KIAA1586

Overview
NameKIAA1586
Smed IDSMED30004345
Length (bp)2202
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of KIAA1586 (SMED30004345) t-SNE clustered cells

Violin plots show distribution of expression levels for KIAA1586 (SMED30004345) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of KIAA1586 (SMED30004345) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for KIAA1586 (SMED30004345) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004345

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004345 SmedASXL_012991SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of KIAA1586 vs. Ensembl Human
Match: KIAA1586 (KIAA1586 [Source:HGNC Symbol;Acc:HGNC:21360])

HSP 1 Score: 105.145 bits (261), Expect = 1.409e-39
Identity = 63/150 (42.00%), Postives = 93/150 (62.00%), Query Frame = 1
Query:  763 KGFKEVFLDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELSLCDA 1212
            K  ++  L KK+ +H  S  H K  +++++S   ++ NL+   N K I+ T K+FNTVYSL K N+ +S IE    LQ+ KN  +  CL +R++A +I EHI KE+K  +FK I  ENAKI IIIDE ST+  K+ L+I+ +C +    A
Sbjct:  196 KTTRQASLRKKIREHDVSKAHGKIQDLLKESTNDSICNLVHKQNNKNIDATVKVFNTVYSLVKHNRPLSDIEGARELQE-KNGEVN-CLNTRYSATRIAEHIAKEMKMKIFKNIIEENAKICIIIDEASTVSKKTTLVIYLQCTIQSAPA 343          

HSP 2 Score: 45.4394 bits (106), Expect = 1.409e-39
Identity = 28/68 (41.18%), Postives = 37/68 (54.41%), Query Frame = 3
Query: 1362 VLSQILEVFPNIIIWHSLIHRL*LVLDYSINDISEANHFYCSADACVSISFSLVPNPTINPGDAAEAI 1565
            V +++LE FP IIIW+ L HRL L LD SI++I + NH     D   SI      N T   G  A+ +
Sbjct:  402 VATKLLENFPEIIIWNCLNHRLQLSLDDSISEIKQINHLKIFIDKIYSIYHQPNKNQTKLLGTVAKEL 469          

HSP 3 Score: 42.743 bits (99), Expect = 1.409e-39
Identity = 18/27 (66.67%), Postives = 21/27 (77.78%), Query Frame = 2
Query: 1292 GFSNEYLSKNLIDFCSDGVSVMLGSKS 1372
            GF+NEYL  NLI FCSDG + +LG KS
Sbjct:  374 GFTNEYLKANLIAFCSDGANTILGRKS 400          

HSP 4 Score: 31.9574 bits (71), Expect = 1.409e-39
Identity = 14/30 (46.67%), Postives = 20/30 (66.67%), Query Frame = 3
Query:  582 DCENKNQLEIFSKKYVYLTIKNGKL*CSIC 671
            DC N+ Q  +F+++Y +L IK GKL C  C
Sbjct:  135 DCWNEKQAFMFTEQYKWLEIKEGKLGCKDC 164          
BLAST of KIAA1586 vs. Ensembl Human
Match: KIAA1586 (KIAA1586 [Source:HGNC Symbol;Acc:HGNC:21360])

HSP 1 Score: 104.76 bits (260), Expect = 1.411e-39
Identity = 63/150 (42.00%), Postives = 93/150 (62.00%), Query Frame = 1
Query:  763 KGFKEVFLDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELSLCDA 1212
            K  ++  L KK+ +H  S  H K  +++++S   ++ NL+   N K I+ T K+FNTVYSL K N+ +S IE    LQ+ KN  +  CL +R++A +I EHI KE+K  +FK I  ENAKI IIIDE ST+  K+ L+I+ +C +    A
Sbjct:  169 KTTRQASLRKKIREHDVSKAHGKIQDLLKESTNDSICNLVHKQNNKNIDATVKVFNTVYSLVKHNRPLSDIEGARELQE-KNGEVN-CLNTRYSATRIAEHIAKEMKMKIFKNIIEENAKICIIIDEASTVSKKTTLVIYLQCTIQSAPA 316          

HSP 2 Score: 45.8246 bits (107), Expect = 1.411e-39
Identity = 28/68 (41.18%), Postives = 37/68 (54.41%), Query Frame = 3
Query: 1362 VLSQILEVFPNIIIWHSLIHRL*LVLDYSINDISEANHFYCSADACVSISFSLVPNPTINPGDAAEAI 1565
            V +++LE FP IIIW+ L HRL L LD SI++I + NH     D   SI      N T   G  A+ +
Sbjct:  375 VATKLLENFPEIIIWNCLNHRLQLSLDDSISEIKQINHLKIFIDKIYSIYHQPNKNQTKLLGTVAKEL 442          

HSP 3 Score: 42.743 bits (99), Expect = 1.411e-39
Identity = 18/27 (66.67%), Postives = 21/27 (77.78%), Query Frame = 2
Query: 1292 GFSNEYLSKNLIDFCSDGVSVMLGSKS 1372
            GF+NEYL  NLI FCSDG + +LG KS
Sbjct:  347 GFTNEYLKANLIAFCSDGANTILGRKS 373          

HSP 4 Score: 31.5722 bits (70), Expect = 1.411e-39
Identity = 14/30 (46.67%), Postives = 20/30 (66.67%), Query Frame = 3
Query:  582 DCENKNQLEIFSKKYVYLTIKNGKL*CSIC 671
            DC N+ Q  +F+++Y +L IK GKL C  C
Sbjct:  108 DCWNEKQAFMFTEQYKWLEIKEGKLGCKDC 137          
BLAST of KIAA1586 vs. UniProt/SwissProt
Match: sp|Q9HCI6|K1586_HUMAN (E3 SUMO-protein ligase KIAA1586 OS=Homo sapiens OX=9606 GN=KIAA1586 PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 6.241e-39
Identity = 63/150 (42.00%), Postives = 93/150 (62.00%), Query Frame = 1
Query:  763 KGFKEVFLDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELSLCDA 1212
            K  ++  L KK+ +H  S  H K  +++++S   ++ NL+   N K I+ T K+FNTVYSL K N+ +S IE    LQ+ KN  +  CL +R++A +I EHI KE+K  +FK I  ENAKI IIIDE ST+  K+ L+I+ +C +    A
Sbjct:  196 KTTRQASLRKKIREHDVSKAHGKIQDLLKESTNDSICNLVHKQNNKNIDATVKVFNTVYSLVKHNRPLSDIEGARELQE-KNGEVN-CLNTRYSATRIAEHIAKEMKMKIFKNIIEENAKICIIIDEASTVSKKTTLVIYLQCTIQSAPA 343          

HSP 2 Score: 45.4394 bits (106), Expect = 6.241e-39
Identity = 28/68 (41.18%), Postives = 37/68 (54.41%), Query Frame = 3
Query: 1362 VLSQILEVFPNIIIWHSLIHRL*LVLDYSINDISEANHFYCSADACVSISFSLVPNPTINPGDAAEAI 1565
            V +++LE FP IIIW+ L HRL L LD SI++I + NH     D   SI      N T   G  A+ +
Sbjct:  402 VATKLLENFPEIIIWNCLNHRLQLSLDDSISEIKQINHLKIFIDKIYSIYHQPNKNQTKLLGTVAKEL 469          

HSP 3 Score: 42.743 bits (99), Expect = 6.241e-39
Identity = 18/27 (66.67%), Postives = 21/27 (77.78%), Query Frame = 2
Query: 1292 GFSNEYLSKNLIDFCSDGVSVMLGSKS 1372
            GF+NEYL  NLI FCSDG + +LG KS
Sbjct:  374 GFTNEYLKANLIAFCSDGANTILGRKS 400          

HSP 4 Score: 31.9574 bits (71), Expect = 6.241e-39
Identity = 14/30 (46.67%), Postives = 20/30 (66.67%), Query Frame = 3
Query:  582 DCENKNQLEIFSKKYVYLTIKNGKL*CSIC 671
            DC N+ Q  +F+++Y +L IK GKL C  C
Sbjct:  135 DCWNEKQAFMFTEQYKWLEIKEGKLGCKDC 164          
BLAST of KIAA1586 vs. TrEMBL
Match: A0A4X2L7A5 (Uncharacterized protein OS=Vombatus ursinus OX=29139 GN=LOC114052945 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.960e-40
Identity = 61/141 (43.26%), Postives = 92/141 (65.25%), Query Frame = 1
Query:  772 KEVFLDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXX-XXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKC 1191
            ++  L KKM +H  S  H K  +++++S   + ++  +   N K ++ T K+FNTVYSL K N+ +S IE V+ LQ+ K + IG+CL +R++A +I EHI KE+K  +FK I  ENAKI II+DE S I  KS L+I+ +C
Sbjct:  131 RQASLRKKMREHDVSKAHNKIQDLLKESPSSDSVSNFVPKPNNKNMDATVKVFNTVYSLVKCNRPLSDIEGVIELQEEKGVDIGSCLHTRYSATRIAEHIAKEIKMKVFKNIIEENAKICIIVDETSAISKKSTLVIYLQC 271          

HSP 2 Score: 48.1358 bits (113), Expect = 1.960e-40
Identity = 25/46 (54.35%), Postives = 29/46 (63.04%), Query Frame = 3
Query: 1371 QILEVFPNIIIWHSLIHRL*LVLDYSINDISEANHFYCSADACVSI 1508
            ++LE FP IIIWH L HRL L LD SI++I   NHF    D   SI
Sbjct:  340 KLLENFPKIIIWHCLNHRLQLSLDDSISEIERVNHFKMFLDKTYSI 385          

HSP 3 Score: 40.817 bits (94), Expect = 1.960e-40
Identity = 18/33 (54.55%), Postives = 22/33 (66.67%), Query Frame = 2
Query: 1274 SCMKNNGFSNEYLSKNLIDFCSDGVSVMLGSKS 1372
            S + + GF NEYL  NLI FCSDG   +LG +S
Sbjct:  303 SALNDCGFHNEYLKANLIAFCSDGADTVLGRRS 335          

HSP 4 Score: 36.5798 bits (83), Expect = 1.960e-40
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 2
Query:  665 DLSKISYLGAEATKHHQLSKPWTNNDVKSDGNSKASRKSSLIKK 796
            D S + +LG  A KH  +SK W    V  +G++K +R++SL KK
Sbjct:   95 DCSTVQHLGMRAEKHVHVSKEWIAYLVTPNGSNKITRQASLRKK 138          
BLAST of KIAA1586 vs. TrEMBL
Match: A0A4X2K3N5 (Uncharacterized protein OS=Vombatus ursinus OX=29139 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.957e-39
Identity = 61/147 (41.50%), Postives = 95/147 (64.63%), Query Frame = 1
Query:  772 KEVFLDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELSLCDA 1212
            ++  L KK+ +H  S  H K   ++++S   ++ N++  LN K I+ T ++F TVYSL KRN+ +S IE  + LQ+   + IG CL++R++A +I EHI KE+K  +FK I  ENAKI ++IDE++TI  KS L+I+ +C L    A
Sbjct:  221 RQASLRKKIREHDVSKAHTKIQNLLKESADDSISNIVHKLNNKNIDATVRVFKTVYSLVKRNRPLSDIEGAIELQEKNGIDIGNCLRTRYSATRIAEHIAKEIKMKMFKNIVEENAKICVVIDEVTTISKKSTLVIYLQCALQSAPA 367          

HSP 2 Score: 41.2022 bits (95), Expect = 1.957e-39
Identity = 19/33 (57.58%), Postives = 23/33 (69.70%), Query Frame = 2
Query: 1274 SCMKNNGFSNEYLSKNLIDFCSDGVSVMLGSKS 1372
            S + + GF NEYL  NLI FCSDG + +LG KS
Sbjct:  392 STLDDCGFDNEYLKANLIAFCSDGANKILGRKS 424          

HSP 3 Score: 41.2022 bits (95), Expect = 1.957e-39
Identity = 22/49 (44.90%), Postives = 29/49 (59.18%), Query Frame = 3
Query: 1362 VLSQILEVFPNIIIWHSLIHRL*LVLDYSINDISEANHFYCSADACVSI 1508
            V +++LE FP II W  L H+L L LD SI++I + NH     D   SI
Sbjct:  426 VATKLLENFPKIIFWPCLSHQLQLSLDDSISEIKQVNHLKIFLDKMYSI 474          

HSP 4 Score: 36.1946 bits (82), Expect = 1.957e-39
Identity = 18/44 (40.91%), Postives = 28/44 (63.64%), Query Frame = 2
Query:  665 DLSKISYLGAEATKHHQLSKPWTNNDVKSDGNSKASRKSSLIKK 796
            D S I +LG  A KH  +SK W+   +  +G++K +R++SL KK
Sbjct:  185 DCSTIRHLGMTAEKHIHVSKEWSAYLITPNGSNKITRQASLRKK 228          
BLAST of KIAA1586 vs. TrEMBL
Match: A0A5F5PHT7 (Zinc finger protein 451 OS=Equus caballus OX=9796 GN=ZNF451 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.046e-39
Identity = 65/150 (43.33%), Postives = 95/150 (63.33%), Query Frame = 1
Query:  763 KGFKEVFLDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELSLCDA 1212
            K  ++  L KK+ +H  S  H K  E++++SV  ++ NL+   N K I+ T K+FNTVYSL K N+ +S IE  + LQ+ +N  +  CL +R++A +I EHI KE+K  +FK I  ENAKI IIIDE ST+  KS L+I+ +C +    A
Sbjct:  169 KTTRQASLRKKIREHDVSKAHGKIQELLKESVNGSISNLVHKQNNKNIDATVKVFNTVYSLVKHNRPLSDIEGAVELQE-ENGEVN-CLNTRYSATRIAEHIAKEMKMKIFKNIIEENAKICIIIDEASTVSKKSTLVIYIQCTVQSAPA 316          

HSP 2 Score: 47.7506 bits (112), Expect = 4.046e-39
Identity = 25/49 (51.02%), Postives = 32/49 (65.31%), Query Frame = 3
Query: 1362 VLSQILEVFPNIIIWHSLIHRL*LVLDYSINDISEANHFYCSADACVSI 1508
            V +++LE FP IIIW+ L HRL L LD SI++I + NHF    D   SI
Sbjct:  375 VATKLLENFPEIIIWNCLNHRLQLSLDDSISEIKQVNHFKIFLDKIYSI 423          

HSP 3 Score: 45.4394 bits (106), Expect = 4.046e-39
Identity = 19/27 (70.37%), Postives = 22/27 (81.48%), Query Frame = 2
Query: 1292 GFSNEYLSKNLIDFCSDGVSVMLGSKS 1372
            GF+NEYL  NLI FCSDG ++MLG KS
Sbjct:  347 GFTNEYLKANLIAFCSDGANIMLGRKS 373          

HSP 4 Score: 32.3426 bits (72), Expect = 4.046e-39
Identity = 14/30 (46.67%), Postives = 20/30 (66.67%), Query Frame = 3
Query:  582 DCENKNQLEIFSKKYVYLTIKNGKL*CSIC 671
            DC N+ Q  +F+++Y +L IK GKL C  C
Sbjct:  108 DCWNEKQALMFTEQYKWLEIKEGKLGCKDC 137          
BLAST of KIAA1586 vs. TrEMBL
Match: F6X4K7 (Zinc finger protein 451 OS=Equus caballus OX=9796 GN=ZNF451 PE=4 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 4.994e-39
Identity = 65/150 (43.33%), Postives = 95/150 (63.33%), Query Frame = 1
Query:  763 KGFKEVFLDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELSLCDA 1212
            K  ++  L KK+ +H  S  H K  E++++SV  ++ NL+   N K I+ T K+FNTVYSL K N+ +S IE  + LQ+ +N  +  CL +R++A +I EHI KE+K  +FK I  ENAKI IIIDE ST+  KS L+I+ +C +    A
Sbjct:  196 KTTRQASLRKKIREHDVSKAHGKIQELLKESVNGSISNLVHKQNNKNIDATVKVFNTVYSLVKHNRPLSDIEGAVELQE-ENGEVN-CLNTRYSATRIAEHIAKEMKMKIFKNIIEENAKICIIIDEASTVSKKSTLVIYIQCTVQSAPA 343          

HSP 2 Score: 47.3654 bits (111), Expect = 4.994e-39
Identity = 25/49 (51.02%), Postives = 32/49 (65.31%), Query Frame = 3
Query: 1362 VLSQILEVFPNIIIWHSLIHRL*LVLDYSINDISEANHFYCSADACVSI 1508
            V +++LE FP IIIW+ L HRL L LD SI++I + NHF    D   SI
Sbjct:  402 VATKLLENFPEIIIWNCLNHRLQLSLDDSISEIKQVNHFKIFLDKIYSI 450          

HSP 3 Score: 45.4394 bits (106), Expect = 4.994e-39
Identity = 19/27 (70.37%), Postives = 22/27 (81.48%), Query Frame = 2
Query: 1292 GFSNEYLSKNLIDFCSDGVSVMLGSKS 1372
            GF+NEYL  NLI FCSDG ++MLG KS
Sbjct:  374 GFTNEYLKANLIAFCSDGANIMLGRKS 400          

HSP 4 Score: 32.3426 bits (72), Expect = 4.994e-39
Identity = 14/30 (46.67%), Postives = 20/30 (66.67%), Query Frame = 3
Query:  582 DCENKNQLEIFSKKYVYLTIKNGKL*CSIC 671
            DC N+ Q  +F+++Y +L IK GKL C  C
Sbjct:  135 DCWNEKQALMFTEQYKWLEIKEGKLGCKDC 164          
BLAST of KIAA1586 vs. TrEMBL
Match: A0A2I3H4R0 (KIAA1586 OS=Nomascus leucogenys OX=61853 GN=KIAA1586 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 9.587e-39
Identity = 63/147 (42.86%), Postives = 93/147 (63.27%), Query Frame = 1
Query:  772 KEVFLDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELSLCDA 1212
            ++  L KK+ +H  S  H K  +++++S   ++ NL+   N K I+ T K+FNTVYSL KRN+ +S IE    LQ+ K+  +  CL +R++A +I EHI KE+K  +FK I  ENAKI IIIDE ST+  KS L+I+ +C +    A
Sbjct:  172 RQASLRKKIREHDVSKAHGKIQDLLKESTNDSISNLVHKQNNKNIDATVKVFNTVYSLVKRNRPLSDIEGARELQE-KHGEVN-CLNTRYSATRIAEHIAKEMKMKIFKNIIEENAKICIIIDEASTVSKKSTLVIYLQCTIQSAPA 316          

HSP 2 Score: 45.8246 bits (107), Expect = 9.587e-39
Identity = 28/68 (41.18%), Postives = 37/68 (54.41%), Query Frame = 3
Query: 1362 VLSQILEVFPNIIIWHSLIHRL*LVLDYSINDISEANHFYCSADACVSISFSLVPNPTINPGDAAEAI 1565
            V +++LE FP IIIW+ L HRL L LD SI++I + NH     D   SI      N T   G  A+ +
Sbjct:  375 VATKLLENFPEIIIWNCLNHRLQLSLDDSISEIKQINHLKIFLDKIYSIYHQPNKNQTKLLGTVAKEL 442          

HSP 3 Score: 42.743 bits (99), Expect = 9.587e-39
Identity = 18/27 (66.67%), Postives = 21/27 (77.78%), Query Frame = 2
Query: 1292 GFSNEYLSKNLIDFCSDGVSVMLGSKS 1372
            GF+NEYL  NLI FCSDG + +LG KS
Sbjct:  347 GFTNEYLKANLIAFCSDGANTILGRKS 373          

HSP 4 Score: 36.965 bits (84), Expect = 9.587e-39
Identity = 18/44 (40.91%), Postives = 29/44 (65.91%), Query Frame = 2
Query:  665 DLSKISYLGAEATKHHQLSKPWTNNDVKSDGNSKASRKSSLIKK 796
            D S + +LG++A KH  +SK W    V  +G++K +R++SL KK
Sbjct:  136 DCSTVRHLGSKAEKHVHVSKEWIAYLVTPNGSNKITRQASLRKK 179          
BLAST of KIAA1586 vs. Ensembl Medaka
Match: ENSORLT00000029584.1 (pep primary_assembly:ASM223467v1:15:12688806:12690917:1 gene:ENSORLG00000022188.1 transcript:ENSORLT00000029584.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 7.497e-21
Identity = 45/139 (32.37%), Postives = 80/139 (57.55%), Query Frame = 1
Query:  784 LDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELS 1200
            L KK+ +H  S  H + V+I++ + K  L+N+ T       ETT ++F T Y +AK NK  +  E+++ LQ+  ++ +G  L S+   + IV+H+  ++K  +  KI    +KI ++ DE + +G+KS LI+F K  + 
Sbjct:   96 LRKKIHEHKNSAAHKEVVKILETAKKDTLVNMNTKSQDFAFETTARVFRTAYYVAKYNKPFTDFESLIDLQETNSINMGRVLHSKTVCVDIVDHVASQMKKEIMTKIIQNRSKITVLADESTNVGNKSTLIVFVKASVD 234          

HSP 2 Score: 43.1282 bits (100), Expect = 7.497e-21
Identity = 20/46 (43.48%), Postives = 28/46 (60.87%), Query Frame = 2
Query: 1277 CMKNNGFSNEYLSKNLIDFCSDGVSVMLGSKSDFRSFSKHNYLAFI 1414
            C+  NGF+ + L + LI FCSDG SVMLG KS      K ++ + +
Sbjct:  264 CLLKNGFTMQLLQELLIGFCSDGASVMLGVKSGVGKLLKDDFPSIV 309          
BLAST of KIAA1586 vs. Ensembl Medaka
Match: ENSORLT00000037733.1 (pep primary_assembly:ASM223467v1:17:413272:415622:1 gene:ENSORLG00000029136.1 transcript:ENSORLT00000037733.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 2.808e-20
Identity = 45/139 (32.37%), Postives = 79/139 (56.83%), Query Frame = 1
Query:  784 LDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELS 1200
            L KK+ +H  S  H + V+I++ + K  L+N+ T       ETT ++F T Y +AK NK  +  E+++ LQ+   + +G  L S+   + IV+H+  ++K  +  KI    +KI ++ DE + +G+KS LI+F K  + 
Sbjct:  131 LRKKIHEHKNSAAHKEVVKILETAKKDTLVNMNTKSQDFAFETTARVFRTAYYVAKYNKPFTDFESLIDLQETNLINMGRVLHSKTVCVDIVDHVASQMKKEIMTKIIQNRSKITVLADESTNVGNKSTLIVFVKASVD 269          

HSP 2 Score: 43.1282 bits (100), Expect = 2.808e-20
Identity = 20/46 (43.48%), Postives = 28/46 (60.87%), Query Frame = 2
Query: 1277 CMKNNGFSNEYLSKNLIDFCSDGVSVMLGSKSDFRSFSKHNYLAFI 1414
            C+  NGF+ + L + LI FCSDG SVMLG KS      K ++ + +
Sbjct:  299 CLLKNGFTMQLLQELLIGFCSDGASVMLGVKSGVGKLLKDDFPSIV 344          
BLAST of KIAA1586 vs. Ensembl Medaka
Match: ENSORLT00000039522.1 (pep primary_assembly:ASM223467v1:5:29857639:29864727:-1 gene:ENSORLG00000022850.1 transcript:ENSORLT00000039522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 5.277e-20
Identity = 45/135 (33.33%), Postives = 79/135 (58.52%), Query Frame = 1
Query:  784 LDKKMSKHFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSK 1188
            L KK+ +H  S  H + V+I++ + K  L+N+ T       ETT ++F T Y +AK NK  +  E+++ LQ+  ++ +G  L S+   + IV+H+  ++K  +  KI    +KI ++ DE + +G+KS LI+F K
Sbjct:  168 LRKKIHEHKNSAAHKEVVKILETAKKDTLVNMNTKSQDFAFETTARVFRTAYYVAKYNKPFTDFESLIDLQETNSINMGRVLHSKTVCVDIVDHVASQMKKEIMTKIIQNRSKITVLADESTNVGNKSTLIVFLK 302          

HSP 2 Score: 40.817 bits (94), Expect = 5.277e-20
Identity = 19/46 (41.30%), Postives = 27/46 (58.70%), Query Frame = 2
Query: 1277 CMKNNGFSNEYLSKNLIDFCSDGVSVMLGSKSDFRSFSKHNYLAFI 1414
            C+  NGF+ + L + LI FCSDG SV LG KS      K ++ + +
Sbjct:  336 CLLKNGFTMQLLQELLIGFCSDGASVTLGVKSGVGKLLKDDFPSIV 381          
BLAST of KIAA1586 vs. Ensembl Medaka
Match: ENSORLT00000029043.1 (pep primary_assembly:ASM223467v1:9:29758602:29763845:-1 gene:ENSORLG00000021804.1 transcript:ENSORLT00000029043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 4.239e-19
Identity = 41/132 (31.06%), Postives = 75/132 (56.82%), Query Frame = 1
Query:  805 HFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELS 1200
            H  S  H + V+I++ + K  L+N+ T       ETT ++F T Y +AK NK  +  E+++ LQ+  ++ +G  L S+   + IV+H+  ++K  +  K+    +KI ++ DE + +G+KS LI+F K  + 
Sbjct:  200 HKNSAAHKEVVKILETAKKDTLVNMNTKSQDFAFETTARVFRTAYYVAKYNKPFTDFESLIDLQETNSINMGRVLHSKTVCVDIVDHVASQMKKEIMTKVIQNRSKITVLADESTDVGNKSTLIVFVKASVD 331          

HSP 2 Score: 41.2022 bits (95), Expect = 4.239e-19
Identity = 20/46 (43.48%), Postives = 27/46 (58.70%), Query Frame = 2
Query: 1277 CMKNNGFSNEYLSKNLIDFCSDGVSVMLGSKSDFRSFSKHNYLAFI 1414
            C+  NGF  + L + LI FCSDG SVMLG KS      K ++ + +
Sbjct:  361 CLLKNGFIMQLLQELLIGFCSDGASVMLGVKSGVGKLLKDDFPSIV 406          
BLAST of KIAA1586 vs. Ensembl Medaka
Match: ENSORLT00000042190.1 (pep primary_assembly:ASM223467v1:9:29758602:29762240:-1 gene:ENSORLG00000021804.1 transcript:ENSORLT00000042190.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 4.494e-19
Identity = 41/132 (31.06%), Postives = 75/132 (56.82%), Query Frame = 1
Query:  805 HFTSGFHLKSVEIIQQSVKQXXXXXXXXXXKKEIETTTKIFNTVYSLAKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCELS 1200
            H  S  H + V+I++ + K  L+N+ T       ETT ++F T Y +AK NK  +  E+++ LQ+  ++ +G  L S+   + IV+H+  ++K  +  K+    +KI ++ DE + +G+KS LI+F K  + 
Sbjct:  170 HKNSAAHKEVVKILETAKKDTLVNMNTKSQDFAFETTARVFRTAYYVAKYNKPFTDFESLIDLQETNSINMGRVLHSKTVCVDIVDHVASQMKKEIMTKVIQNRSKITVLADESTDVGNKSTLIVFVKASVD 301          

HSP 2 Score: 41.2022 bits (95), Expect = 4.494e-19
Identity = 20/46 (43.48%), Postives = 27/46 (58.70%), Query Frame = 2
Query: 1277 CMKNNGFSNEYLSKNLIDFCSDGVSVMLGSKSDFRSFSKHNYLAFI 1414
            C+  NGF  + L + LI FCSDG SVMLG KS      K ++ + +
Sbjct:  331 CLLKNGFIMQLLQELLIGFCSDGASVMLGVKSGVGKLLKDDFPSIV 376          
BLAST of KIAA1586 vs. Planmine SMEST
Match: SMESG000013295.1 (SMESG000013295.1)

HSP 1 Score: 46.595 bits (109), Expect = 6.604e-6
Identity = 25/78 (32.05%), Postives = 48/78 (61.54%), Query Frame = 1
Query:  964 MSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLFKKITSENAKINIIIDELSTIGSKSVLIIFSKCEL 1197
            MS I   + LQ    +    C  S+++A++I+ +I++++  ++F KI S  +K  II+DE +T+   S LI++ +CE+
Sbjct:    1 MSDIVDEIDLQVENGVDCEICRHSQYSALKIIYNISEQMHKSIFSKIVSNQSKFCIILDETTTVSKLSTLIVYLRCEI 78          
The following BLAST results are available for this feature:
BLAST of KIAA1586 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
KIAA15861.409e-3942.00KIAA1586 [Source:HGNC Symbol;Acc:HGNC:21360][more]
KIAA15861.411e-3942.00KIAA1586 [Source:HGNC Symbol;Acc:HGNC:21360][more]
back to top
BLAST of KIAA1586 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KIAA1586 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KIAA1586 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KIAA1586 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KIAA1586 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KIAA1586 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9HCI6|K1586_HUMAN6.241e-3942.00E3 SUMO-protein ligase KIAA1586 OS=Homo sapiens OX... [more]
back to top
BLAST of KIAA1586 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4X2L7A51.960e-4043.26Uncharacterized protein OS=Vombatus ursinus OX=291... [more]
A0A4X2K3N51.957e-3941.50Uncharacterized protein OS=Vombatus ursinus OX=291... [more]
A0A5F5PHT74.046e-3943.33Zinc finger protein 451 OS=Equus caballus OX=9796 ... [more]
F6X4K74.994e-3943.33Zinc finger protein 451 OS=Equus caballus OX=9796 ... [more]
A0A2I3H4R09.587e-3942.86KIAA1586 OS=Nomascus leucogenys OX=61853 GN=KIAA15... [more]
back to top
BLAST of KIAA1586 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KIAA1586 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KIAA1586 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KIAA1586 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KIAA1586 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000029584.17.497e-2132.37pep primary_assembly:ASM223467v1:15:12688806:12690... [more]
ENSORLT00000037733.12.808e-2032.37pep primary_assembly:ASM223467v1:17:413272:415622:... [more]
ENSORLT00000039522.15.277e-2033.33pep primary_assembly:ASM223467v1:5:29857639:298647... [more]
ENSORLT00000029043.14.239e-1931.06pep primary_assembly:ASM223467v1:9:29758602:297638... [more]
ENSORLT00000042190.14.494e-1931.06pep primary_assembly:ASM223467v1:9:29758602:297622... [more]
back to top
BLAST of KIAA1586 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000013295.16.604e-632.05SMESG000013295.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004345 ID=SMED30004345|Name=KIAA1586|organism=Schmidtea mediterranea sexual|type=transcript|length=2202bp
TTTGAACAGAATATTTAAAAAAAATTTTGACAAATAAAATTATATATATT
ATAAATTAAAGTATTTTTAATTTATAGAGATTATTAAATTTTAAAATACA
AGTAATTTTTAAGAAAAAACTAATTAAAACAATTTTTAGTTATTTTAATT
TATAATTTTATTTAAACAACAATGAGAAGACTAGAAGTCGTACAAAATTT
CATCATAATTATTATGCAACTATTAAGATCAGATATCATTGAATGGTAGG
AAATGTAAAGTTAAAGGAGTATAGTATATAAAAGAATGGTCAACCTATTC
GTAAATTACTAGCTGTAACCAGTGATGAGGTGAAGCCGACTCGGTCCGGC
TTGCACGAGTCTTGTTAATTATTTTATGAATTTACGAGCCGGTTGAAGTG
AAAAAATGAAATGACAAAATACAATTATGAATTTTTTATCACTAAAAAAT
TCATGTTTAAATGACAAAGCAGATAAAAATGAAACAATAATTGAGGTAAT
GTAACCGGCACCACCACCCATATCTCTCATAGATAATGTAACAGATATTT
CAGTGACAACAAGTATTAAATCAATGGTTCAGATTGCGAGAATAAAAATC
AGTTAGAGATTTTTTCAAAAAAATATGTATATCTAACAATAAAAAATGGA
AAATTGTGATGTTCGATTTGTCAAAAATTTCCTATTTGGGTGCAGAAGCT
ACCAAACATCATCAACTTTCTAAACCGTGGACAAATAATGATGTTAAATC
TGATGGAAATTCAAAGGCTTCAAGGAAGTCTTCCTTGATAAAAAAATGTC
TAAACATTTCACTTCTGGTTTTCACTTGAAATCAGTTGAAATTATTCAAC
AAAGTGTAAAACAAAATCTGCTGAATTTGATAACTAATTTAAATAAAAAA
GAAATCGAAACAACAACCAAAATTTTCAATACGGTTTATAGCTTAGCTAA
AAGAAACAAATCAATGTCTCATATAGAAGCAGTTTTATTACTTCAAAAAA
TTAAAAATATGTACATTGGAACTTGTTTACAATCGCGATTTACAGCTATC
CAAATTGTAGAGCACATCACCAAAGAATTGAAATTTAACCTTTTTAAAAA
GATTACTAGTGAAAATGCCAAAATCAACATAATAATTGACGAATTATCAA
CAATTGGTAGCAAAAGTGTTTTAATAATATTCAGTAAATGTGAGCTGTCC
TTGTGTGATGCCTAGTGTTCATTTTCTTAGATCTATCTGAATTGGGATCA
ACAAATGATGAATTAATATATAAAGCTGTATGAAAAATAACGGATTTTCT
AATGAATATTTGTCAAAAAACTTAATTGATTTCTGTTCAGATGGGGTGAG
TGTTATGCTGGGTTCTAAGTCAGATTTTAGAAGTTTTTCCAAACATAATT
ATTTGGCATTCATTAATTCATAGACTATAACTTGTGCTCGATTATAGCAT
TAATGATATATCAGAGGCTAATCATTTTTATTGCTCGGCTGATGCTTGTG
TGAGCATTTCTTTTTCCTTGGTGCCGAATCCGACGATTAATCCGGGAGAT
GCTGCTGAAGCAATAATATTCAGAAGTTGTGCATTCCAGCGTTCAAATAT
ACACAACTGGAGCTCCTCTTCGTAAAAAGTTTCTAGGAGAAAGGTATTTT
GGTCAGAAATGACGAAGTACTGGGCACGACTCTCTGAAATGAGGTCGTCC
CTGATTCTGGTTAGTTTGTTTTCTCTGATTCAGCTTCTTCATTTTCTCCG
GGGCAAACCATGTCCCATTCAGGGGTTTTTACTTGTTTTGAAGAGTTTTC
ATCTCGGCTTCTAGCGTGAGGGAGTTTGACGACTAAGAAGATATGGTGTT
GCAATGTTGGTAGTTTCGTTATCTTGAAGGTAGAATTATTCATTTCTCTT
TTATTGTAGATTAGCGTAAATTATTTCTCTACACCTTAGAGTTTATCCCA
CTGAACTTACAAAGAATATTGTCAAAGCGAGTTTGATTGTTTCTATATTA
TAAGGTTATTTACTCTGTTCTTATATTAGTGCAGTTTAGTGTAATATTTT
TTATAAATGATTCCTTCTCTGTATATGGCCCAAAAACTTCTAAAATGGTG
CTCGTCCGTAAATAAAATAATTTTCATATAAATAAATCAACAATTCAAAT
AAAATCTATTTTGGTATTGGTAATCAAAATATTATCTTTTGTTTTCTTCA
GG
back to top

protein sequence of SMED30004345-orf-1

>SMED30004345-orf-1 ID=SMED30004345-orf-1|Name=SMED30004345-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MSKHFTSGFHLKSVEIIQQSVKQNLLNLITNLNKKEIETTTKIFNTVYSL
AKRNKSMSHIEAVLLLQKIKNMYIGTCLQSRFTAIQIVEHITKELKFNLF
KKITSENAKINIIIDELSTIGSKSVLIIFSKCELSLCDA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016925protein sumoylation
Vocabulary: molecular function
TermDefinition
GO:0061665SUMO ligase activity
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR46880FAMILY NOT NAMEDcoord: 2..133
NoneNo IPR availablePANTHERPTHR46880:SF5E3 SUMO-PROTEIN LIGASE KIAA1586coord: 2..133