHDPSQIKHQSSKFVIKKGFQTIPYYVPFVGSHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREP+EIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYG KKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSW YGNNWGFIRNYTSNKKGVI+FVIPYIPLAQSLSIQISEVSSNLKPPM ATT YQ LTNFQSKDGHYLQFMPINDKFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYPSVPVKCYPRDDFFGHYQCVNGTTLTCLSGWKGGNCREPICSG CLNGACVEPNKCICKQYWTGKGCN+C KAKYCKNGYCVNGGDCECYPGWMNFDCSKKGPIKHLYRNVTTVKPITKNETEIRKFEKQTIFERIISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCA+RI DEALLQFGQSSNADLSYLVQ LI LN KI  D++     K  CIPQKRVKRMI PIYG  YDSRKVLSTAGFTAITNARIVNVKCM  LA GMPDRSY TF + RTQM++S NSVLKISDAK+KKQIREYFPESWVFSYFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDSSSKYSSFCSEKKKKKINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYL+SLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADG+LLTAYVLISLNGVDLTNTTINITKAINCATENITNNTPNY+LALTSYLLSLYTPSSSLSQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWELSEEEKKSLSLQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFN+ CNKSDEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRRTVFVAEQSMFYEWNLELEPKNCSCLNSWESFNKSFVILSSRWRSLNEKLTLSNDSIMFPMTTLYSAYQFDLQAQCNIANNFYLMANRLIPDFANKTAKNDSCPKCILRNNYYSVIKNITEWYCANFTDWKLNISSTSPIVKGVLS NVSS PVEL+FPHQFCYCYEHVRDTKKSFRIVDLNHKLQSLNQKPKDPIKLMLNK FEVVDEEIFSSLKNIKCG
Sbjct:   18 FAVKDFYFITSPNLLITETSHHFNVHTSTDIVLTIESIHDPSQIKHQSSKFVIKKGFQTIPYYVPFVGSHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPEEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGTKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWEYGNNWGFIRNYTSNKKGVIDFVIPYIPLAQSLSIQISEVSSNLKPPMTATTSYQLLTNFQSKDGHYLQFMPINDKFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYPSVPVKCYPRDDFFGHYQCVNGTTLTCLSGWKGGNCREPICSGDCLNGACVEPNKCICKQYWTGKGCNRCIKAKYCKNGYCVNGGDCECYPGWMNFDCSKKGPIKHLYRNVTTVKPITKNETEIRKFEKQTIFERIISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAVRITDEALLQFGQSSNADLSYLVQMLITLNKKIANDNQRIFYGKPWCIPQKRVKRMILPIYGFGYDSRKVLSTAGFTAITNARIVNVKCMHILAMGMPDRSYYTFESARTQMTQSGNSVLKISDAKLKKQIREYFPESWVFSYFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDSSSKYSSFCSEKKKKKINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLSSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGQLLTAYVLISLNGVDLTNTTINITKAINCATENITNNTPNYKLALTSYLLSLYTPSSSLSQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWELSEEEKKSLSLQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNRDCNKSDEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRRTVFVAEQSMFYEWNLELEPKNCSCLNSWESFNKSFVILSSRWRSLNEKLTLSNDSIMFPMTTLYSAYQFDLQAQCNIANNFYLMANRLIPDFANKTAKNDSCPKCILRNNYYSVIKNITEWYCANFTDWKLNISSTSPIVKGVLSRNVSSFPVELKFPHQFCYCYEHVRDTKKSFRIVDLNHKLQSLNQKPKDPIKLMLNKRFEVVDEEIFSSLKNIKCG 1870          
BLAST of Alpha-2-macroglobulin vs. Planmine SMEST
Match: SMESG000037144.1 (SMESG000037144.1)

HSP 1 Score: 2527.67 bits (6550), Expect = 0.000e+0
Identity = 1278/1457 (87.71%), Postives = 1340/1457 (91.97%), Query Frame = 1
Query:   88 AVKDFYFITSPNLLITETSHHFNVHTSTDIVLTIESIHDPSQIKHQSSKFVIKKGFQTIPYYVPFVGSHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQISEVSSNLKPPMAATTVYQSLTNFQSKDGHYLQFMPINDKFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYPSVPVKCYPRDDFFGHYQCVNGTTLTCLSGWKGGNCREPICSGGCLNGACVEPNKCICKQYWTGKGCNQCTKAKYCKNGYCVNGGDCECYPGWMNFDCSKKGPIKHLYRNVTTVKPITKNETEIRKFEKQTIFERIISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLAR---GMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXINIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTE 4449
            A  +FYFIT+PN LITET H FNVHTSTDIVLTIESIHDPSQIK+QSSKF+IKKGFQTIPYYVPFVGSHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEI+LDK NKF+S  SK      +F LIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPS ILAKDESISFKVCSKYSTGK M AKI+G+FC +++Y +KKCVAFKSDL+KQNC++IKLES  + +  +SF Y  AKSQINVTVTENGTSSSVSKAVEGPGI YNSF IKFD RPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGF RNYTSNKKGVI+FVIPYIPLAQSLSI+ISEVS+++KPPM   ++YQSL NFQS+DGHYLQFMPI  KFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYPSVPVKCYPRDDFFGHYQCVNGTTLTCLSGWKGGNCREPICSG CLNGACVEPNKCICKQYWTGKGCN+CTKAKYCKNGYCVNGGDCECYPGWMNFDCSKKGPIKHLYRNVTTVKPITKNETEIRKFEKQTIFER+ISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKE+GCA+RIADEALLQFGQSSNADLSYLVQKLIKLN KI  D++     K  CIPQK VKRMI PIYG  YDSRKVLSTAGFTAITNARIVN+ C   + R    +   + A+F  E + +             ++KKQIR++FPESWVFSYFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEI+ KI VD+NEINVIGLK+FTLCQCKNDEKTVYFNLKPKIIG LN+TI +SSKYS+FCS K    INIAMSDSVRRQILVEPPGVPTETTFSELICNKN+ L +  VF+IPS+IVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYL  + I NPAL AKAK YIIDGY+RQLTYKHDDGSFSAFGK DKFGSTWLTAFVLKSF  ASKYVNINLSTLKEATKYLEK+QRSDGCFEEKGKLFSSTMAGGIKRNDK DG+LLTAYVLISLNGVDLTNTTINITKAINCATENITNNTPNYRLALT+Y LSLY  S +L+Q V AQL  QSVSFGRYKYWPFDKESSDE KSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNL VSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVK +
Sbjct:   19 AKNEFYFITTPNQLITETLHRFNVHTSTDIVLTIESIHDPSQIKNQSSKFIIKKGFQTIPYYVPFVGSHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIILDKTNKFVS--SKTRKHFRFFHLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSGILAKDESISFKVCSKYSTGKLMTAKINGIFC-IFAYKRKKCVAFKSDLLKQNCSRIKLESNTLNL--TSFAYFTAKSQINVTVTENGTSSSVSKAVEGPGIMYNSFIIKFDSRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFSRNYTSNKKGVIDFVIPYIPLAQSLSIRISEVSNDIKPPMNPASLYQSLANFQSRDGHYLQFMPIKQKFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYPSVPVKCYPRDDFFGHYQCVNGTTLTCLSGWKGGNCREPICSGDCLNGACVEPNKCICKQYWTGKGCNRCTKAKYCKNGYCVNGGDCECYPGWMNFDCSKKGPIKHLYRNVTTVKPITKNETEIRKFEKQTIFERMISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKEDGCAVRIADEALLQFGQSSNADLSYLVQKLIKLNKKIANDNQRIFYGKPWCIPQKHVKRMILPIYGFGYDSRKVLSTAGFTAITNARIVNINCHFPIWRFNGPLARVAGASFEKESSSLK-----------TELKKQIRDFFPESWVFSYFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEIHAKIEVDSNEINVIGLKAFTLCQCKNDEKTVYFNLKPKIIGNLNITIHTSSKYSTFCSNKNLTNINIAMSDSVRRQILVEPPGVPTETTFSELICNKNQTLRLKKVFSIPSKIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLEGMKIDNPALEAKAKRYIIDGYSRQLTYKHDDGSFSAFGKKDKFGSTWLTAFVLKSFQAASKYVNINLSTLKEATKYLEKIQRSDGCFEEKGKLFSSTMAGGIKRNDKTDGQLLTAYVLISLNGVDLTNTTINITKAINCATENITNNTPNYRLALTAYSLSLYNFSLNLTQQVIAQLDKQSVSFGRYKYWPFDKESSDEHKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLNVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKNQ 1459          
BLAST of Alpha-2-macroglobulin vs. Planmine SMEST
Match: SMESG000037149.1 (SMESG000037149.1)

HSP 1 Score: 1513.05 bits (3916), Expect = 0.000e+0
Identity = 778/889 (87.51%), Postives = 826/889 (92.91%), Query Frame = 1
Query: 2980 LCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKSDEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRRTVFVAEQSMFYEWNLELEPKNCSCLNSWESFNKSFVILSSRWRSLNEKLTLSNDSIMFPMTTLYSAYQFDLQAQCNIANNFYLMANRLIPDFANKTAKNDSCPKCILRNNYYSVIKNITEWYCANFTDWKLNISSTSPIVKGVLSSNVSSIPVELEFPHQFCYCYEHVRDTKKSFRIVDLNHKLQSLNQKPKDPIKLMLNKGFEVVDEEIFSSLKNIKCG 5643
            +C C N+EKTVYFN++PK+IGKLN+TI SSS+YS+FCS++ + K  N+ M DSVRRQILVEPPGVP ETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLV MPYGCGEQNMVAVVPSIYVLDYL+SLNI+NPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSF DASKYV+I  S L +A  YLE  Q+ DGCFEEKGKL SSTMAG +K+ND +D  LLTAYVLIS+  + LT +  N+ +A+ C  +N+   +  +RLALT+Y +SLY  SS+L+++V  QL+ QSVS GRYKYWPFDKESSD ++SNSADIETTGYAILALINHQDLS SMK VYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWELSEEEKKSLSLQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFN+ CNKSDEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRRTVFVAEQSMFYE NLELEPKNCSCLNSWESFNK+FVILSSRWRSLNEKLTLSNDSIMFPM TLYSAYQFDLQAQCNIANNFYLMANRLIPDFANKTAKNDSCPKCILRNNYY VIKNITEWYCAN+T W LN+SSTSPIVKGVLSSNVSSIPVELEFPHQFCYCYEHVRD K+SFRIVDLNHKLQSLNQKPKDPIKL+LN  F++V+ EIFSSLK IKC 
Sbjct:    1 MCLCSNEEKTVYFNIQPKLIGKLNITIHSSSRYSTFCSKENENKTKNVEMFDSVRRQILVEPPGVPMETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVRMPYGCGEQNMVAVVPSIYVLDYLSSLNIENPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFTDASKYVDIQKSILIKAMNYLENSQKPDGCFEEKGKLLSSTMAGNVKQNDNSDSSLLTAYVLISIKRMKLTKSNFNVFQALKCVAKNLEKESSTFRLALTAYAMSLYDGSSNLTRSVMNQLVKQSVSIGRYKYWPFDKESSDIKRSNSADIETTGYAILALINHQDLSESMKIVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWELSEEEKKSLSLQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNRDCNKSDEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRRTVFVAEQSMFYELNLELEPKNCSCLNSWESFNKNFVILSSRWRSLNEKLTLSNDSIMFPMATLYSAYQFDLQAQCNIANNFYLMANRLIPDFANKTAKNDSCPKCILRNNYYFVIKNITEWYCANYTYWNLNVSSTSPIVKGVLSSNVSSIPVELEFPHQFCYCYEHVRDMKRSFRIVDLNHKLQSLNQKPKDPIKLVLNNEFQIVEGEIFSSLKYIKCA 889          
BLAST of Alpha-2-macroglobulin vs. Planmine SMEST
Match: SMESG000037155.1 (SMESG000037155.1)

HSP 1 Score: 1321.61 bits (3419), Expect = 0.000e+0
Identity = 686/785 (87.39%), Postives = 728/785 (92.74%), Query Frame = 1
Query: 2980 LCQCKNDEKTVYFNLKPKIIGKLNVTIDXXXXXXXXXXXXXXXXI-NIAMSDSVRRQILVEPPGVPTETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEATKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNGVDLXXXXXXXXXXXXXXXENITNNTPNYRXXXXXXXXXXXXXXXXXXQNVFAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDLSVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWXXXXXXXXXXXXQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKSDEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRRTVFVAEQSMFYEWNLELEPKNCSCLNSWESFNKSFVILSSRWRSLNEKLTLSNDSIMFPMTTLYSAYQFDLQAQCNIANNFYLMANRLIPDFANKTAKNDSCPKCILRNNYYSVIK 5331
            +C C N+EKTVYFN++PK+IGKLN+TI SSS+YS+FCS++ + K  N+ M DSVRRQILVEPPGVP ETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLV MPYGCGEQNMVAVVPSIYVLDYL+SLNI+NPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSF DASKYV+I  S L +A  YLE  Q+ DGCFEEKGKLFSSTMAG +K+ND  D  LLTAY+LIS+  + LT +  N+ +A+ C  +N+   +  +RLALT+Y +SLY  SS+L+++V  QL+ QSVS GRYKYWPFDKESSDE KSNSADIETTGYAILALINHQDLS S+KTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGV QNVNL VSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWELSEEEKKSLSLQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKI+DYYNPEIYSE SYSMFN+ CNKSDEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRRTVFVAEQSMFYE NLELEPKNCSCLNSWESFNKSFVILSSRW+SLNEKLTLSNDSIMFPMTTLYSAYQFDLQAQCNIAN FYLMANRLIPDFANKTAKNDSCPKCILRNNYYS+ K
Sbjct:    1 MCLCSNEEKTVYFNIQPKLIGKLNITIHSSSRYSTFCSKENENKTKNVEMFDSVRRQILVEPPGVPMETTFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDKLVRMPYGCGEQNMVAVVPSIYVLDYLSSLNIENPALSAKAKSYIIDGYTRQLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFTDASKYVDIQKSILIKAMNYLENSQKPDGCFEEKGKLFSSTMAGNVKQNDNTDSSLLTAYILISIKRMKLTKSNFNVFQALKCVAKNLEKESSTFRLALTAYAMSLYDGSSNLTRSVMNQLVKQSVSIGRYKYWPFDKESSDEHKSNSADIETTGYAILALINHQDLSESLKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVHQNVNLNVSVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLSSLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMILVIINYPSGWELSEEEKKSLSLQISTPLNRIDFQKTRMELYYDAFSYNDAGKDSCFRFKIEEKTKISNLQPAVVKILDYYNPEIYSEMSYSMFNRDCNKSDEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRRTVFVAEQSMFYELNLELEPKNCSCLNSWESFNKSFVILSSRWKSLNEKLTLSNDSIMFPMTTLYSAYQFDLQAQCNIANYFYLMANRLIPDFANKTAKNDSCPKCILRNNYYSLSK 785          
BLAST of Alpha-2-macroglobulin vs. Planmine SMEST
Match: SMESG000037154.1 (SMESG000037154.1)

HSP 1 Score: 940.643 bits (2430), Expect = 0.000e+0
Identity = 472/967 (48.81%), Postives = 635/967 (65.67%), Query Frame = 1
Query:   88 AVKDFYFITSPNLLITETSHHFNVHTSTDIVLTIESIHDPSQIKHQSSKFVIKKGFQTIPYYVPFVGSHLGSKIRLNILGDVCQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRLRFMAIYPTNLMREPDEIGKQVEIVLD--KNNKFISKPSKNDNDSNYFDLIIIETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQFEIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFCMLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINVTVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRHNKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSLSIQISEVSSNLKPPMAATTVYQSLTNFQSKDGHYLQFMPINDKFKCPGKLNLTLLTNYDIASTSIYVQIFSRGQIVKMIEYPSVPVKCYPRDDFFGHYQCVNGTTLTCLSGWKGGNCREPICSGGCLNGACVEPNKCICKQYWTGKGCNQCTKAKYCKNGYCVNGGDCECYPGWMNFDCSKKGPIKHLYRNVTTVKPIT------KNETEIRKFEKQTIFERIISIPLMKNMGPDVHVIAYFINTDNEVVADALEIASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEALLQFGQSSNADLSYLVQKLIKLNHKIT--LDSRIGLLRKHKCIPQKRVKRMIQPIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNERTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKHLNLTVPDSMTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPVKVFNYAGTCFEINVKINVDANEINV 2958
            A KDFYFIT P +L+ E+SH  ++H+ST++++ I + H  S I+H+S  F IKKG   IPY +PF      + I L  LGD+C   +KC+ T+N+ G + NET  + +I++NFIIF+ETDKPIYKPG+++ LRFM IYPTNL  +P  +  Q  IV D  +N K I     N +    F+LI+IE     RVAQW+N++I  AMNL YQL+KDP  GIWKAKA++ GQEE+++F + KYVLPRFI+ + PP++I+ KD SI +++C++YST K M A+I   FC++Y Y  +KC      L    C  I++ +K VF   + +R+ + +S+INVTVTENGTSS++SK+++G GI    + I F+ +PY+K GLPYFG + L+RH+ KP +   I IS+        WGF  NY+S++ GV+ F+IP +      +IQI+E S  ++  +      +++  ++S     L+ +PI +K KCPGKLNLT+LTNYDI+ST++YVQI SRGQIVK IEYP VP+KCY RDD  GHY+CV+  TL CL GWKG NC EPICS GC+NGAC   +KC+CK  W G+ C++C K  YCKNG C  G DC C PGW  +DCS KG     Y N     P++      K      K+E ++IFERI+SIPL+KNMGPD+HVI YFIN   EV+ D +E+  GL +CS +GGG+F F+K TA+PKSKV+L +DPGV+   CA+RIAD  L QFGQSSN DLSYLVQKLI +NHKI    +     L  HK      V     P  G  +DS   +  +GF A+TNARIVN KC     +G+       F +   ++  S + V      K++  +REYFP SW+F YFN T K L LTVPDS+TTW+A S+CMTE G+WIA  Q L V   F++ IYVPYSMKLNE L LP+K+FNY   C+EI  +I+ + NEI V
Sbjct:   19 AAKDFYFITMPKVLLVESSHKISLHSSTNLLVKIVTFHTKSPIRHESETFYIKKGISLIPYQLPFYDKTNEASISLRFLGDICDELIKCDPTQNVYGKYFNETHILNIINQNFIIFSETDKPIYKPGERIMLRFMPIYPTNLKTDPPMLFNQRVIVGDGKENYKLI-----NSDIGKTFELIVIENSIEARVAQWRNLTIENAMNLNYQLSKDPAIGIWKAKAIYRGQEEVMEFRVMKYVLPRFIINITPPNQIMYKDSSIKYEICAQYSTKKKMIARIQTTFCIIYYYVTEKCQVTNLILKDTYCATIEVSTKSVFPAFNKYRFIRTRSRINVTVTENGTSSTISKSLDGNGIMDTEYKIVFNSKPYFKFGLPYFGNVKLIRHDNKPQRNTKIKISVDFPKRYVKWGFESNYSSDENGVVRFIIPSVISNSLFTIQITEASDVIENVITTPIFSRNIDPWESISEQVLEILPIENKIKCPGKLNLTVLTNYDISSTNLYVQILSRGQIVKAIEYPPVPIKCYSRDDDLGHYKCVDDKTLQCLPGWKGNNCIEPICSRGCINGACTSHDKCVCKMGWVGETCDKCIKPAYCKNGNCNRGNDCVCLPGWTKYDCSIKG---FRYNNEPLYVPLSKYTEPPKKPAVTNKYENKSIFERILSIPLLKNMGPDIHVIVYFINAQLEVIVDTVELLEGLESCSNVGGGEFIFDKNTALPKSKVILKIDPGVQNASCAVRIADIVLFQFGQSSNVDLSYLVQKLIYINHKIINYKNDVTNCLSDHKISQYSFV-----PETG--FDSDFSIKNSGFKAVTNARIVNKKCK---FKGL-------FPSSTNKIEIS-DFVFGEEKMKLQTHVREYFPGSWIFKYFNHTPKQLFLTVPDSLTTWQARSFCMTENGIWIAVPQILTVHKLFFTEIYVPYSMKLNERLHLPIKLFNYVDICYEIRSEISTNTNEIYV 959          
The following BLAST results are available for this feature:
BLAST of Alpha-2-macroglobulin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
A2ML15.754e-9728.69alpha-2-macroglobulin like 1 [Source:HGNC Symbol;A... [more]
A2ML12.243e-9628.69alpha-2-macroglobulin like 1 [Source:HGNC Symbol;A... [more]
A2ML12.092e-9428.46alpha-2-macroglobulin like 1 [Source:HGNC Symbol;A... [more]
A2M9.057e-9328.05alpha-2-macroglobulin [Source:HGNC Symbol;Acc:HGNC... [more]
CD1093.644e-8628.63CD109 molecule [Source:HGNC Symbol;Acc:HGNC:21685][more]
back to top
BLAST of Alpha-2-macroglobulin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tep-12.477e-9027.97TEP (ThiolEster containing Protein) [Source:UniPr... [more]
tep-12.477e-9027.97TEP (ThiolEster containing Protein) [Source:UniPr... [more]
tep-12.477e-9027.97TEP (ThiolEster containing Protein) [Source:UniPr... [more]
tep-14.212e-9027.85TEP (ThiolEster containing Protein) [Source:UniPr... [more]
tep-14.212e-9027.85TEP (ThiolEster containing Protein) [Source:UniPr... [more]
back to top
BLAST of Alpha-2-macroglobulin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tep22.543e-7931.03gene:FBgn0041182 transcript:FBtr0079511[more]
Tep21.994e-7830.88gene:FBgn0041182 transcript:FBtr0079510[more]
Tep23.450e-7831.11gene:FBgn0041182 transcript:FBtr0335488[more]
Tep27.687e-7630.29gene:FBgn0041182 transcript:FBtr0079513[more]
Tep21.706e-7430.42gene:FBgn0041182 transcript:FBtr0335487[more]
back to top
BLAST of Alpha-2-macroglobulin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-212c13.82.486e-9727.56si:ch211-212c13.8 [Source:ZFIN;Acc:ZDB-GENE-131118... [more]
si:dkey-105h12.27.564e-9729.52si:dkey-105h12.2 [Source:ZFIN;Acc:ZDB-GENE-131118-... [more]
a2ml1.969e-9628.07alpha-2-macroglobulin-like [Source:ZFIN;Acc:ZDB-GE... [more]
a2ml2.709e-9628.07alpha-2-macroglobulin-like [Source:ZFIN;Acc:ZDB-GE... [more]
sb:cb373.330e-9527.67sb:cb37 [Source:ZFIN;Acc:ZDB-GENE-030131-9800][more]
back to top
BLAST of Alpha-2-macroglobulin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
a2ml12.228e-9631.91alpha-2-macroglobulin-like 1 [Source:NCBI gene;Acc... [more]
pzp3.274e-9528.16pregnancy-zone protein [Source:NCBI gene;Acc:77954... [more]
lrrc21.736e-8027.36leucine rich repeat containing 2 [Source:Xenbase;A... [more]
tubal3.18.697e-8026.82tubulin alpha like 3, gene 1 [Source:Xenbase;Acc:X... [more]
lrrc28.658e-7929.63leucine rich repeat containing 2 [Source:Xenbase;A... [more]
back to top
BLAST of Alpha-2-macroglobulin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mug11.064e-9128.08murinoglobulin 1 [Source:MGI Symbol;Acc:MGI:99837][more]
Gm72981.978e-9128.46predicted gene 7298 [Source:MGI Symbol;Acc:MGI:364... [more]
A2ml12.419e-8127.03alpha-2-macroglobulin like 1 [Source:MGI Symbol;Ac... [more]
Cd1092.554e-7627.17CD109 antigen [Source:MGI Symbol;Acc:MGI:2445221][more]
Pzp1.821e-7029.47PZP, alpha-2-macroglobulin like [Source:MGI Symbol... [more]
back to top
BLAST of Alpha-2-macroglobulin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63041|A1M_RAT1.272e-9829.20Alpha-1-macroglobulin OS=Rattus norvegicus OX=1011... [more]
sp|A8K2U0|A2ML1_HUMAN1.005e-9328.46Alpha-2-macroglobulin-like protein 1 OS=Homo sapie... [more]
sp|P01023|A2MG_HUMAN4.349e-9228.05Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q5R4N8|A2MG_PONAB4.628e-9228.09Alpha-2-macroglobulin OS=Pongo abelii OX=9601 GN=A... [more]
sp|P20740|OVOS_CHICK5.210e-9128.72Ovostatin OS=Gallus gallus OX=9031 PE=1 SV=3[more]
back to top
BLAST of Alpha-2-macroglobulin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y6HTR90.000e+065.82Alpha-2-macroglobulin OS=Dugesia japonica OX=6161 ... [more]
A0A5J4NQR50.000e+029.07Alpha-2-macroglobulin OS=Paragonimus westermani OX... [more]
A0A1S8WUB02.812e-17127.17A-macroglobulin complement component OS=Opisthorch... [more]
A0A074ZT721.581e-17027.18Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A4S2M4B32.717e-16827.28Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Alpha-2-macroglobulin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031363.11.077e-9331.70pep primary_assembly:Astyanax_mexicanus-2.0:1:1573... [more]
ENSAMXT00000010848.29.477e-9331.54pep primary_assembly:Astyanax_mexicanus-2.0:1:1573... [more]
ENSAMXT00000005486.23.577e-8827.85pep primary_assembly:Astyanax_mexicanus-2.0:6:3017... [more]
ENSAMXT00000010844.21.556e-8429.39pep primary_assembly:Astyanax_mexicanus-2.0:1:1571... [more]
ENSAMXT00000010840.27.767e-8430.64alpha-2-macroglobulin-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Alpha-2-macroglobulin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpamd88.666e-7829.52C3 and PZP like alpha-2-macroglobulin domain conta... [more]
cpamd89.462e-7729.34C3 and PZP like alpha-2-macroglobulin domain conta... [more]
cd1098.634e-7126.65CD109 molecule [Source:ZFIN;Acc:ZDB-GENE-120215-25... [more]
cpamd81.922e-5229.28C3 and PZP like alpha-2-macroglobulin domain conta... [more]
ENSPMAT00000004103.11.167e-4423.75pep scaffold:Pmarinus_7.0:GL476516:13600:100895:-1... [more]
back to top
BLAST of Alpha-2-macroglobulin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-2-macroglobulin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO333911.321e-5929.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329563.509e-4831.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381932.649e-4726.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333931.455e-4344.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333925.911e-1831.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-2-macroglobulin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000030023.12.060e-10429.87alpha-2-macroglobulin-like protein 1 [Source:NCBI ... [more]
ENSORLT00000001261.21.223e-9628.54alpha-2-macroglobulin-like protein 1 [Source:NCBI ... [more]
ENSORLT00000012489.24.848e-9628.06alpha-2-macroglobulin-like protein 1 [Source:NCBI ... [more]
ENSORLT00000000908.26.152e-9527.62pep primary_assembly:ASM223467v1:2:10066528:100814... [more]
ENSORLT00000037305.14.586e-9327.85alpha-2-macroglobulin-like protein 1 [Source:NCBI ... [more]
back to top
BLAST of Alpha-2-macroglobulin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037203.10.000e+097.36SMESG000037203.1[more]
SMESG000037144.10.000e+087.71SMESG000037144.1[more]
SMESG000037149.10.000e+087.51SMESG000037149.1[more]
SMESG000037155.10.000e+087.39SMESG000037155.1[more]
SMESG000037154.10.000e+048.81SMESG000037154.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004348 ID=SMED30004348|Name=Alpha-2-macroglobulin|organism=Schmidtea mediterranea sexual|type=transcript|length=5775bp
GAATCTATATAAATCTTATATGATCTAACGAAAATGAATTCGGTAGTTTT
AATAACAATAATAATTTCAATTGTTACAAAGGTGTTTGCAGTGAAAGATT
TTTATTTTATAACTTCACCGAATTTGTTGATAACTGAAACCTCGCACCAT
TTCAATGTTCATACATCAACTGATATAGTGCTGACAATCGAATCAATTCA
TGATCCAAGTCAAATTAAGCATCAAAGTTCTAAATTTGTTATTAAAAAGG
GATTTCAAACAATTCCTTATTACGTACCATTTGTCGGAAGTCATTTGGGA
TCAAAAATAAGACTAAATATTCTTGGAGATGTTTGTCAAAGTGGAATGAA
ATGTGAATTAACGAAAAATATAACGGGCAATTTCATCAATGAAACTCGGG
AAATTGGGTTGATTGACAAAAACTTTATAATTTTTGCTGAAACAGACAAG
CCAATTTATAAACCCGGAGATAAAGTTCGATTACGGTTCATGGCCATCTA
TCCAACAAACCTCATGAGAGAACCAGATGAGATTGGAAAACAAGTCGAAA
TAGTTTTAGATAAAAACAATAAATTCATTTCGAAGCCATCAAAGAATGAC
AACGATTCCAATTATTTTGATTTGATAATCATTGAAACCCCGGATAACGT
CAGAGTAGCTCAATGGAAGAACGTGTCAATCAACGAAGCAATGAATTTAG
AATATCAATTGAACAAAGATCCAATATTTGGAATTTGGAAGGCAAAAGCG
GTTTTCGATGGTCAAGAAGAAATAATTCAATTCGAAATTAAGAAATATGT
TTTGCCTCGTTTCATTGTCGAAGTGATTCCGCCAAGTGAAATTCTAGCGA
AAGATGAGTCGATAAGTTTCAAAGTATGCTCGAAGTATTCTACTGGTAAA
CCGATGAATGCGAAAATCAGCGGAATGTTTTGTATGCTCTATTCTTACGG
AAAGAAAAAATGTGTTGCATTTAAATCGGATCTGATGAAACAAAATTGTA
ACAAAATAAAACTGGAATCGAAAATCGTGTTCATATTAGCGTCTTCGTTT
CGGTATTCTAAGGCGAAAAGTCAAATCAATGTCACAGTTACAGAGAATGG
AACTTCATCGTCCGTTTCGAAAGCTGTTGAAGGCCCAGGAATAAAGTACA
ATTCTTTCAATATTAAATTCGACGGTAGACCGTATTATAAGCCGGGTTTA
CCATATTTTGGAAGAATTAATCTAGTACGGCATAATAAAAAGCCAGCTAA
GATGGTCAACATATCGATATCCATACAGAGTTGGGCATATGGAAATAATT
GGGGTTTTATTCGTAATTATACTTCGAATAAAAAGGGCGTGATTGAATTC
GTAATTCCCTACATTCCTTTGGCACAATCACTTTCGATTCAAATATCAGA
AGTTTCAAGTAATCTGAAACCTCCGATGGCTGCTACAACAGTATATCAAT
CATTAACTAATTTTCAATCAAAGGATGGCCATTACTTACAGTTCATGCCG
ATTAATGATAAATTTAAATGTCCCGGCAAACTCAATTTAACATTATTGAC
CAATTACGATATAGCGTCAACTAGCATATACGTACAAATATTTTCCAGAG
GTCAAATAGTAAAAATGATTGAATATCCTTCTGTTCCTGTAAAATGTTAT
CCGAGAGACGATTTTTTTGGACATTATCAATGTGTCAATGGGACCACATT
GACTTGTTTATCAGGCTGGAAAGGCGGCAATTGTAGAGAACCTATTTGTA
GTGGGGGTTGTTTAAATGGGGCTTGTGTAGAACCAAACAAATGCATTTGT
AAACAATATTGGACTGGTAAAGGCTGTAATCAATGCACTAAAGCTAAATA
TTGCAAAAATGGCTACTGTGTAAATGGTGGGGACTGTGAATGTTATCCTG
GATGGATGAATTTTGATTGTTCTAAAAAAGGACCGATAAAACATTTGTAT
AGAAATGTTACAACTGTTAAACCTATTACAAAGAATGAAACTGAAATAAG
AAAATTTGAAAAGCAAACTATATTTGAACGTATTATTTCTATACCATTGA
TGAAAAATATGGGCCCCGATGTTCATGTAATTGCTTATTTTATAAATACA
GATAATGAAGTAGTAGCCGATGCACTAGAAATAGCCAGTGGATTGAATAA
TTGTTCACAGCTTGGCGGAGGGAAATTTAAATTCAATAAGAAAACTGCGA
TGCCAAAATCCAAAGTGGTTTTGACTGTAGATCCAGGAGTCAAAGAAAAT
GGTTGTGCCATTCGAATAGCAGATGAAGCCTTACTGCAATTCGGTCAATC
AAGTAATGCAGATTTGAGTTATTTAGTTCAAAAGCTGATTAAACTCAATC
ACAAAATAACATTGGATTCTAGAATTGGACTTTTAAGAAAACATAAATGC
ATTCCTCAAAAGCGTGTCAAGCGAATGATACAGCCTATATATGGTTTGGA
ATATGACAGTAGAAAGGTTTTATCTACTGCTGGATTTACTGCAATAACAA
ATGCTCGAATTGTTAACGTTAAATGTATGCAATATTTAGCCAGGGGAATG
CCAGACCGATCTTACGCTACATTTTCAAATGAAAGAACTCAAATGTCAAA
ATCTAGAAATTCAGTGTTAAAAATTTCAGATGCTAAAATGAAAAAACAAA
TTCGTGAATATTTCCCAGAATCATGGGTGTTTTCATACTTTAATAAAACA
ACGAAACATTTGAATTTAACAGTTCCTGATTCCATGACAACTTGGAGAGC
TGATTCGTATTGCATGACAGAAAAAGGTTTATGGATTGCTCCTACTCAGA
AATTGAAAGTCATTTTACCTTTCTACTCTAATATTTATGTACCATATTCG
ATGAAATTAAATGAAGTTCTGCAGCTTCCTGTTAAGGTTTTCAATTATGC
TGGAACGTGTTTCGAAATTAATGTTAAAATAAATGTTGATGCTAATGAAA
TAAATGTGATTGGACTGAAATCATTCACGTTATGCCAATGCAAGAATGAC
GAAAAGACAGTTTATTTCAATCTCAAACCTAAAATTATTGGAAAACTTAA
TGTTACAATAGATTCATCATCAAAGTATTCAAGTTTCTGTTCCGAGAAGA
AAAAAAAGAAGATAAATATTGCCATGTCTGATTCCGTGCGTCGGCAAATA
CTTGTTGAACCGCCTGGCGTACCGACGGAGACAACATTTTCTGAATTAAT
TTGCAATAAAAATGAGCAACTTGGTATTTTATCTGTGTTTGCTATTCCTT
CTGAAATCGTTTCCGGTTCACTGAGATCATATTTAACATTTAATGGTGAT
GTAATGGGGAAAACATTTGATAATCTCGACAAATTGGTAGTGATGCCTTA
CGGGTGTGGTGAACAAAACATGGTGGCAGTCGTTCCAAGTATTTATGTTC
TGGATTATCTGAATAGTTTGAATATTAAAAACCCTGCATTATCGGCTAAG
GCTAAGAGTTACATAATTGATGGCTACACAAGGCAGTTAACTTATAAGCA
TGATGATGGATCGTTTTCCGCATTCGGTAAAACTGATAAATTCGGAAGCA
CATGGCTAACAGCATTCGTATTGAAATCATTTCACGATGCCAGTAAATAT
GTAAACATTAATCTATCAACATTAAAAGAAGCTACAAAATATTTGGAGAA
AATGCAAAGATCCGACGGTTGTTTTGAAGAGAAAGGAAAATTGTTTAGTA
GCACAATGGCGGGGGGCATTAAACGGAACGATAAAGCAGATGGGAAACTA
TTGACTGCTTATGTTTTAATATCTTTAAATGGTGTTGATTTGACAAATAC
GACAATAAATATCACAAAAGCAATAAATTGTGCTACAGAAAATATAACTA
ATAATACTCCAAATTATAGATTGGCTTTGACTTCATATTTACTTTCACTA
TATACTCCATCTTCCAGTTTGAGCCAGAATGTGTTCGCTCAGCTATTAGA
TCAATCCGTGAGTTTCGGGCGATATAAGTATTGGCCTTTTGACAAGGAAT
CTTCTGATGAACAAAAATCTAATTCCGCAGACATTGAAACGACGGGTTAT
GCAATTCTAGCCCTGATTAACCATCAGGATTTATCCGTATCTATGAAAAC
AGTTTATTGGCTATCAAATCAGCGCAATAGCCTCGGCGGATATTATTCAA
CTCAAGACACCGTGGTCGCTCTCAATGCTTTGGCGGTTTTCGCAAAGACG
ATTGGTGTATCTCAAAATGTCAATCTGAAAGTGTCAGTTGTCCTTAACCG
CAACAAGACCTATAACGGCTTGATAACTCTTGATAACCGGCTAGTTTCTC
AAACATTCAATCTCGGCACTGAAAATATTTCCTACGTTTCAATGAAAACT
AACGGATCGGGTTGCGCATCTATTCAGTTATCATCTTTGTACAACATTCA
TAGATTATATGCTGCCAACGACACGTTCAAATTGTCTGTGAAAACCGAGA
TTGACTCTGTGAAGCAGTGCAATATTCGAAACATAAAAGTATGCTTTGCC
TATCTGCGACGAGATAAAAATTCCAACATGATCCTTGTAATAATAAATTA
TCCCTCTGGATGGGAATTGTCGGAAGAAGAAAAGAAATCTTTATCTTTAC
AAATTTCTACTCCTCTCAATCGGATAGATTTCCAAAAGACGAGAATGGAA
TTGTATTACGATGCGTTTTCATATAATGATGCTGGGAAAGATTCTTGTTT
CCGGTTTAAAATTGAAGAGAAGACAAAAATATCAAATTTACAGCCGGCAG
TTGTGAAAATTGTAGATTATTATAATCCGGAAATTTACAGTGAAAAGTCG
TATTCAATGTTTAATAAAGCTTGCAATAAGAGTGATGAAAAAGAGCCAGG
CCGTCCTGAGGTTTTGCTTTGCCCGATTTGTGTCAATGATTCAATCAACT
CTACTTTGAAATTCATCGGGACGATTTGTAATGCTTGGTTCAACGGTTTT
GTTACGGCCAATTCCAATGCCAGTCAAAGGAGAACTGTATTTGTTGCTGA
GCAGTCGATGTTCTATGAATGGAACTTAGAGTTGGAACCTAAAAATTGCA
GCTGTTTGAATAGCTGGGAAAGTTTCAATAAAAGTTTTGTGATTTTATCA
AGTCGGTGGAGATCATTGAATGAGAAATTAACATTGTCAAACGACTCAAT
AATGTTCCCGATGACAACTTTATACTCGGCCTATCAGTTTGACTTGCAAG
CCCAATGCAACATTGCCAATAACTTCTATTTGATGGCCAACCGGCTGATT
CCAGATTTCGCCAATAAAACGGCAAAGAATGATTCGTGTCCGAAGTGCAT
TCTGAGGAATAATTATTATTCCGTTATCAAAAATATCACTGAGTGGTATT
GTGCAAATTTTACGGATTGGAAGTTAAACATCTCATCGACATCGCCAATT
GTGAAGGGCGTTTTAAGTAGCAACGTCTCGAGTATTCCTGTGGAGCTCGA
GTTTCCCCACCAGTTTTGCTACTGCTATGAACATGTTAGAGATACGAAGA
AATCGTTCAGAATCGTCGATCTAAATCACAAATTACAATCTTTGAACCAA
AAGCCCAAAGATCCGATTAAACTAATGCTGAATAAAGGATTTGAAGTTGT
CGACGAAGAAATATTTTCATCCTTGAAAAACATAAAATGTGGCTGATGGA
TATTTGTTGGCAACTGTTTTCATAGAAACTTTTACTAAAAGGTTTAATAT
AAAATAAATGTAATTTGAAGTTATTTTATTATTTTTGTTTTGCGGGAATG
TTTCAATAAAAATGGTTCCGTTTAG
back to top

protein sequence of SMED30004348-orf-1

>SMED30004348-orf-1 ID=SMED30004348-orf-1|Name=SMED30004348-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1871bp
MNSVVLITIIISIVTKVFAVKDFYFITSPNLLITETSHHFNVHTSTDIVL
TIESIHDPSQIKHQSSKFVIKKGFQTIPYYVPFVGSHLGSKIRLNILGDV
CQSGMKCELTKNITGNFINETREIGLIDKNFIIFAETDKPIYKPGDKVRL
RFMAIYPTNLMREPDEIGKQVEIVLDKNNKFISKPSKNDNDSNYFDLIII
ETPDNVRVAQWKNVSINEAMNLEYQLNKDPIFGIWKAKAVFDGQEEIIQF
EIKKYVLPRFIVEVIPPSEILAKDESISFKVCSKYSTGKPMNAKISGMFC
MLYSYGKKKCVAFKSDLMKQNCNKIKLESKIVFILASSFRYSKAKSQINV
TVTENGTSSSVSKAVEGPGIKYNSFNIKFDGRPYYKPGLPYFGRINLVRH
NKKPAKMVNISISIQSWAYGNNWGFIRNYTSNKKGVIEFVIPYIPLAQSL
SIQISEVSSNLKPPMAATTVYQSLTNFQSKDGHYLQFMPINDKFKCPGKL
NLTLLTNYDIASTSIYVQIFSRGQIVKMIEYPSVPVKCYPRDDFFGHYQC
VNGTTLTCLSGWKGGNCREPICSGGCLNGACVEPNKCICKQYWTGKGCNQ
CTKAKYCKNGYCVNGGDCECYPGWMNFDCSKKGPIKHLYRNVTTVKPITK
NETEIRKFEKQTIFERIISIPLMKNMGPDVHVIAYFINTDNEVVADALEI
ASGLNNCSQLGGGKFKFNKKTAMPKSKVVLTVDPGVKENGCAIRIADEAL
LQFGQSSNADLSYLVQKLIKLNHKITLDSRIGLLRKHKCIPQKRVKRMIQ
PIYGLEYDSRKVLSTAGFTAITNARIVNVKCMQYLARGMPDRSYATFSNE
RTQMSKSRNSVLKISDAKMKKQIREYFPESWVFSYFNKTTKHLNLTVPDS
MTTWRADSYCMTEKGLWIAPTQKLKVILPFYSNIYVPYSMKLNEVLQLPV
KVFNYAGTCFEINVKINVDANEINVIGLKSFTLCQCKNDEKTVYFNLKPK
IIGKLNVTIDSSSKYSSFCSEKKKKKINIAMSDSVRRQILVEPPGVPTET
TFSELICNKNEQLGILSVFAIPSEIVSGSLRSYLTFNGDVMGKTFDNLDK
LVVMPYGCGEQNMVAVVPSIYVLDYLNSLNIKNPALSAKAKSYIIDGYTR
QLTYKHDDGSFSAFGKTDKFGSTWLTAFVLKSFHDASKYVNINLSTLKEA
TKYLEKMQRSDGCFEEKGKLFSSTMAGGIKRNDKADGKLLTAYVLISLNG
VDLTNTTINITKAINCATENITNNTPNYRLALTSYLLSLYTPSSSLSQNV
FAQLLDQSVSFGRYKYWPFDKESSDEQKSNSADIETTGYAILALINHQDL
SVSMKTVYWLSNQRNSLGGYYSTQDTVVALNALAVFAKTIGVSQNVNLKV
SVVLNRNKTYNGLITLDNRLVSQTFNLGTENISYVSMKTNGSGCASIQLS
SLYNIHRLYAANDTFKLSVKTEIDSVKQCNIRNIKVCFAYLRRDKNSNMI
LVIINYPSGWELSEEEKKSLSLQISTPLNRIDFQKTRMELYYDAFSYNDA
GKDSCFRFKIEEKTKISNLQPAVVKIVDYYNPEIYSEKSYSMFNKACNKS
DEKEPGRPEVLLCPICVNDSINSTLKFIGTICNAWFNGFVTANSNASQRR
TVFVAEQSMFYEWNLELEPKNCSCLNSWESFNKSFVILSSRWRSLNEKLT
LSNDSIMFPMTTLYSAYQFDLQAQCNIANNFYLMANRLIPDFANKTAKND
SCPKCILRNNYYSVIKNITEWYCANFTDWKLNISSTSPIVKGVLSSNVSS
IPVELEFPHQFCYCYEHVRDTKKSFRIVDLNHKLQSLNQKPKDPIKLMLN
KGFEVVDEEIFSSLKNIKCG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041555MG3
IPR036595A-macroglobulin_rcpt-bd_sf
IPR040839MG4
IPR013783Ig-like_fold
IPR000742EGF-like_dom
IPR009048A-macroglobulin_rcpt-bd
IPR001599Macroglobln_a2
IPR008930Terpenoid_cyclase/PrenylTrfase
IPR011626Alpha-macroglobulin_TED
IPR011625A2M_N_BRD
IPR019565MacrogloblnA2_thiol-ester-bond
IPR013032EGF-like_CS
IPR019742MacrogloblnA2_CS
IPR014756Ig_E-set
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004866endopeptidase inhibitor activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1867..1873
NoneNo IPR availableGENE3DG3DSA:2.60.40.1930coord: 133..259
e-value: 1.9E-16
score: 62.2
NoneNo IPR availableGENE3DG3DSA:2.60.120.1540coord: 1046..1463
e-value: 2.3E-145
score: 487.7
NoneNo IPR availableGENE3DG3DSA:2.10.25.140coord: 538..574
e-value: 3.1E-8
score: 35.6
NoneNo IPR availableGENE3DG3DSA:2.20.130.20coord: 838..931
e-value: 9.0E-13
score: 50.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.1940coord: 260..375
e-value: 1.3E-10
score: 43.9
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 586..635
e-value: 1.5E-7
score: 33.4
NoneNo IPR availableGENE3DG3DSA:1.50.10.20coord: 1091..1399
e-value: 2.3E-145
score: 487.7
NoneNo IPR availablePANTHERPTHR11412MACROGLOBULIN/COMPLEMENTcoord: 27..1601
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR001599Alpha-2-macroglobulinSMARTSM01360A2M_2coord: 883..969
e-value: 3.1E-15
score: 66.6
IPR001599Alpha-2-macroglobulinPFAMPF00207A2Mcoord: 883..968
e-value: 6.9E-16
score: 57.9
IPR000742EGF-like domainSMARTSM00181egf_5coord: 574..602
e-value: 18.0
score: 13.1
coord: 603..633
e-value: 15.0
score: 14.1
IPR009048Alpha-macroglobulin, receptor-bindingSMARTSM01361A2M_recep_2coord: 1500..1593
e-value: 2.7E-8
score: 43.6
IPR009048Alpha-macroglobulin, receptor-bindingPFAMPF07677A2M_recepcoord: 1500..1593
e-value: 1.2E-14
score: 54.8
IPR041555Macroglobulin domain MG3PFAMPF17791MG3coord: 257..333
e-value: 4.7E-13
score: 49.2
IPR036595Alpha-macroglobulin, receptor-binding domain superfamilyGENE3DG3DSA:2.60.40.690coord: 1464..1598
e-value: 2.3E-145
score: 487.7
IPR036595Alpha-macroglobulin, receptor-binding domain superfamilySUPERFAMILYSSF49410Alpha-macroglobulin receptor domaincoord: 1468..1598
IPR040839Macroglobulin domain MG4PFAMPF17789MG4coord: 386..475
e-value: 2.1E-12
score: 47.0
IPR011626Alpha-macroglobulin-like, TED domainPFAMPF07678TED_complementcoord: 1088..1388
e-value: 5.5E-86
score: 288.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 933..1575
e-value: 2.3E-145
score: 487.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 382..465
e-value: 5.4E-9
score: 38.0
IPR011625Alpha-2-macroglobulin, bait region domainPFAMPF07703A2M_BRDcoord: 489..755
e-value: 1.4E-8
score: 35.2
IPR019742Alpha-2-macroglobulin, conserved sitePROSITEPS00477ALPHA_2_MACROGLOBULINcoord: 1108..1116
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 590..601
IPR008930Terpenoid cyclases/protein prenyltransferase alpha-alpha toroidSUPERFAMILYSSF48239Terpenoid cyclases/Protein prenyltransferasescoord: 1098..1392
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 928..1024