TBC1 domain family member 2B

Overview
NameTBC1 domain family member 2B
Smed IDSMED30004335
Length (bp)2525
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TBC1 domain family member 2B (SMED30004335) t-SNE clustered cells

Violin plots show distribution of expression levels for TBC1 domain family member 2B (SMED30004335) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TBC1 domain family member 2B (SMED30004335) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TBC1 domain family member 2B (SMED30004335) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004335

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004335SMESG000012909.1 dd_Smed_v4_2925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30004335SMESG000012909.1 dd_Smed_v4_2925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Match: SGSM3 (small G protein signaling modulator 3 [Source:HGNC Symbol;Acc:HGNC:25228])

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 427/762 (56.04%), Postives = 565/762 (74.15%), Query Frame = 1
Query:  172 FAALTSSMWPQNIEIPLTEDE--SDEVEFSYDEFGFRVIDGQTRQKY--------VLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            F+ALT S+WPQ I    T+ E  +++ EF YDEFGFRV   +  +          ++E+   RL+W AHLEFT++ ++ G+L+WD I + +  S KL+S++   GIPH +RPQLWMR+SGAL K++N + SY+EIV  +++D  + +KQIEKDL+RT+PSN CF+ + S G+PRLRR+LR LAWLYP+IGYCQG G++ + LLLFLEEED FW+M AIIEDLLP SY+ST L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++I+ LLR+WDLFFYEGS VLF++ LGM+ LKE E+++ +N+A IFN LS +PS++ D   L+ V+  L   LT   ++  R+K+LA ++ ++G  +          + +R+ +R +S I+ LL+          +D++++K KNI+QTE++ DLR +IL++ RHF+  +  +       PDYS+ SH  D E YV  SR+ ++RAKA+LDFERHDDDELGF+KNDII I+S KDEHCW+GELNGLRGWFPAKFVE+LDERSK+Y  AGDDSV E +TDL+RG  CPALKA+FEHG+K+  LL   CHPWLFIEEAA REVE+DF SVYSRL+LCKTFRLDEDGKVLTPEE+L++A+QSVN THD  HAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+L  F+F LS DWEL                  ++  + ++E +R++L+ H+LFSW++
Sbjct:   12 FSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDV-GDLTWDKIAVSLPRSEKLRSLVLA-GIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGVAMRLAGSLTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLF--------GEDDLEALKAKNIKQTELVADLREAILRVARHFQCTDPKNC-SVELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASVYSRLVLCKTFRLDEDGKVLTPEELLYRAVQSVNVTHDAVHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELPA---------------KREAQQPLKEGVRDMLVKHHLFSWDV 747          
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Match: SGSM3 (small G protein signaling modulator 3 [Source:HGNC Symbol;Acc:HGNC:25228])

HSP 1 Score: 314.694 bits (805), Expect = 7.390e-101
Identity = 155/255 (60.78%), Postives = 206/255 (80.78%), Query Frame = 1
Query:  310 LENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLK 1074
            +E+   RL+W AHLEFT++ ++ G+L+WD I + +  S KL+S++   GIPH +RPQLWMR+SGAL K++N + SY+EIV  +++D  + +KQIEKDL+RT+PSN CF+ + S G+PRLRR+LR LAWLYP+IGYCQG G++ + LLLFLEEED FW+M AIIEDLLP SY+ST L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++I+ LLR+WDLFFYEGS VLF++ LGM+ LK
Sbjct:    1 MEDAPQRLRWQAHLEFTHNHDV-GDLTWDKIAVSLPRSEKLRSLVLA-GIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLK 253          
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Match: SGSM3 (small G protein signaling modulator 3 [Source:HGNC Symbol;Acc:HGNC:25228])

HSP 1 Score: 264.618 bits (675), Expect = 1.789e-82
Identity = 127/164 (77.44%), Postives = 143/164 (87.20%), Query Frame = 1
Query: 1807 ITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWEL 2298
            +TDL+RG  CPALKA+FEHG+K+  LL   CHPWLFIEEAA REVE+DF SVYSRL+LCKTFRLDEDGKVLTPEE+L++A+QSVN THD  HAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+L  F+F LS DWEL
Sbjct:    1 VTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASVYSRLVLCKTFRLDEDGKVLTPEELLYRAVQSVNVTHDAVHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWEL 164          
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Match: TBC1D2 (TBC1 domain family member 2 [Source:HGNC Symbol;Acc:HGNC:18026])

HSP 1 Score: 172.94 bits (437), Expect = 8.263e-46
Identity = 112/352 (31.82%), Postives = 185/352 (52.56%), Query Frame = 1
Query:  226 EDESDEVEFS----YDEFGFRVI------DGQTRQK-YVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDT-FWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQI 1245
            E  SD +E S    YDE+GF  +      D +   K   LE+ +H L  L  ++    +       W  +  ++ PS +LK ++   G+P   RP++W  +    ++  +    Y+E+++   +     ++QIE DL RT P+N  F+  +S+   +LRR+L   +W  P IGYCQG+  + +  LL LEEE++ FW + AI+E ++P  YY   L   Q DQ  L++L+ + LP++   L +H +++SL+T +WFL +F   L    LLRVWD F YEG+ V+FR  L + +  E E+L   N  +I+  L      I++  KL+        ++ F+ +   R K L Q+
Sbjct:   86 EASSDSIELSPISKYDEYGFLTVPDYEVEDLKLLAKIQALESRSHHLLGLEAVDRPLRER------WAALGDLV-PSAELKQLLRA-GVPREHRPRVWRWLVHLRVQHLHTPGCYQELLSRGQAREHPAARQIELDLNRTFPNNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLEEEESAFWCLVAIVETIMPADYYCNTLTASQVDQRVLQDLLSEKLPRLMAHLGQHHVDLSLVTFNWFLVVFADSLISNILLRVWDAFLYEGTKVVFRYALAIFKYNEKEILRLQNGLEIYQYLRFFTKTISNSRKLM--------NIAFNDMNPFRMKQLRQL 421          
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Match: TBC1D2 (TBC1 domain family member 2 [Source:HGNC Symbol;Acc:HGNC:18026])

HSP 1 Score: 174.481 bits (441), Expect = 7.075e-45
Identity = 113/352 (32.10%), Postives = 185/352 (52.56%), Query Frame = 1
Query:  226 EDESDEVEFS----YDEFGF------RVIDGQTRQK-YVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDT-FWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQI 1245
            E  SD +E S    YDE+GF       V D +   K   LE+ +H L  L  ++    +       W  +  ++ PS +LK ++   G+P   RP++W  +    ++  +    Y+E+++   +     ++QIE DL RT P+N  F+  +S+   +LRR+L   +W  P IGYCQG+  + +  LL LEEE++ FW + AI+E ++P  YY   L   Q DQ  L++L+ + LP++   L +H +++SL+T +WFL +F   L    LLRVWD F YEG+ V+FR  L + +  E E+L   N  +I+  L      I++  KL+        ++ F+ +   R K L Q+
Sbjct:  328 EASSDSIELSPISKYDEYGFLTVPDYEVEDLKLLAKIQALESRSHHLLGLEAVDRPLRER------WAALGDLV-PSAELKQLLR-AGVPREHRPRVWRWLVHLRVQHLHTPGCYQELLSRGQAREHPAARQIELDLNRTFPNNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLEEEESAFWCLVAIVETIMPADYYCNTLTASQVDQRVLQDLLSEKLPRLMAHLGQHHVDLSLVTFNWFLVVFADSLISNILLRVWDAFLYEGTKVVFRYALAIFKYNEKEILRLQNGLEIYQYLRFFTKTISNSRKLM--------NIAFNDMNPFRMKQLRQL 663          
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Match: tbc-18 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:Q94222])

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 355/807 (43.99%), Postives = 527/807 (65.30%), Query Frame = 1
Query:  142 YLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDGQ-----------TRQKYV---LENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIK---LKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQ----IFNCLSKLPSEITDINKLI--LVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVD--PNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKC-HPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLD---VVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTG------EYILNQQVA----------EKMRENIREILMHHNLFSWEL 2427
            Y + + +P  F+A+  +M P  IE PL        EF +DEFGFR  D             +  K++   LEN  H+L+ +++L+  + K ++ ++ W  I   + P +K    + ++ E GIPHS+RP LW R+SGA  K+K+ K +Y+ ++     D      QIE+DL+RTLP+N+CF   +S GI  LRRIL+ +A++YPD+GYCQGMGVIV+ LLL+  EE TFW+M A+IED+LP ++Y+  L+G+QAD+   R L+  ++P +++ L ++++E+SL+T+ W LT+FGS+   R +LRVWD  FY G + +FR+I+ ++++KE E++E   T Q    IF  LS+LP+ +T++ K+I  + S+E T  +T   I  LRKK+ A +M ++G+ V+   + NLPKQ   +R+L RS+S+I Q+     +S   ++ND  S   KNIRQTE+LVDL+ S+LQI R+F + +     +  TQ DYS  SH +D+  Y++  R   KRA+A+LDF R +++ELGF+KNDI+ IIS KDEHCW+GE+NGLRGWFPAKFVE++DER K Y   GD++V+ EIT+ IRG    + + I +HG++   L  S   HPW FIE+ A   VEK+F+SVYSRL LC TF LDEDGK+LTPEE+LF+++Q +N +H+   A  DVKLRSL+  G+N+Q +HLW + LCS+     +  K+YH W+FIRSP W QIKC+LRLLSQFSF LS  +E+  +D    K   G      + IL+  V+          E +++ + ++L+ H+LFSW+L
Sbjct:   44 YFELDGKP--FSAINKAMLPIYIEDPL--------EF-FDEFGFRKQDDDHDPNLGDEEETSSAKHLSEPLENSTHKLKLISYLQDVH-KEVKDDVLWSHI---LGPELKTDRFEELLKEGGIPHSMRPFLWPRLSGATKKQKDAKYTYESVLQQCAQDKPSIGVQIERDLLRTLPNNICFWKKNSEGIEALRRILKCVAFIYPDLGYCQGMGVIVATLLLYCSEETTFWMMTALIEDILPPNFYTQTLLGLQADERVSRHLMKCHVPDLNKALEDYEVEVSLLTVSWLLTLFGSVFRTRVMLRVWDFIFYSGGVNIFRVIISILKMKEQEIVEIAETTQSSADIFTALSQLPASVTEVEKVIEYMGSFEFT--ITDHLIAELRKKHQAVLMADQGMIVNTATDTNLPKQTTQRRKLTRSKSIIKQIF----SSKDETANDPKS---KNIRQTEILVDLKESVLQICRYFISCDEKMELNVCTQADYSPESHNKDIANYLKGRRVGAKRARALLDFAREEENELGFRKNDIVTIISEKDEHCWVGEVNGLRGWFPAKFVEVVDERGKSYTIYGDEAVSPEITEYIRGRLANSFRQIMDHGIRENALYTSMAYHPWSFIEDIAYYSVEKNFNSVYSRLTLCNTFNLDEDGKILTPEELLFRSVQLINDSHNAVSAHSDVKLRSLLVVGVNEQCIHLWFDLLCSATQHEHIRNKYYHSWAFIRSPAWRQIKCDLRLLSQFSFNLSMSFEIEGIDKKKRKFVNGLLTSQKKKILSTVVSSSQDNKQNGEEPLKQGVTDMLIKHHLFSWDL 826          
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Match: tbc-2 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:Q23419])

HSP 1 Score: 154.451 bits (389), Expect = 2.321e-38
Identity = 96/289 (33.22%), Postives = 150/289 (51.90%), Query Frame = 1
Query:  403 EIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTS---YKEIVNATTSDHIMCS-----KQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQI 1245
            +  I  S  LK++I   G+P + R ++W  +    +K K  +     Y+ ++    +     S     KQI+ DL RTLP+N  F    S  I +LR +L    +    +GYCQG+  + +  LL L+E+D+FW + A +E L P  YY+++LIG  ADQ  LR+L+ + LPK+   L   ++++SL  L WFLT F  +L     L ++D F YEG+ VLFR  L + ++ E  +L+      +  CLSK    I D   L  V++         TI+  R+ YL Q+
Sbjct:  614 QTAIMSSPDLKTLIR-TGVPPAYRGRVWKIIVTHWVKDKQAELGNGYYQSMLRKAGTKKQDGSYDAAIKQIDLDLARTLPTNKLFDEPDSANIEKLRNVLYAFRYHNSHVGYCQGLNRLAAIALLNLDEQDSFWFLVACVEHLQPEGYYTSSLIGAVADQKVLRDLVAEKLPKLAAHLRALEVDLSLFALSWFLTCFVDVLPHSIYLTIFDAFLYEGNKVLFRFALALFKICEPHVLQCKTIGTVHQCLSKAQEHIIDFKSLAQVAFNELNPFPQKTIETKRQLYLTQL 901          
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Match: tbc-2 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:Q23419])

HSP 1 Score: 154.451 bits (389), Expect = 2.321e-38
Identity = 96/289 (33.22%), Postives = 150/289 (51.90%), Query Frame = 1
Query:  403 EIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTS---YKEIVNATTSDHIMCS-----KQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQI 1245
            +  I  S  LK++I   G+P + R ++W  +    +K K  +     Y+ ++    +     S     KQI+ DL RTLP+N  F    S  I +LR +L    +    +GYCQG+  + +  LL L+E+D+FW + A +E L P  YY+++LIG  ADQ  LR+L+ + LPK+   L   ++++SL  L WFLT F  +L     L ++D F YEG+ VLFR  L + ++ E  +L+      +  CLSK    I D   L  V++         TI+  R+ YL Q+
Sbjct:  614 QTAIMSSPDLKTLIR-TGVPPAYRGRVWKIIVTHWVKDKQAELGNGYYQSMLRKAGTKKQDGSYDAAIKQIDLDLARTLPTNKLFDEPDSANIEKLRNVLYAFRYHNSHVGYCQGLNRLAAIALLNLDEQDSFWFLVACVEHLQPEGYYTSSLIGAVADQKVLRDLVAEKLPKLAAHLRALEVDLSLFALSWFLTCFVDVLPHSIYLTIFDAFLYEGNKVLFRFALALFKICEPHVLQCKTIGTVHQCLSKAQEHIIDFKSLAQVAFNELNPFPQKTIETKRQLYLTQL 901          
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Match: tbc-9 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:A0A061ACS9])

HSP 1 Score: 145.206 bits (365), Expect = 2.380e-35
Identity = 86/254 (33.86%), Postives = 146/254 (57.48%), Query Frame = 1
Query:  406 IIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLI 1167
            + ++ +++L  ++ E G+P  LR Q+WM  SGA  +       Y+E+++     + +  ++IE+DL R+LP +  F      GI  LRRIL   A+  P+IGYCQ M ++ S LLLF +EE+ FWL+ A+ E LLP  YY+T ++G   DQ    EL+ + LP +   L    ++  ++ L WFLT+F S +     +R+ DLFF+EG+ ++F++ L M++  E  + E  +  +I   L+K    I + + ++
Sbjct:  285 VCMYRTVELHRLLLE-GVPLQLRGQIWMVCSGAAAEMALNPGYYRELLHKNQGVYSVALEEIERDLHRSLPEHPAFQQ--GPGIDALRRILTAYAFRNPNIGYCQAMNIVGSVLLLFTKEEEAFWLLVAVCERLLP-DYYNTKVVGALVDQGVFSELVERLLPTVGAQLTRLGLD-DMVALSWFLTVFLSAIKFDAAVRILDLFFFEGARLMFQVALEMLKENEKLICESRDDGEILMSLAKYTESIYEGDTVV 533          
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Match: tbc-9 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:A0A061ACS9])

HSP 1 Score: 145.206 bits (365), Expect = 2.803e-35
Identity = 86/254 (33.86%), Postives = 146/254 (57.48%), Query Frame = 1
Query:  406 IIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLI 1167
            + ++ +++L  ++ E G+P  LR Q+WM  SGA  +       Y+E+++     + +  ++IE+DL R+LP +  F      GI  LRRIL   A+  P+IGYCQ M ++ S LLLF +EE+ FWL+ A+ E LLP  YY+T ++G   DQ    EL+ + LP +   L    ++  ++ L WFLT+F S +     +R+ DLFF+EG+ ++F++ L M++  E  + E  +  +I   L+K    I + + ++
Sbjct:  285 VCMYRTVELHRLLLE-GVPLQLRGQIWMVCSGAAAEMALNPGYYRELLHKNQGVYSVALEEIERDLHRSLPEHPAFQQ--GPGIDALRRILTAYAFRNPNIGYCQAMNIVGSVLLLFTKEEEAFWLLVAVCERLLP-DYYNTKVVGALVDQGVFSELVERLLPTVGAQLTRLGLD-DMVALSWFLTVFLSAIKFDAAVRILDLFFFEGARLMFQVALEMLKENEKLICESRDDGEILMSLAKYTESIYEGDTVV 533          
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Match: CG12241 (gene:FBgn0038304 transcript:FBtr0083051)

HSP 1 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 419/769 (54.49%), Postives = 573/769 (74.51%), Query Frame = 1
Query:  172 FAALTSSMWPQNI------EIPLTEDESDEVEFSYDEFGFRVI--DG--QTRQKYV----LENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFV---DPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            F+ALT+SMWPQ I         L    +D+ E+ +DEFGFRV   DG  Q+  K +    +E+   RLQW+AHLEF+++K    ELSW+ +++++  + KL++M+ + GIPH+LR Q+WMR+SGAL K++  +TSY +IV A+++D +M SKQIEKDL+R LP+N CFS+ + TGIPRLRRILRG+AWL+PDIGYCQG GVIV+ LLLF+EEE+ FW+M  I+EDLLP SYYS+ L+G+QADQ  +  LI  YL  + E L +HDIE+SLITLHWFLT+F ++++++ L+R+WD FFYEGS+VLF++ LGM+++KE ++   +N+AQIFN LS +P E+TD+  L   + E+   L+ + I   R+++LA +M ++G  +   +   NLPKQ + +RQ+++S+S++   L+  +       N+ D +K KNIRQTE+LVDLR +IL++ RHF       + H     +YS  SHA+D E ++ V+R R++RAKA+ DFERHDDDELGF++NDII IIS KDEHCW+GELNGLRGWFPAKFVE+LDERSK Y +AGDD+++E +TDL+RG   PA+KA  EHGMKR   L    HPWL+IEEAA+REVEKDF SVYSRL+LCKT+RLDEDGKVLTPEE+L++ +Q++N THD+AHAQMDVKLRSLIC GLN+QVLHLWLE LC+  +VV+KWYH WSFI SPGWVQIKCELR+LSQF+F L+ DWEL      +              ++ +++ +R++L+ H+LFSW+L
Sbjct:   58 FSALTASMWPQEILAKLGGGAELASGPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKE-AAELSWEHVDVMLPRTEKLRNMVRQ-GIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQIGNPEAAPNLPKQQLARRQVRKSKSILEAFLFRGDG------NEGDQLKNKNIRQTEILVDLREAILKVGRHFITIEPKLAGHIQLTANYSTESHAKDHENFINVARTRKRRAKALHDFERHDDDELGFRRNDIITIISQKDEHCWVGELNGLRGWFPAKFVELLDERSKLYTSAGDDAISETVTDLVRGTLAPAIKAFLEHGMKRPTFLGGPIHPWLYIEEAATREVEKDFESVYSRLVLCKTYRLDEDGKVLTPEELLYRCVQAINQTHDDAHAQMDVKLRSLICLGLNEQVLHLWLEVLCACQEVVQKWYHSWSFIDSPGWVQIKCELRILSQFAFNLNPDWELPPKRGKE--------------SQPLKDGVRDMLVKHHLFSWDL 804          
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Match: CG7324 (gene:FBgn0037074 transcript:FBtr0331797)

HSP 1 Score: 139.428 bits (350), Expect = 2.936e-33
Identity = 90/296 (30.41%), Postives = 159/296 (53.72%), Query Frame = 1
Query:  208 IEIPLTEDESD-EVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIV-NATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEML 1089
            + +PL+ + +  ++ +S           Q   + + + E   ++W AH    + + +    + D I +I+             GIP  LR ++W+  SGA+  ++     Y+++V  A    +     +I++DL R+LP +  F   S+ GI  LRR+L+  A   P +GYCQ M ++ S  LLF +EE+ FW++ ++ E+LLP  YY   ++G Q DQ  L EL+  +LP +H  L +  + I +I++ WFLTIF S+++  + L + D FFYEG+ ++F I L +I+    ++L
Sbjct:  392 VHVPLSRERAKYDISWSKQTALMNTFKTQFSAEIIQKQEEKMVRWEAHFR-DFGRGIGMFRTTDVINLIVE------------GIPDKLRQEIWLIFSGAIHDKEMNPGLYEDLVEKAACIKNCFAHDEIDRDLPRSLPEHPAFQ--STDGIGALRRVLQAYALRNPQVGYCQAMNIVSSVFLLFCDEENAFWMLASLCENLLP-DYYKDKVVGAQIDQGVLNELVETHLPDLHGHLEQLGV-IKMISISWFLTIFMSVISYESSLHILDCFFYEGAKIIFMISLQIIEWNRDKLL 670          
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Match: CG7324 (gene:FBgn0037074 transcript:FBtr0078404)

HSP 1 Score: 139.428 bits (350), Expect = 3.003e-33
Identity = 90/296 (30.41%), Postives = 159/296 (53.72%), Query Frame = 1
Query:  208 IEIPLTEDESD-EVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIV-NATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEML 1089
            + +PL+ + +  ++ +S           Q   + + + E   ++W AH    + + +    + D I +I+             GIP  LR ++W+  SGA+  ++     Y+++V  A    +     +I++DL R+LP +  F   S+ GI  LRR+L+  A   P +GYCQ M ++ S  LLF +EE+ FW++ ++ E+LLP  YY   ++G Q DQ  L EL+  +LP +H  L +  + I +I++ WFLTIF S+++  + L + D FFYEG+ ++F I L +I+    ++L
Sbjct:  392 VHVPLSRERAKYDISWSKQTALMNTFKTQFSAEIIQKQEEKMVRWEAHFR-DFGRGIGMFRTTDVINLIVE------------GIPDKLRQEIWLIFSGAIHDKEMNPGLYEDLVEKAACIKNCFAHDEIDRDLPRSLPEHPAFQ--STDGIGALRRVLQAYALRNPQVGYCQAMNIVSSVFLLFCDEENAFWMLASLCENLLP-DYYKDKVVGAQIDQGVLNELVETHLPDLHGHLEQLGV-IKMISISWFLTIFMSVISYESSLHILDCFFYEGAKIIFMISLQIIEWNRDKLL 670          
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Match: CG5916 (gene:FBgn0038401 transcript:FBtr0344009)

HSP 1 Score: 121.709 bits (304), Expect = 7.423e-30
Identity = 83/271 (30.63%), Postives = 136/271 (50.18%), Query Frame = 1
Query:  427 KLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFL-EEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSE---ITDINKLILVSYELTEDLTFSTIQALRK 1227
            KLK  I + GIP   RP +WM++SGA   ++     ++ ++     D  + S  I  DL RT P N+ F         RL  IL   A    D+GYCQG+  I   LL+   +EE +FWL+  I+E+++P  Y+S N+  +  D    REL+ + +P ++  +    +   +I   WF+ IF  +L +  +LR+WD  F EG  ++FR  L M    ++ +L  D+ A + N       +   +TD +  +   + L   L  S +++LRK
Sbjct:   62 KLKRYIRK-GIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI-SDSISIDLPRTFPDNIHFD----MKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVP-QYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSLR--LKRSELESLRK 323          
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Match: CG5916 (gene:FBgn0038401 transcript:FBtr0083251)

HSP 1 Score: 121.709 bits (304), Expect = 7.423e-30
Identity = 83/271 (30.63%), Postives = 136/271 (50.18%), Query Frame = 1
Query:  427 KLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFL-EEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSE---ITDINKLILVSYELTEDLTFSTIQALRK 1227
            KLK  I + GIP   RP +WM++SGA   ++     ++ ++     D  + S  I  DL RT P N+ F         RL  IL   A    D+GYCQG+  I   LL+   +EE +FWL+  I+E+++P  Y+S N+  +  D    REL+ + +P ++  +    +   +I   WF+ IF  +L +  +LR+WD  F EG  ++FR  L M    ++ +L  D+ A + N       +   +TD +  +   + L   L  S +++LRK
Sbjct:   62 KLKRYIRK-GIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI-SDSISIDLPRTFPDNIHFD----MKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVP-QYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSLR--LKRSELESLRK 323          
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:406635])

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 428/778 (55.01%), Postives = 569/778 (73.14%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNIEIPLTE-DESDEVEFSYDEFGFRVI--DGQTRQKYVL-------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEG-LFVDPNHNLPKQL--INKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G Y      P  F+ALT SMWPQ+I     + D   EVE  YDEFGFR+   DG   +K++        E+   RL+W AHLEFT++  + G+L+WD I   +  S +L+S++   GIPHS+RPQLWMR+SGAL K++    SY+EIV  +++D    +KQIEKDL+RT+P+N CF+ ++S G+P+LRR+LRGLAWLYPDIGYCQG G++VS LLLFLEEED  W+MCA+IEDLLP SY+S+ L+GVQ DQ  LR+LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++IR LLR+WDL FYEGS+VLF++ LGM+++KE E++  +N+A IFN LS LPS++ D   ++  +  L   L+   +   R K+LA I+  +  L  + +H+L   L  + +RQ  R +S +S LLW          ++++++K KNI+QTE++  LR +I +   HF   +  +    +  PDYS+ SH  D E ++ VSRNR++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVEILDERSK+Y  AGDD+V E + DL+RG  CPALKAIF+HG+K+  +L   CHPWLFIEEAAS+EVE+DF+SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN +HD AH QMDVK RSLIC GLN+QVLHLWLE LCSS+  V+KWYHPWSF+RSPGWVQIKCELR+LS+F+F LS D EL T      ++              ++E ++++L+ H+LFSW++
Sbjct:    2 SGSYTPAPGGP--FSALTPSMWPQDILAKYCQKDPGTEVELQYDEFGFRIDSEDGVETRKWLCGDGAPQREDPQQRLRWQAHLEFTHNHTV-GDLTWDKITPTLARSDRLRSLVLG-GIPHSMRPQLWMRLSGALQKKRTSDISYREIVKNSSNDDTTAAKQIEKDLLRTMPTNACFNTLTSVGVPKLRRVLRGLAWLYPDIGYCQGTGMVVSCLLLFLEEEDALWMMCALIEDLLPPSYFSSTLLGVQTDQRVLRQLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIRILLRIWDLLFYEGSMVLFQVTLGMLKIKEDELVSSENSASIFNTLSDLPSQLEDGAAVLGEAVRLAGSLSQENLDTHRHKHLAYILAEQAQLNSNNSHSLNTNLNKVVRRQNMRRKSTLSSLLW--------GEDEVEALKAKNIKQTELVAALREAINRTAEHFHCLDPRNC-STDLTPDYSMESHQRDHENFLVVSRNRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEILDERSKEYSLAGDDTVTEAVNDLVRGSLCPALKAIFQHGLKKPSILGGPCHPWLFIEEAASKEVERDFNSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDTAHVQMDVKFRSLICVGLNEQVLHLWLEVLCSSMSAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQDCELPTKKEEKEQRP-------------LKEGVQDMLVKHHLFSWDI 753          
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:406635])

HSP 1 Score: 260.381 bits (664), Expect = 1.677e-81
Identity = 124/169 (73.37%), Postives = 147/169 (86.98%), Query Frame = 1
Query: 1798 NEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVT 2304
             E + DL+RG  CPALKAIF+HG+K+  +L   CHPWLFIEEAAS+EVE+DF+SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN +HD AH QMDVK RSLIC GLN+QVLHLWLE LCSS+  V+KWYHPWSF+RSPGWVQIKCELR+LS+F+F LS D EL T
Sbjct:    2 TEAVNDLVRGSLCPALKAIFQHGLKKPSILGGPCHPWLFIEEAASKEVERDFNSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDTAHVQMDVKFRSLICVGLNEQVLHLWLEVLCSSMSAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQDCELPT 170          
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Match: tbc1d2 (TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-100])

HSP 1 Score: 165.622 bits (418), Expect = 1.074e-41
Identity = 111/348 (31.90%), Postives = 178/348 (51.15%), Query Frame = 1
Query:  256 YDEFGFRV-IDGQT--------------RQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIK--RKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEE-DTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQI 1245
            YDE+GFR+ +D +               R + +L  E      LA          EGEL+          S ++K ++   G+PH  R ++W  M     K  R+     Y E+   + S   +  +QI+ DL RTL SN  FS  +S  I +L R+L+  +W  P IGY QG+  + +  LL L+EE D FW +  I+E ++P +Y++ +L+G QADQ  L++L+ + LP++   L    ++ISLIT+ WFL +F   L  R L +VWD   YEGS V+FR  L + + +E  +L+  ++ +++  L   P+ I D  KL  +++     L    IQ  R  +L ++
Sbjct:  552 YDEYGFRIAVDYKVEDLKLLAKIQALEFRSQNLLNQEECDGPLLARCAQLLFGRPEGELT---------SSAEMKGLLR-TGLPHEYRVRVWRFMIQTRTKSLRERHPDRYHELCEKSRSSPHLVPRQIQLDLDRTLTSNKHFSPPTSPLIQKLERVLQAFSWHNPTIGYVQGLNRLAAIALLVLQEEADAFWCLVVIVEHIMPPNYFTKDLVGCQADQRVLKDLMLEKLPRLTAHLEALKVDISLITVEWFLVLFVESLPTRILFKVWDALLYEGSKVIFRYALALFKYREEAILKIQDSVEMYQYLRIFPNTIADGRKLTSIAFNDMNPLRMRLIQNRRAAHLERL 889          
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Match: tbc1d2b (TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB-GENE-100922-148])

HSP 1 Score: 156.377 bits (394), Expect = 8.480e-39
Identity = 99/309 (32.04%), Postives = 161/309 (52.10%), Query Frame = 1
Query:  328 RLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWM-RMSGALIKRKNC--KTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQI 1245
            R++W  +L  T ++           E++  P +K    +   G+PH  R ++W   +S  + K ++C  K  Y  ++           KQIE DL+RTLP+N  +S   S GI +LR +L   +W  PDIGYCQG+  + +  LL+L++ED FW + AI+E  +P  YY+  L+G Q DQ   ++L+ + LP++H     + ++ SLIT +WFL +F   +    L ++WD F YEG  ++FR  L + + KE E L+  +   IF  L      I D  KL+ +++          IQ  R  +L ++
Sbjct:  509 RVKWDNYLAITMNR-----------EMVRSPDLK---ALMRGGVPHIHRSKVWSWCVSFHVKKMRDCQPKDYYHNLLCMANDKPNPACKQIELDLLRTLPNNKHYSSPDSDGIQKLRNVLLAFSWRNPDIGYCQGLNRLAAIALLYLDQEDAFWCLVAIVEVFMPHDYYTKTLLGSQVDQRVFKDLMYEKLPRLHAHFEHYKVDFSLITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKIIFRFALALFKYKEEEFLKLQDPMTIFKYLRYFTRTILDARKLMAMAFVDMNPFPLRQIQNRRTFHLEKV 803          
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Match: tbc1d2b (TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB-GENE-100922-148])

HSP 1 Score: 156.377 bits (394), Expect = 1.178e-38
Identity = 99/309 (32.04%), Postives = 161/309 (52.10%), Query Frame = 1
Query:  328 RLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWM-RMSGALIKRKNC--KTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQI 1245
            R++W  +L  T ++           E++  P +K    +   G+PH  R ++W   +S  + K ++C  K  Y  ++           KQIE DL+RTLP+N  +S   S GI +LR +L   +W  PDIGYCQG+  + +  LL+L++ED FW + AI+E  +P  YY+  L+G Q DQ   ++L+ + LP++H     + ++ SLIT +WFL +F   +    L ++WD F YEG  ++FR  L + + KE E L+  +   IF  L      I D  KL+ +++          IQ  R  +L ++
Sbjct:  617 RVKWDNYLAITMNR-----------EMVRSPDLK---ALMRGGVPHIHRSKVWSWCVSFHVKKMRDCQPKDYYHNLLCMANDKPNPACKQIELDLLRTLPNNKHYSSPDSDGIQKLRNVLLAFSWRNPDIGYCQGLNRLAAIALLYLDQEDAFWCLVAIVEVFMPHDYYTKTLLGSQVDQRVFKDLMYEKLPRLHAHFEHYKVDFSLITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKIIFRFALALFKYKEEEFLKLQDPMTIFKYLRYFTRTILDARKLMAMAFVDMNPFPLRQIQNRRTFHLEKV 911          
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Match: mak (male germ cell associated kinase [Source:Xenbase;Acc:XB-GENE-490935])

HSP 1 Score: 843.188 bits (2177), Expect = 0.000e+0
Identity = 436/766 (56.92%), Postives = 580/766 (75.72%), Query Frame = 1
Query:  169 AFAALTSSMWPQNIEIPLTEDES--DEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNH---NLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +F+ALT+SMWPQ+I    T+ E   ++ EF YDEFGFRV   DG       L      E+   RL+W AHLEFT++ ++ G+L+WD I++ +  S KL+S++   GIPHS+RPQLWMR+SGAL K++N + +YK+IV  +++D  + +KQIEKDL+RT+PSN CFS++ S G+PRLRR+LRGLAWLYPDIGYCQG G++ + LLLFLEEED FW+M AI+EDL+PVSY++T L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++I+ LLR+WD FFY+GSLVLF+  LGM+++KE E+++ +N+A IFN LS +PS+I + + L+  +  ++  LT   I+A R+K+LA ++ ++G  ++      NL K  I +RQ +R +S I+ LL+ ++        D +++K KNI+QT ++ DLR +ILQ+ RHF+  +  +    +  PDY++ SH  D E YV  SR+R++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVEILDERSK+Y  AGDDSV E ITDL+RG  CP++K+IFEHG+K+  LL   CHPWLFIEEAASREVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++ +QSVN +HD AHAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+LS+F+F LS DWEL        K+              ++E ++++L+ H+LFSW++
Sbjct:   12 SFSALTASMWPQDILAKYTQKEQSVEQPEFRYDEFGFRVDKEDGAEPNSSKLLGIPLTEDPQQRLRWQAHLEFTHNHDV-GDLTWDKIDVTLPHSDKLRSLVLA-GIPHSMRPQLWMRLSGALQKKQNSEMTYKDIVRNSSNDDTLAAKQIEKDLLRTMPSNACFSNLQSVGVPRLRRVLRGLAWLYPDIGYCQGTGMVAACLLLFLEEEDAFWMMAAIVEDLVPVSYFNTTLVGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIKLLLRIWDFFFYQGSLVLFQTTLGMLKMKEEELIQSENSASIFNTLSDIPSQIEEADVLLREAMLISGTLTEVMIEAQRRKHLAYLIADQGQLLNSTAAVTNLSK--IIRRQSQRRKSGITTLLFGDD--------DFEALKSKNIKQTALVADLREAILQVARHFQCTDPKNC-SIDLTPDYTMESHQRDHENYVSCSRSRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEILDERSKEYSVAGDDSVTEGITDLVRGTLCPSIKSIFEHGLKKPSLLGGPCHPWLFIEEAASREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRGVQSVNVSHDAAHAQMDVKLRSLICIGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLSRFAFSLSPDWELPVKREDKEKKP-------------LKEGVQDMLVKHHLFSWDI 751          
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Match: mak (male germ cell associated kinase [Source:Xenbase;Acc:XB-GENE-490935])

HSP 1 Score: 843.188 bits (2177), Expect = 0.000e+0
Identity = 436/766 (56.92%), Postives = 580/766 (75.72%), Query Frame = 1
Query:  169 AFAALTSSMWPQNIEIPLTEDES--DEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNH---NLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +F+ALT+SMWPQ+I    T+ E   ++ EF YDEFGFRV   DG       L      E+   RL+W AHLEFT++ ++ G+L+WD I++ +  S KL+S++   GIPHS+RPQLWMR+SGAL K++N + +YK+IV  +++D  + +KQIEKDL+RT+PSN CFS++ S G+PRLRR+LRGLAWLYPDIGYCQG G++ + LLLFLEEED FW+M AI+EDL+PVSY++T L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++I+ LLR+WD FFY+GSLVLF+  LGM+++KE E+++ +N+A IFN LS +PS+I + + L+  +  ++  LT   I+A R+K+LA ++ ++G  ++      NL K  I +RQ +R +S I+ LL+ ++        D +++K KNI+QT ++ DLR +ILQ+ RHF+  +  +    +  PDY++ SH  D E YV  SR+R++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVEILDERSK+Y  AGDDSV E ITDL+RG  CP++K+IFEHG+K+  LL   CHPWLFIEEAASREVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++ +QSVN +HD AHAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+LS+F+F LS DWEL        K+              ++E ++++L+ H+LFSW++
Sbjct:   12 SFSALTASMWPQDILAKYTQKEQSVEQPEFRYDEFGFRVDKEDGAEPNSSKLLGIPLTEDPQQRLRWQAHLEFTHNHDV-GDLTWDKIDVTLPHSDKLRSLVLA-GIPHSMRPQLWMRLSGALQKKQNSEMTYKDIVRNSSNDDTLAAKQIEKDLLRTMPSNACFSNLQSVGVPRLRRVLRGLAWLYPDIGYCQGTGMVAACLLLFLEEEDAFWMMAAIVEDLVPVSYFNTTLVGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIKLLLRIWDFFFYQGSLVLFQTTLGMLKMKEEELIQSENSASIFNTLSDIPSQIEEADVLLREAMLISGTLTEVMIEAQRRKHLAYLIADQGQLLNSTAAVTNLSK--IIRRQSQRRKSGITTLLFGDD--------DFEALKSKNIKQTALVADLREAILQVARHFQCTDPKNC-SIDLTPDYTMESHQRDHENYVSCSRSRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEILDERSKEYSVAGDDSVTEGITDLVRGTLCPSIKSIFEHGLKKPSLLGGPCHPWLFIEEAASREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRGVQSVNVSHDAAHAQMDVKLRSLICIGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLSRFAFSLSPDWELPVKREDKEKKP-------------LKEGVQDMLVKHHLFSWDI 751          
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Match: mak (male germ cell associated kinase [Source:Xenbase;Acc:XB-GENE-490935])

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 435/766 (56.79%), Postives = 580/766 (75.72%), Query Frame = 1
Query:  169 AFAALTSSMWPQNIEIPLTEDES--DEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNH---NLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +F+ALT+SMWPQ+I    T+ E   ++ EF YDEFGFRV   DG       L      E+   RL+W AHLEFT++ ++ G+L+WD I++ +  S KL+S++   GIPHS+RPQLWMR+SGAL K++N + +YK+IV  +++D  + +KQIEKDL+RT+PSN CFS++ S G+PRLRR+LRGLAWLYPDIGYCQG G++ + LLLFLEEED FW+M AI+EDL+PVSY++T L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++I+ LLR+WD FFY+GSLVLF+  LGM+++KE E+++ +N+A IFN LS +PS+I + + L+  +  ++  LT   I+A R+K+LA ++ ++G  ++      NL K  I +RQ +R +S I+ LL+ ++        D +++K KNI+QT ++ DLR +ILQ+ RHF+  +  +    +  PDY++ SH  D E YV  SR+R++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVEILDERSK+Y  AGDDSV E ITDL+RG  CP++K+IFEHG+K+  LL   CHPWLFIEEAASREVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++ +QSVN +HD AHAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+LS+F+F LS DWEL                   +  + ++E ++++L+ H+LFSW++
Sbjct:   12 SFSALTASMWPQDILAKYTQKEQSVEQPEFRYDEFGFRVDKEDGAEPNSSKLLGIPLTEDPQQRLRWQAHLEFTHNHDV-GDLTWDKIDVTLPHSDKLRSLVLA-GIPHSMRPQLWMRLSGALQKKQNSEMTYKDIVRNSSNDDTLAAKQIEKDLLRTMPSNACFSNLQSVGVPRLRRVLRGLAWLYPDIGYCQGTGMVAACLLLFLEEEDAFWMMAAIVEDLVPVSYFNTTLVGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIKLLLRIWDFFFYQGSLVLFQTTLGMLKMKEEELIQSENSASIFNTLSDIPSQIEEADVLLREAMLISGTLTEVMIEAQRRKHLAYLIADQGQLLNSTAAVTNLSK--IIRRQSQRRKSGITTLLFGDD--------DFEALKSKNIKQTALVADLREAILQVARHFQCTDPKNC-SIDLTPDYTMESHQRDHENYVSCSRSRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEILDERSKEYSVAGDDSVTEGITDLVRGTLCPSIKSIFEHGLKKPSLLGGPCHPWLFIEEAASREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRGVQSVNVSHDAAHAQMDVKLRSLICIGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLSRFAFSLSPDWELPV-----------------KREKPLKEGVQDMLVKHHLFSWDI 747          
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Match: mak (male germ cell associated kinase [Source:Xenbase;Acc:XB-GENE-490935])

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 418/766 (54.57%), Postives = 560/766 (73.11%), Query Frame = 1
Query:  169 AFAALTSSMWPQNIEIPLTEDES--DEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNH---NLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +F+ALT+SMWPQ+I    T+ E   ++ EF YDEFGFRV   DG       L      E+   RL+W AHLEFT++ ++ G+L+WD I++ +  S KL+S++   GIPHS+RPQLWMR+SGAL K++N + +YK+IV  +++D  + +KQIEKDL+RT+PSN CFS++ S G+PRLRR+LRGLAWLYPDIGYCQG G++ + LLLFLEEED FW+M AI+EDL+PVSY++T L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++I+ LLR+WD FFY+GSLVLF+  LGM+++KE E+++ +N+A IFN LS +PS+I + + L+  +  ++  LT   I+A R+K+LA ++ ++G  ++      NL K  I +RQ +R +S I+ LL+ ++        D +++K KNI+QT ++ DLR +ILQ+ RHF+  +  +    +  PDY++ SH  D E YV  SR+R++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVEILDERSK+Y  AGDDSV E ITDL+RG  CP++K+IFEHG+K+  LL   CHPWLFIEEAASREVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++ +QSVN +HD AHAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGW + K                                         + ++E ++++L+ H+LFSW++
Sbjct:   21 SFSALTASMWPQDILAKYTQKEQSVEQPEFRYDEFGFRVDKEDGAEPNSSKLLGIPLTEDPQQRLRWQAHLEFTHNHDV-GDLTWDKIDVTLPHSDKLRSLVLA-GIPHSMRPQLWMRLSGALQKKQNSEMTYKDIVRNSSNDDTLAAKQIEKDLLRTMPSNACFSNLQSVGVPRLRRVLRGLAWLYPDIGYCQGTGMVAACLLLFLEEEDAFWMMAAIVEDLVPVSYFNTTLVGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIKLLLRIWDFFFYQGSLVLFQTTLGMLKMKEEELIQSENSASIFNTLSDIPSQIEEADVLLREAMLISGTLTEVMIEAQRRKHLAYLIADQGQLLNSTAAVTNLSK--IIRRQSQRRKSGITTLLFGDD--------DFEALKSKNIKQTALVADLREAILQVARHFQCTDPKNC-SIDLTPDYTMESHQRDHENYVSCSRSRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEILDERSKEYSVAGDDSVTEGITDLVRGTLCPSIKSIFEHGLKKPSLLGGPCHPWLFIEEAASREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRGVQSVNVSHDAAHAQMDVKLRSLICIGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWDKEK-----------------------------------------KPLKEGVQDMLVKHHLFSWDI 732          
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Match: mak (male germ cell associated kinase [Source:Xenbase;Acc:XB-GENE-490935])

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 382/665 (57.44%), Postives = 509/665 (76.54%), Query Frame = 1
Query:  169 AFAALTSSMWPQNIEIPLTEDES--DEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNH---NLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCG 2124
            +F+ALT+SMWPQ+I    T+ E   ++ EF YDEFGFRV   DG       L      E+   RL+W AHLEFT++ ++ G+L+WD I++ +  S KL+S++   GIPHS+RPQLWMR+SGAL K++N + +YK+IV  +++D  + +KQIEKDL+RT+PSN CFS++ S G+PRLRR+LRGLAWLYPDIGYCQG G++ + LLLFLEEED FW+M AI+EDL+PVSY++T L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++I+ LLR+WD FFY+GSLVLF+  LGM+++KE E+++ +N+A IFN LS +PS+I + + L+  +  ++  LT   I+A R+K+LA ++ ++G  ++      NL K  I +RQ +R +S I+ LL+ ++        D +++K KNI+QT ++ DLR +ILQ+ RHF+  +  +    +  PDY++ SH  D E YV  SR+R++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVEILDERSK+Y  AGDDSV E ITDL+RG  CP++K+IFEHG+K+  LL   CHPWLFIEEAASREVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++ +QSVN +HD AHAQMDVKLRSLIC G
Sbjct:   12 SFSALTASMWPQDILAKYTQKEQSVEQPEFRYDEFGFRVDKEDGAEPNSSKLLGIPLTEDPQQRLRWQAHLEFTHNHDV-GDLTWDKIDVTLPHSDKLRSLVLA-GIPHSMRPQLWMRLSGALQKKQNSEMTYKDIVRNSSNDDTLAAKQIEKDLLRTMPSNACFSNLQSVGVPRLRRVLRGLAWLYPDIGYCQGTGMVAACLLLFLEEEDAFWMMAAIVEDLVPVSYFNTTLVGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIKLLLRIWDFFFYQGSLVLFQTTLGMLKMKEEELIQSENSASIFNTLSDIPSQIEEADVLLREAMLISGTLTEVMIEAQRRKHLAYLIADQGQLLNSTAAVTNLSK--IIRRQSQRRKSGITTLLFGDD--------DFEALKSKNIKQTALVADLREAILQVARHFQCTDPKNC-SIDLTPDYTMESHQRDHENYVSCSRSRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEILDERSKEYSVAGDDSVTEGITDLVRGTLCPSIKSIFEHGLKKPSLLGGPCHPWLFIEEAASREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRGVQSVNVSHDAAHAQMDVKLRSLICIG 663          
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Match: Sgsm3 (small G protein signaling modulator 3 [Source:MGI Symbol;Acc:MGI:1916329])

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 430/774 (55.56%), Postives = 572/774 (73.90%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNI--EIPLTEDESDEVEFSYDEFGFRVID-------GQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G +  + S P  F+ALT S+WPQ I  +    E+ S++ E  YDEFGFRV          Q     ++E+   RL+W AHLEFT++ ++ G+L+WD I + +  S KL+S++   GIPH +RPQLWMR+SGAL K+KN + SY+EI+  +++D  + +KQIEKDL+RT+PSN CF++++S G+PRLRR+LR LAWLYP+IGYCQG G++ + LLLFLEEED FW+MCAIIEDLLP SY+ST L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++IR LLR+WDLFFYEGSLVLF+  LGM++LKE E+++ +N+A IFN LS +P+++ D   L+  +  L   LT   ++  R+K+LA ++ ++G  +          + +R+ +R +S I+ LL+          +D++++K KNI+QTE++ DLR +IL++ RHF+  +  +       PDYS+ SH  D E YV   R+ ++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVE+LDERSK+Y  AGDDSV E +TDL+RG  CPALKA+FEHG+K+  LL   CHPWLFIEEAA REVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN THD AHAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+L  F+F LS DWEL                  ++  + ++E ++++L+ H+LFSW++
Sbjct:    2 SGNHTPSASGP--FSALTPSIWPQEILAKYSQKEESSEQPELCYDEFGFRVDKEGSEPGCSQMTGSPLVEDPPQRLRWQAHLEFTHNHDV-GDLTWDKIAVSLPRSEKLRSLVLA-GIPHGMRPQLWMRLSGALQKKKNSELSYREIIKNSSNDETIAAKQIEKDLLRTMPSNACFANVNSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIRLLLRIWDLFFYEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPAQMDDAELLLGEAMRLAGSLTDVAVETQRRKHLAYLIADQGQTLGTGTTTNLSQVVRRRTQRRKSGITSLLF--------GEDDLEALKAKNIKQTELVADLREAILRVARHFQCTDPKNC-SVELTPDYSMESHQRDHENYVACLRSHRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELPAR--------------REEEKQPLKEGVQDMLVKHHLFSWDI 748          
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Match: Sgsm3 (small G protein signaling modulator 3 [Source:MGI Symbol;Acc:MGI:1916329])

HSP 1 Score: 750.74 bits (1937), Expect = 0.000e+0
Identity = 387/700 (55.29%), Postives = 515/700 (73.57%), Query Frame = 1
Query:  328 RLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            RL+W AHLEFT++ ++ G+L+WD I + +  S KL+S++   GIPH +RPQLWMR+SGAL K+KN + SY+EI+  +++D  + +KQIEKDL+RT+PSN CF++++S G+PRLRR+LR LAWLYP+IGYCQG G++ + LLLFLEEED FW+MCAIIEDLLP SY+ST L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++IR LLR+WDLFFYEGSLVLF+  LGM++LKE E+++ +N+A IFN LS +P+++ D   L+  +  L   LT   ++  R+K+LA ++ ++G  +          + +R+ +R +S I+ LL+          +D++++K KNI+QTE++ DLR +IL++ RHF+  +  +       PDYS+ SH  D E YV   R+ ++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVE+LDERSK+                          A+FEHG+K+  LL   CHPWLFIEEAA REVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN THD AHAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+L  F+F LS DWEL                  ++  + ++E ++++L+ H+LFSW++
Sbjct:    2 RLRWQAHLEFTHNHDV-GDLTWDKIAVSLPRSEKLRSLVLA-GIPHGMRPQLWMRLSGALQKKKNSELSYREIIKNSSNDETIAAKQIEKDLLRTMPSNACFANVNSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIRLLLRIWDLFFYEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPAQMDDAELLLGEAMRLAGSLTDVAVETQRRKHLAYLIADQGQTLGTGTTTNLSQVVRRRTQRRKSGITSLLF--------GEDDLEALKAKNIKQTELVADLREAILRVARHFQCTDPKNC-SVELTPDYSMESHQRDHENYVACLRSHRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDERSKE--------------------------ALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELPA---------------RREEKQPLKEGVQDMLVKHHLFSWDI 649          
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Match: Sgsm3 (small G protein signaling modulator 3 [Source:MGI Symbol;Acc:MGI:1916329])

HSP 1 Score: 238.81 bits (608), Expect = 6.179e-73
Identity = 112/196 (57.14%), Postives = 147/196 (75.00%), Query Frame = 1
Query: 1300 INKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLL 1887
            + +R+ +R +S I+ LL+          +D++++K KNI+QTE++ DLR +IL++ RHF+  +  +       PDYS+ SH  D E YV   R+ ++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVE+LDERSK+Y  AGDDSV E +TDL+RG  CPALKA+FEHG+K+  LL
Sbjct:   27 VVRRRTQRRKSGITSLLF--------GEDDLEALKAKNIKQTELVADLREAILRVARHFQCTDPKNC-SVELTPDYSMESHQRDHENYVACLRSHRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLL 213          
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Match: Tbc1d2 (TBC1 domain family, member 2 [Source:MGI Symbol;Acc:MGI:2652885])

HSP 1 Score: 169.859 bits (429), Expect = 5.550e-43
Identity = 107/341 (31.38%), Postives = 177/341 (51.91%), Query Frame = 1
Query:  232 ESDEVEFS----YDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELS--WDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLE-EEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKY 1233
            E+D V  S    YD++GF  +     +   L  +   L+  +H    + + +E  L   W  +  +  PS +LK ++   G+P   RP++W  +    ++       Y+E++    +     ++QIE DL RT P+N  F+  +S+   +LRR+L   +W  P IGYCQG+  + +  LL LE EE  FW + AI+E +LP  YYS  L   Q DQ  L++L+ + LP++   L +H +++SLIT +WFL +F   L    LLRVWD F YEG+ V+FR  L + +  E  +L+  ++ +I+  L      I D  KL+ +++          ++ LR  +
Sbjct:  542 EADSVGLSPVSEYDDYGFLTVPDYEMEDLKLLAKIQALEVRSHHLLAH-EAVERPLRDRWATLTELT-PSAELKQLLR-AGVPREHRPRVWRWLVHRRVRHLQAPGCYQELLARGRACEHPAARQIELDLNRTFPTNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLEDEESAFWCLVAIVETILPAEYYSKTLTASQVDQRVLQDLLSEKLPRLTAHLGQHRVDLSLITFNWFLVVFADSLISDILLRVWDAFLYEGTKVVFRYALAIFKYNEEAILQLQDSLEIYQYLRFFTKTICDSRKLMSIAFNDMNPFPMKQLRQLRAAH 879          
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Match: Tbc1d2b (TBC1 domain family, member 2B [Source:MGI Symbol;Acc:MGI:1914266])

HSP 1 Score: 162.925 bits (411), Expect = 1.005e-40
Identity = 109/341 (31.96%), Postives = 178/341 (52.20%), Query Frame = 1
Query:  256 YDEFGFRVI-DGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDI-------EIIIHPSIKLKSMIHEYGIPHSLRPQLW---MRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQI 1245
            +D +GFR + D    +K V +  A  L+ L     T ++ +   + W++        E+   P  +LK++I   GIPH  R ++W   +       K       ++ ++          SKQIE DL+RTLP+N  +S  +S GI +LR +L   +W  PDIGYCQG+  +V+  LL+L++ED FW +  I+E  +P  YY+  L+G Q DQ   R+L+ + LP++H    ++ ++ +LIT +WFL +F   +    L ++WD F YEG  V+FR  L + + KE E+L+  ++  IF  L      I D  KLI +S+          I+  R  +L ++
Sbjct:  596 FDIYGFRTVPDDDEEEKLVAKVRALDLKTLY---LTDNQEVSTGVKWENYFASTMNREMACSP--ELKNLIRA-GIPHEHRSKVWKWCVDRHTRKFKDSMEPDYFQTLLQKALEKQNPASKQIELDLLRTLPNNKHYSSPTSEGIQKLRSVLLAFSWRNPDIGYCQGLNRLVAVALLYLDQEDAFWCLVTIVEVFMPRDYYTKTLLGSQVDQRVFRDLLSEKLPRLHTHFEQYKVDYTLITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKVIFRFALALFKYKEEEILKLQDSMSIFKYLRYFTRTILDARKLISISFGDLNPFPLRQIRNRRAYHLEKV 930          
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Match: sp|Q2KI13|SGSM3_BOVIN (Small G protein signaling modulator 3 OS=Bos taurus OX=9913 GN=SGSM3 PE=2 SV=1)

HSP 1 Score: 860.136 bits (2221), Expect = 0.000e+0
Identity = 432/771 (56.03%), Postives = 573/771 (74.32%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDES--DEVEFSYDEFGFRV----IDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G ++ + + P  F+ALT SMWPQ I     ++E+  ++ EF YDEFGFRV     DG      +LE+   RL+W AHLEFT++ ++ G+L+WD I + +  S KL+S++   G+PHS+RPQLWMR+SGAL K++N + SY+EIV  +++D  + +KQIEKDL+RT+PSN CF+H+S  G+PRLRR+LR LAWLYP+IGYCQG G++ + LLLFLEE+D FW+MCAIIEDLLP SY+ST L+GVQ DQ  LR LI +YLP++  LL EHDIE+SLITLHWFLT F S+++IR LLR+WDLFFYEGSLVLF+  LGM++LKE E+++ +N+A IFN LS +PS++ D + L+  +  L   LT   ++  R+K+LA ++ ++G  +          + +R+ +R +S I+ LL+          +D++++K KNI+QTE++ DLR +IL++ RHF+  +  +  +    PDYS+ SH  D E YV  SR   +RAKA+LDFERHDDDELGF+KNDII I+S KDEHCW+GELNGLRGWFPAKFVE+LDERSK+Y  AGDD+V E +TDL+RG  CPALKA+ EHG+K+  LL   CHPWLFIEEAA REVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN THD AHAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+L  F+F LS DWEL      + K               ++E ++++L+ H+LFSW++
Sbjct:    2 SGSHVPSANGP--FSALTPSMWPQEILAKYAQEEATVEQPEFRYDEFGFRVDKEDADGIPYSGQLLEDPPQRLRWQAHLEFTHNHDV-GDLTWDKIAVSLPRSEKLRSLVLA-GVPHSMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFAHVSGVGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEDDAFWMMCAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDRLLQEHDIELSLITLHWFLTAFASVVHIRLLLRLWDLFFYEGSLVLFQATLGMLRLKEDELIQSENSASIFNTLSDIPSQLEDADLLLAEAMRLAGSLTAVAVETQRRKHLAYLLADQGQLLGAPATTGLSQVVRRRTQRRKSGITSLLF--------GEDDLEAMKAKNIKQTELVADLREAILRVARHFQCTDPKNC-NVELTPDYSMESHQRDHESYVACSRGHPRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDAVTEGVTDLVRGTLCPALKALLEHGLKKPSLLGGACHPWLFIEEAAGREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELPAKREEEKK--------------PLKEGVQDMLVKHHLFSWDI 745          
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Match: sp|Q96HU1|SGSM3_HUMAN (Small G protein signaling modulator 3 OS=Homo sapiens OX=9606 GN=SGSM3 PE=1 SV=1)

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 427/762 (56.04%), Postives = 565/762 (74.15%), Query Frame = 1
Query:  172 FAALTSSMWPQNIEIPLTEDE--SDEVEFSYDEFGFRVIDGQTRQKY--------VLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            F+ALT S+WPQ I    T+ E  +++ EF YDEFGFRV   +  +          ++E+   RL+W AHLEFT++ ++ G+L+WD I + +  S KL+S++   GIPH +RPQLWMR+SGAL K++N + SY+EIV  +++D  + +KQIEKDL+RT+PSN CF+ + S G+PRLRR+LR LAWLYP+IGYCQG G++ + LLLFLEEED FW+M AIIEDLLP SY+ST L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++I+ LLR+WDLFFYEGS VLF++ LGM+ LKE E+++ +N+A IFN LS +PS++ D   L+ V+  L   LT   ++  R+K+LA ++ ++G  +          + +R+ +R +S I+ LL+          +D++++K KNI+QTE++ DLR +IL++ RHF+  +  +       PDYS+ SH  D E YV  SR+ ++RAKA+LDFERHDDDELGF+KNDII I+S KDEHCW+GELNGLRGWFPAKFVE+LDERSK+Y  AGDDSV E +TDL+RG  CPALKA+FEHG+K+  LL   CHPWLFIEEAA REVE+DF SVYSRL+LCKTFRLDEDGKVLTPEE+L++A+QSVN THD  HAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+L  F+F LS DWEL                  ++  + ++E +R++L+ H+LFSW++
Sbjct:   12 FSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDV-GDLTWDKIAVSLPRSEKLRSLVLA-GIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGVAMRLAGSLTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLF--------GEDDLEALKAKNIKQTELVADLREAILRVARHFQCTDPKNC-SVELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASVYSRLVLCKTFRLDEDGKVLTPEELLYRAVQSVNVTHDAVHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELPA---------------KREAQQPLKEGVRDMLVKHHLFSWDV 747          
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Match: sp|A6H8I2|SGSM3_XENLA (Small G protein signaling modulator 3 homolog OS=Xenopus laevis OX=8355 GN=sgsm3 PE=2 SV=1)

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 434/778 (55.78%), Postives = 580/778 (74.55%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDES--DEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNH---NLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G Y  +   P  F+ALT+SMWPQ+I    T+ E   ++ EF YDEFGFRV   DG       L      E+   RL+W AHLEFT++ ++ G+L+WD I++ +  S KL+S++   GIPHS+RPQLWMR+SGAL K++N + +YK+I   +++D  + +KQIEKDL+RT+PSN CFS++ S G+PRLRR+LRGLAWL+PDIGYCQG G++ + LLLFLEEED FW+M  I+EDL+PVSY++T L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++I+ LLR+WD FFY+GSLVLF+  LGM+++KE E+++ +N+A IFN LS +PS+I + + L+  +  ++  LT   I+A R+K+LA ++ ++G  ++      NL K  I +RQ +R +S I+ LL+ ++N         +++K KNI+QT ++ DLR +ILQ+ RHF+ Y    +   +  PDY++ SH  D E YV  S++R++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFV+ILDERSK+Y  AGDDSV E ITDLIRG   P++K+IFEHG+K+  LL   CHPWLFIEEAASREVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++ +QSVN +HD AHAQMDVKLRSLI  GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+LS+F+F LS DWEL        K+              ++E ++++L+ H+LFSW++
Sbjct:    2 SGSYTPSPGGP--FSALTASMWPQDILAKYTQKEQTVEQPEFRYDEFGFRVDKEDGAEPNSSKLLGIPLTEDPQQRLRWQAHLEFTHNHDV-GDLTWDKIDVTLPHSDKLRSLVLA-GIPHSMRPQLWMRLSGALQKKQNSEMTYKDIGRNSSNDDTLAAKQIEKDLLRTMPSNACFSNLQSVGVPRLRRVLRGLAWLFPDIGYCQGTGMVAACLLLFLEEEDAFWMMATIVEDLVPVSYFNTTLVGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIKLLLRIWDFFFYQGSLVLFQTTLGMLKMKEEELIQSENSASIFNTLSDIPSQIEEADVLLREAMLISGTLTEVMIEAQRRKHLAYLIADQGQLLNSTAAVANLSK--IMRRQSQRRKSAITTLLFGDDN--------FEALKSKNIKQTALVADLREAILQVARHFQ-YTDPKNCSIDLTPDYTMESHQRDHENYVSCSQSRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVDILDERSKEYSVAGDDSVTEGITDLIRGTLSPSIKSIFEHGLKKPSLLGGPCHPWLFIEEAASREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRGVQSVNVSHDAAHAQMDVKLRSLISIGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLSKFAFSLSPDWELPVKREDKEKKP-------------LKEGVQDMLVKHHLFSWDI 751          
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Match: sp|Q6P6R7|SGSM3_RAT (Small G protein signaling modulator 3 OS=Rattus norvegicus OX=10116 GN=Sgsm3 PE=1 SV=1)

HSP 1 Score: 843.958 bits (2179), Expect = 0.000e+0
Identity = 432/773 (55.89%), Postives = 573/773 (74.13%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDE-SDEVEFSYDEFGFRVID-------GQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G +  + S P  F+ALT S+WPQ I    ++ E S E E  YDEFGFRV          Q     ++E+   RL+W AHLEFT++ ++ G+L+WD I + +  S KL+S++   GIPH +RPQLWMR+SGAL K+KN + SY+EIV  +++D  + +KQIEKDL+RT+PSN CF++++S G+PRLRR+LR LAWLYP+IGYCQG G++ + LLLFLEEED FW+MCAIIEDLLP SY+ST L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++IR LLR+WDLFFYEGSLVLF+  LGM++LKE E+++ +N+A IFN LS +P+++ D   L+  + +L   LT   ++  R+K+LA ++ ++G  +  +       + +R+ +R +S I+ LL+          +D++++K KNI+QTE++ DLR +IL++ RHF+  +  +       PDYS+ SH  D E YV   R+ ++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVE+LDERSK+Y  AGDDSV E +TDL+RG  CPALKA+FEHG+K+  LL   CHPWLFIEEAA REVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN THD AHAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+L  F+F LS DWEL                  ++  + ++E ++++L+ H+LFSW++
Sbjct:    2 SGNHTPSASGP--FSALTPSIWPQEILAKSSQKEDSSEPEICYDEFGFRVDKEGSEPGCSQMAGTPLVEDPPQRLRWQAHLEFTHNHDV-GDLTWDKIAVSLPRSEKLRSLVLA-GIPHGMRPQLWMRLSGALQKKKNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFANVNSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIRLLLRIWDLFFYEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPAQMDDAELLLGEAMQLAGSLTDVAVETQRRKHLAYLIADQGQTLGTSTTTSLSQVVRRRTQRRKSGITSLLF--------GEDDLEALKAKNIKQTELVADLREAILRVARHFQCTDPKNC-SVELTPDYSMESHQRDHENYVACLRSHRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELPAK--------------REEEKQPLKEGVQDMLVKHHLFSWDI 747          
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Match: sp|Q8VCZ6|SGSM3_MOUSE (Small G protein signaling modulator 3 OS=Mus musculus OX=10090 GN=Sgsm3 PE=1 SV=1)

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 430/774 (55.56%), Postives = 572/774 (73.90%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNI--EIPLTEDESDEVEFSYDEFGFRVID-------GQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G +  + S P  F+ALT S+WPQ I  +    E+ S++ E  YDEFGFRV          Q     ++E+   RL+W AHLEFT++ ++ G+L+WD I + +  S KL+S++   GIPH +RPQLWMR+SGAL K+KN + SY+EI+  +++D  + +KQIEKDL+RT+PSN CF++++S G+PRLRR+LR LAWLYP+IGYCQG G++ + LLLFLEEED FW+MCAIIEDLLP SY+ST L+GVQ DQ  LR LI +YLP++ +LL EHDIE+SLITLHWFLT F S+++IR LLR+WDLFFYEGSLVLF+  LGM++LKE E+++ +N+A IFN LS +P+++ D   L+  +  L   LT   ++  R+K+LA ++ ++G  +          + +R+ +R +S I+ LL+          +D++++K KNI+QTE++ DLR +IL++ RHF+  +  +       PDYS+ SH  D E YV   R+ ++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVE+LDERSK+Y  AGDDSV E +TDL+RG  CPALKA+FEHG+K+  LL   CHPWLFIEEAA REVE+DF SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN THD AHAQMDVKLRSLIC GLN+QVLHLWLE LCSSL  V+KWY PWSF+RSPGWVQIKCELR+L  F+F LS DWEL                  ++  + ++E ++++L+ H+LFSW++
Sbjct:    2 SGNHTPSASGP--FSALTPSIWPQEILAKYSQKEESSEQPELCYDEFGFRVDKEGSEPGCSQMTGSPLVEDPPQRLRWQAHLEFTHNHDV-GDLTWDKIAVSLPRSEKLRSLVLA-GIPHGMRPQLWMRLSGALQKKKNSELSYREIIKNSSNDETIAAKQIEKDLLRTMPSNACFANVNSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIRLLLRIWDLFFYEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPAQMDDAELLLGEAMRLAGSLTDVAVETQRRKHLAYLIADQGQTLGTGTTTNLSQVVRRRTQRRKSGITSLLF--------GEDDLEALKAKNIKQTELVADLREAILRVARHFQCTDPKNC-SVELTPDYSMESHQRDHENYVACLRSHRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELPAR--------------REEEKQPLKEGVQDMLVKHHLFSWDI 748          
BLAST of TBC1 domain family member 2B vs. TrEMBL
Match: A0A210Q0E7 (Small G protein signaling modulator 3-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05321 PE=4 SV=1)

HSP 1 Score: 919.072 bits (2374), Expect = 0.000e+0
Identity = 466/799 (58.32%), Postives = 608/799 (76.10%), Query Frame = 1
Query:   73 VSNNSMEVSSQKYLNYSAKTNGEYLDNNSQPEA-FAALTSSMWPQNIEIPL---TEDESDEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPN--HNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
             S   + VSS  Y++ S+      LD    P   F+ALT SMWP++I   L    ED + ++++ YDEFGF+V   DG       L      E+  HRL+W A+LEFT++  + G+L+WD +E  +  S KL+ M+ + GIPHSLR Q+WMR+SGAL K++    +YK+IV A+++DH+M SKQIEKDL+RT+PSN CF ++ STGIPRLRR+LRGLAWLYPDIGYCQG GVI S LLLF+EEED FW+MCAIIEDLLP SYYS+ LIG+QADQ  +R+LI  YLP    ++ EHDIE+SLI+LHWFLT+F S+++++ LLRVWDLFFYEGS +LF++ +GM+++KE E+   DN+AQIFN LS +P ++ D++ LI +S+     L+   I++ R+K+LA +M  +G+ V+P+   NLPKQ +NKR L+RSRSL+S LLW           D D  K KNIRQTE+LVD+R +ILQ+ RHF++ +  ++   N   DY++ SHA DLE YV V+RN+++RAKA+LDFERHDDDELGF+KND+I IIS KDEHCW+GELNGLRGWFPAKFVE+LDERSK YC+AGDD+V E ITDL+RG  CPALKAIF+HG+KR+ +L + CHPWLF+EEAA+REVEKDF SVYSRL+LCKT+RLD+DGKVLTPEEIL++A+Q+VN +HD  HAQMDVK RS+ICCGLN+QVLHLWLETLCS ++V+ KWYHPWSF+RSPGWVQIKCELRLLSQFSF LS DWE+        KQST  Y       + ++E ++++L+ H+LFSW++
Sbjct:   36 ASGEGVSVSSTNYMSNSS------LDFTPTPGGPFSALTPSMWPEDILSKLRNQPEDPNGQLDYRYDEFGFKVEEEDGPEENSSKLLSTPFIEDAQHRLKWTAYLEFTHNNEV-GDLTWDKVEPRLPRSEKLRLMVRQ-GIPHSLRNQIWMRLSGALEKKRKSDLTYKDIVKASSNDHLMTSKQIEKDLLRTMPSNACFCNVHSTGIPRLRRVLRGLAWLYPDIGYCQGTGVIASSLLLFMEEEDAFWMMCAIIEDLLPASYYSSTLIGIQADQRVMRQLIISYLPDTDLVMKEHDIELSLISLHWFLTLFASVVHMKVLLRVWDLFFYEGSTILFQMTMGMLKMKEQELKTLDNSAQIFNALSDVPGDVQDVDDLIEISFRTCGSLSDMVIESHRRKHLAYLMAEQGVIVNPDSTKNLPKQQLNKRHLRRSRSLVSMLLW-------GDQEDDDFGKAKNIRQTELLVDMREAILQLARHFQSLDPKNN-KVNLIADYTMDSHARDLENYVNVARNKRRRAKALLDFERHDDDELGFRKNDVITIISQKDEHCWVGELNGLRGWFPAKFVELLDERSKHYCSAGDDTVTENITDLVRGTLCPALKAIFDHGLKRSSILGTTCHPWLFVEEAATREVEKDFQSVYSRLVLCKTYRLDQDGKVLTPEEILYRAVQAVNISHDTCHAQMDVKFRSMICCGLNEQVLHLWLETLCSCVEVIGKWYHPWSFMRSPGWVQIKCELRLLSQFSFNLSKDWEI-------PKQSTESY-------KPLKEGVKDMLVKHHLFSWDI 804          
BLAST of TBC1 domain family member 2B vs. TrEMBL
Match: A0A0B7ACK4 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF106159 PE=4 SV=1)

HSP 1 Score: 915.99 bits (2366), Expect = 0.000e+0
Identity = 469/799 (58.70%), Postives = 608/799 (76.10%), Query Frame = 1
Query:   73 VSNNSMEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLT---EDESDEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDP--NHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVT-MDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            VS + + +S    +  S  +N ++      P  F+ALT SMWPQ+I   +    ED + ++++ YDEFGF+V   DG       L      E+  HRL+W A+LEFT++  + G+L+WD +E+ +  S KL+ M+ + GIPHSLR Q+W+R+SGAL K+     SYK+++ A++SDH+M SKQIEKDL+RT+PSN CF +I+STGIPRLRRILRGLAWLYPDIGYCQG GVI + LLLF+EEEDTFW+MCAIIEDLLP SYYS+ LIG+QADQ  LR+L+  YLP I  +L EHDIE+SLI+LHWFLT+F S+++++ LLR+WDLF+YEGS+V+F+I +GM++LKE E+   DN+AQIFN LS +P ++ D+++LI V++ ++  LT   +   R+K+LA +M ++G  V+P    NLPKQ +NKR L+RS+SL+S +LW       A   + D  K KNIRQTE+LVDLR +ILQ+ RHF+N +  +S    T  DYS+ SHA+DLE YV V+RNR +RAKA+LDFERHDDDELGF+KNDII IIS KDEHCWIGELNGLRGWFPAKFVE+LDERSK Y +AGDDSV E ITDL+RG  CPALKAIFEHG+K++ +L   CHPWLFIEEAA+REVEKDF SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+Q+VN +HD  H+QMDVK RSL+CCGLN+QVLHLWLETLCS +D+++KWYHPWSF+RSPGWVQIKCELRLL QFSF LS DWEL   MD++                   +E ++++L+ H+LFSW+L
Sbjct:   38 VSGDGISIS----VTPSFTSNSDFTPTPGGP--FSALTPSMWPQDIMAKINHPPEDPNGQLDYRYDEFGFKVEEEDGPEENSSKLLSTPFIEDPQHRLKWTAYLEFTHNNEV-GDLTWDKVEVRLPRSEKLRGMVKQ-GIPHSLRGQMWLRLSGALDKKNKTDLSYKDVIKASSSDHLMTSKQIEKDLLRTMPSNACFCNINSTGIPRLRRILRGLAWLYPDIGYCQGTGVIAASLLLFMEEEDTFWMMCAIIEDLLPASYYSSTLIGIQADQRVLRQLVISYLPDIDLVLKEHDIELSLISLHWFLTLFASVVHMKVLLRLWDLFYYEGSVVIFQITMGMLKLKEEELQSLDNSAQIFNALSDVPGDVEDVDELIEVAFRVSGSLTDVHVDTHRRKHLAYLMADQGALVNPESTRNLPKQQLNKRHLRRSKSLMS-VLWG------AGGEEDDFGKAKNIRQTELLVDLREAILQVARHFQNLDPKNSKVILTA-DYSMESHAKDLENYVNVARNRHRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWIGELNGLRGWFPAKFVEVLDERSKHYSSAGDDSVTEAITDLVRGTLCPALKAIFEHGLKKSTILGGNCHPWLFIEEAATREVEKDFQSVYSRLVLCKTYRLDEDGKVLTPEEVLYRAVQAVNISHDACHSQMDVKFRSLVCCGLNEQVLHLWLETLCSCMDIIEKWYHPWSFMRSPGWVQIKCELRLLGQFSFSLSRDWELPRHMDSF----------------RPFKEGVKDMLVKHHLFSWDL 804          
BLAST of TBC1 domain family member 2B vs. TrEMBL
Match: A0A0B7AA75 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF106148 PE=4 SV=1)

HSP 1 Score: 911.753 bits (2355), Expect = 0.000e+0
Identity = 466/798 (58.40%), Postives = 609/798 (76.32%), Query Frame = 1
Query:   73 VSNNSMEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLT---EDESDEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDP--NHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            VS + + +S    +  S  +N ++      P  F+ALT SMWPQ+I   +    ED + ++++ YDEFGF+V   DG       L      E+  HRL+W A+LEFT++  + G+L+WD +E+ +  S KL+ M+ + GIPHSLR Q+W+R+SGAL K+     SYK+++ A++SDH+M SKQIEKDL+RT+PSN CF +I+STGIPRLRRILRGLAWLYPDIGYCQG GVI + LLLF+EEEDTFW+MCAIIEDLLP SYYS+ LIG+QADQ  LR+L+  YLP I  +L EHDIE+SLI+LHWFLT+F S+++++ LLR+WDLF+YEGS+V+F+I +GM++LKE E+   DN+AQIFN LS +P ++ D+++LI V++ ++  LT   +   R+K+LA +M ++G  V+P    NLPKQ +NKR L+RS+SL+S +LW       A   + D  K KNIRQTE+LVDLR +ILQ+ RHF+N +  +S    T  DYS+ SHA+DLE YV V+RNR +RAKA+LDFERHDDDELGF+KNDII IIS KDEHCWIGELNGLRGWFPAKFVE+LDERSK Y +AGDDSV E ITDL+RG  CPALKAIFEHG+K++ +L   CHPWLFIEEAA+REVEKDF SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+Q+VN +HD  H+QMDVK RSL+CCGLN+QVLHLWLETLCS +D+++KWYHPWSF+RSPGWVQIKCELR+L++FSF LS +WEL                L ++V   +R+ + ++L+ H+LFSWE+
Sbjct:   38 VSGDGISIS----VTPSFTSNSDFTPTPGGP--FSALTPSMWPQDIMAKINHPPEDPNGQLDYRYDEFGFKVEEEDGPEENSSKLLSTPFIEDPQHRLKWTAYLEFTHNNEV-GDLTWDKVEVRLPRSEKLRGMVKQ-GIPHSLRGQMWLRLSGALDKKNKTDLSYKDVIKASSSDHLMTSKQIEKDLLRTMPSNACFCNINSTGIPRLRRILRGLAWLYPDIGYCQGTGVIAASLLLFMEEEDTFWMMCAIIEDLLPASYYSSTLIGIQADQRVLRQLVISYLPDIDLVLKEHDIELSLISLHWFLTLFASVVHMKVLLRLWDLFYYEGSVVIFQITMGMLKLKEEELQSLDNSAQIFNALSDVPGDVEDVDELIEVAFRVSGSLTDVHVDTHRRKHLAYLMADQGALVNPESTRNLPKQQLNKRHLRRSKSLMS-VLWG------AGGEEDDFGKAKNIRQTELLVDLREAILQVARHFQNLDPKNSKVILTA-DYSMESHAKDLENYVNVARNRHRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWIGELNGLRGWFPAKFVEVLDERSKHYSSAGDDSVTEAITDLVRGTLCPALKAIFEHGLKKSTILGGNCHPWLFIEEAATREVEKDFQSVYSRLVLCKTYRLDEDGKVLTPEEVLYRAVQAVNISHDACHSQMDVKFRSLVCCGLNEQVLHLWLETLCSCMDIIEKWYHPWSFMRSPGWVQIKCELRILAEFSFNLSMNWELPRKR------------LPRRVT--LRDGVCDMLIQHHLFSWEI 805          
BLAST of TBC1 domain family member 2B vs. TrEMBL
Match: A0A433T805 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_014542 PE=4 SV=1)

HSP 1 Score: 908.672 bits (2347), Expect = 0.000e+0
Identity = 460/766 (60.05%), Postives = 591/766 (77.15%), Query Frame = 1
Query:  172 FAALTSSMWPQNIEIPLT---EDESDEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDP--NHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELV-TMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            F+ALT SMWPQ+I   +    ED + ++++ YDEFGF+V   DG       L      E+  HRL+W A+LEFT++  + G+L+WD +E  +  S KL+ M+ + GIPHSLR Q+W+R+SGAL K++    +YK++V A++SDH+M SKQIEKDL+RT+PSN CF +I+STGIPRLRRILRGLAWLYPDIGYCQG GVI + LLLF+EEEDTFW+MCAIIEDLLP SYYS+ LIG+QADQ  LR+L+  YLP I  +L EHDIE+SLI+LHWFLT+F S+++++ LLR+WDL +YEGS+V+F+I +GM++LKE E+   DN+AQIFN LS +P ++ D++ LI V+++++  L+   +   R+K+LA +M ++G  V+P  + NLPKQ INKR L+RSRSL+S +LW           D D  K KNIRQTE+LVDLR +ILQ+ RHF++ +  ++   N   DYS+ SHA DLE YV V+RNR +RAKA+LDFERHDDDELGF+KNDII IIS KDEHCWIGELNGLRGWFPAKFVE+LDERSK Y  AGDDS+ E ITDL+RG  CPA+KAIFEHG+K++ +L   CHPWLFIEEAA+REVEKDF SVYSRL+LCKT+RLDEDGKVLTPEE++++A+Q+VN +HD  HAQMDVKLRSLICCGLN+QVLHLWLETLCS  D+V+KWYHPWSF+RSPGWVQIKCELRL+ QFSF LS DWEL   MD +                   ++ ++++L+ H+LFSW+L
Sbjct:   65 FSALTPSMWPQDIMAKINHPPEDPNGQLDYRYDEFGFKVEEEDGPEENSSKLLSTPFVEDPQHRLKWTAYLEFTHNNEV-GDLTWDKVEARLPRSEKLRGMVRQ-GIPHSLRGQMWLRLSGALDKKQKSDLTYKDVVKASSSDHLMTSKQIEKDLLRTMPSNACFCNINSTGIPRLRRILRGLAWLYPDIGYCQGTGVIGASLLLFMEEEDTFWMMCAIIEDLLPASYYSSTLIGIQADQRVLRQLVISYLPDIDLVLKEHDIELSLISLHWFLTLFASVVHMKVLLRLWDLLYYEGSVVIFQITMGMLKLKEQELQTLDNSAQIFNALSDVPGDVEDVDDLIEVAFKVSGSLSDVHVDTHRRKHLAYLMADQGALVNPESSRNLPKQQINKRHLRRSRSLMS-VLWGGTQG-----EDEDFGKAKNIRQTELLVDLREAILQVARHFQSLDPKNT-KVNLTADYSMESHARDLENYVNVARNRHRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWIGELNGLRGWFPAKFVEVLDERSKHYSQAGDDSITEAITDLVRGTLCPAIKAIFEHGLKKSTILGGHCHPWLFIEEAATREVEKDFQSVYSRLVLCKTYRLDEDGKVLTPEEVMYRAVQAVNISHDACHAQMDVKLRSLICCGLNEQVLHLWLETLCSCQDIVEKWYHPWSFMRSPGWVQIKCELRLMCQFSFSLSKDWELPRQMDTF----------------RPFKDGVKDMLVKHHLFSWDL 805          
BLAST of TBC1 domain family member 2B vs. TrEMBL
Match: K1Q6P1 (Small G protein signaling modulator 3-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10006870 PE=4 SV=1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 469/802 (58.48%), Postives = 607/802 (75.69%), Query Frame = 1
Query:   67 DVVSNN--SMEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPL---TEDESDEVEFSYDEFGFRVI--DGQTRQKYVL------ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPN--HNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            D+V+ +  ++ VS+ +Y + S     +++     P  F+ALT SMWP++I   L    ED + ++++ YDEFGF+V   DG       L      E+  HRL+W A+LEFT++  + G+L+WD +E  +  S KL+ M+ + GIPHSLRP +WMR+SG + K+     +YK+IV A+++D +M SKQIEKDL+RT+PSN CF +I  TG+PRLRRILRGLAWLYPDIGYCQG GVI   LLLF+EEEDTFW+MCAIIEDLLP SYYS+ LIG+QADQ  +R+LI  YLP I  +L EHDIE+SLI+LHWFLTIF S+++++ LLR+WDLFFYEGS VLF+I +GM+++KE E+   DN+AQIFN LS +P ++ D+ +LI VSY +   LT   I++ R+K+LA +M ++G  V+P+   NLPKQ +NKR LKRSRSL+S LLW           + D  K KNIRQTE+LVDLR +IL+I RHF++ +  ++    T  DY++ SHA DLE Y+ V+RN+++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVE+LDERSK Y +AGDDSV E ITDL+RG  CPALKA+FEHG+KR+ +L + CHPWLF+EEAA++EVEKDF SVYSRL+LCKT+RLDEDGKVLTPEEIL++A+ +VN +HD  HAQMDVK RSLICCGLN+QVLHLWLETLCS LD+V+KWYHPWSF+RSPGWVQIKCELRLLS+F+F LS DWEL        K+ +  Y + + V        ++IL+ H+LFSWE+
Sbjct:   32 DLVAGHVENVSVSTGQYASSS-----DFVPTPGGP--FSALTPSMWPEDILAKLGNPPEDPNGQLDYRYDEFGFKVEEEDGPEENSSKLLSTPFVEDPQHRLKWTAYLEFTHNNEV-GDLTWDKVEPRLPRSEKLRGMVKQ-GIPHSLRPHIWMRLSGGMEKKLKSDLTYKDIVKASSNDLLMTSKQIEKDLLRTMPSNACFCNIHGTGVPRLRRILRGLAWLYPDIGYCQGTGVIAGSLLLFMEEEDTFWMMCAIIEDLLPASYYSSTLIGIQADQRVMRQLIISYLPDIDLVLKEHDIELSLISLHWFLTIFASVVHMKVLLRIWDLFFYEGSTVLFQITMGMLKMKEEELRTLDNSAQIFNSLSDVPGDVQDVEELIEVSYRVAGSLTDMVIESQRRKHLAYLMADQGAIVNPDSAKNLPKQQLNKRHLKRSRSLVSTLLW-------GEMEEDDFGKAKNIRQTEILVDLREAILKIARHFQSLDPKNNKVILTA-DYAMESHARDLENYLNVARNKRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVELLDERSKHYSSAGDDSVTETITDLVRGTLCPALKAVFEHGLKRSSILGTPCHPWLFLEEAATKEVEKDFQSVYSRLVLCKTYRLDEDGKVLTPEEILYRAVHAVNVSHDACHAQMDVKFRSLICCGLNEQVLHLWLETLCSGLDIVEKWYHPWSFMRSPGWVQIKCELRLLSEFAFNLSMDWELPI-----KKKKSPSYSITKSV--------QDILIKHHLFSWEI 803          
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:103030541])

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 424/778 (54.50%), Postives = 572/778 (73.52%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNIEIPL-TEDESDEVEFSYDEFGFRVI--DGQTRQKYV-------LENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEG-LFVDPNHNLPKQL--INKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G Y      P  F+ALT SMWPQ+I      +D++ + E  YDEFGFR+   DG   ++++        E+   RL+W AHLEFT++  + G+L+WD I   +  S +L+S++   GIPHS+RPQLWMR+SGAL K++  + SY+EI+  +++D    +KQIEKDL+RT+P+N CFS ++S G+PRL+R+LRGLAWLYPDIGYCQG G++VS LLLFLEEED  W+MCA+IEDLLP SY+S+ L+GVQ DQ  LR+LI +YLP + +LL EHDIE+SLI+LHWFLT F S+++IR LLR+WDL FY+GS+VLF++ LGM+++KE E++  +N+A IFN LS LPS++ D   ++  +  L   L+  T+ + R+K+LA I+  +  L  + +H L   L  + +RQ  R +S +S LL+          ++ +++K KNI+QTE++  LR +I +   HF   +  H    +  PDYS+ SH  D E ++ VSRNR++RAKA+LDFERHDDDELGF+KNDII I+S KDEHCW+GELNGLRGWFPAKFVE+LDERSK+Y  AGDDSV E ITDL+RG  CPALKAIF+HG+K+  +L   CHPWLFIEEAASREVE+DF+SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN +HD+AH QMDVK RSLIC GLN+QVLHLWLE LCSS++ V+KWY PWSF+RSPGWVQIKCELR+LS+F+F LS D EL        ++              ++E ++++L+ H+LFSW++
Sbjct:    2 SGSYTPAPGGP--FSALTPSMWPQDILAKYHQKDQNMDSEPQYDEFGFRIDSEDGVEPREWLRGDGAPQTEDPQQRLRWQAHLEFTHNHTV-GDLTWDKISPSLPRSERLRSLVLG-GIPHSMRPQLWMRLSGALQKKRTSEISYREIIKNSSNDDTTAAKQIEKDLLRTMPTNACFSTLTSVGVPRLKRVLRGLAWLYPDIGYCQGTGMVVSCLLLFLEEEDALWMMCALIEDLLPPSYFSSTLLGVQTDQRVLRQLIVQYLPSLDQLLQEHDIELSLISLHWFLTSFASVVDIRILLRIWDLLFYDGSIVLFQVTLGMLKIKEEELVSSENSASIFNTLSDLPSQLEDGAAVLGEAVRLAGSLSQDTLDSHRRKHLAYILAEQAQLNSNNSHTLNTNLNKVVRRQSLRRKSTLSSLLF--------GEDEAEALKAKNIKQTELVAALREAITRTAEHFHCLDPRHC-SMDLTPDYSMESHQRDHENFLVVSRNRRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSLAGDDSVTEAITDLVRGTLCPALKAIFQHGLKKPSILGGPCHPWLFIEEAASREVERDFNSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDSAHVQMDVKFRSLICVGLNEQVLHLWLEVLCSSINAVEKWYQPWSFLRSPGWVQIKCELRVLSKFAFSLSQDCELPAKKEEKEQRP-------------LKEGVQDMLVKHHLFSWDI 753          
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:103030541])

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 424/778 (54.50%), Postives = 570/778 (73.26%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNIEIPL-TEDESDEVEFSYDEFGFRVI--DGQTRQKYV-------LENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEG-LFVDPNHNLPKQL--INKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G Y      P  F+ALT SMWPQ+I      +D++ + E  YDEFGFR+   DG   ++++        E+   RL+W AHLEFT++  + G+L+WD I   +  S +L+S++   GIPHS+RPQLWMR+SGAL K++  + SY+EI+  +++D    +KQIEKDL+RT+P+N CFS ++S G+PRL+R+LRGLAWLYPDIGYCQG G++VS LLLFLEEED  W+MCA+IEDLLP SY+S+ L+GVQ DQ  LR+LI +YLP + +LL EHDIE+SLI+LHWFLT F S+++IR LLR+WDL FY+GS+VLF++ LGM+++KE E++  +N+A IFN LS LPS++ D   ++  +  L   L+  T+ + R+K+LA I+  +  L  + +H L   L  + +RQ  R +S +S LL+          ++ +++K KNI+QTE++  LR +I +   HF   +  H    +  PDYS+ SH  D E ++ VSRNR++RAKA+LDFERHDDDELGF+KNDII I+S KDEHCW+GELNGLRGWFPAKFVE+LDERSK+Y  AGDDSV E ITDL+RG  CPALKAIF+HG+K+  +L   CHPWLFIEEAASREVE+DF+SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN +HD+AH QMDVK RSLIC GLN+QVLHLWLE LCSS++ V+KWY PWSF+RSPGWVQIKCELR+LS+F+F LS D EL                  ++ +   +  + ++L+ H+LFSW+L
Sbjct:    2 SGSYTPAPGGP--FSALTPSMWPQDILAKYHQKDQNMDSEPQYDEFGFRIDSEDGVEPREWLRGDGAPQTEDPQQRLRWQAHLEFTHNHTV-GDLTWDKISPSLPRSERLRSLVLG-GIPHSMRPQLWMRLSGALQKKRTSEISYREIIKNSSNDDTTAAKQIEKDLLRTMPTNACFSTLTSVGVPRLKRVLRGLAWLYPDIGYCQGTGMVVSCLLLFLEEEDALWMMCALIEDLLPPSYFSSTLLGVQTDQRVLRQLIVQYLPSLDQLLQEHDIELSLISLHWFLTSFASVVDIRILLRIWDLLFYDGSIVLFQVTLGMLKIKEEELVSSENSASIFNTLSDLPSQLEDGAAVLGEAVRLAGSLSQDTLDSHRRKHLAYILAEQAQLNSNNSHTLNTNLNKVVRRQSLRRKSTLSSLLF--------GEDEAEALKAKNIKQTELVAALREAITRTAEHFHCLDPRHC-SMDLTPDYSMESHQRDHENFLVVSRNRRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSLAGDDSVTEAITDLVRGTLCPALKAIFQHGLKKPSILGGPCHPWLFIEEAASREVERDFNSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDSAHVQMDVKFRSLICVGLNEQVLHLWLEVLCSSINAVEKWYQPWSFLRSPGWVQIKCELRVLSKFAFSLSQDCELPA---------------KKEKSPIQKSEVVDVLVQHHLFSWDL 751          
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:103030541])

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 374/679 (55.08%), Postives = 502/679 (73.93%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNIEIPL-TEDESDEVEFSYDEFGFRVI--DGQTRQKYV-------LENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEG-LFVDPNHNLPKQL--INKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLN 2130
            +G Y      P  F+ALT SMWPQ+I      +D++ + E  YDEFGFR+   DG   ++++        E+   RL+W AHLEFT++  + G+L+WD I   +  S +L+S++   GIPHS+RPQLWMR+SGAL K++  + SY+EI+  +++D    +KQIEKDL+RT+P+N CFS ++S G+PRL+R+LRGLAWLYPDIGYCQG G++VS LLLFLEEED  W+MCA+IEDLLP SY+S+ L+GVQ DQ  LR+LI +YLP + +LL EHDIE+SLI+LHWFLT F S+++IR LLR+WDL FY+GS+VLF++ LGM+++KE E++  +N+A IFN LS LPS++ D   ++  +  L   L+  T+ + R+K+LA I+  +  L  + +H L   L  + +RQ  R +S +S LL+          ++ +++K KNI+QTE++  LR +I +   HF   +  H    +  PDYS+ SH  D E ++ VSRNR++RAKA+LDFERHDDDELGF+KNDII I+S KDEHCW+GELNGLRGWFPAKFVE+LDERSK+Y  AGDDSV E ITDL+RG  CPALKAIF+HG+K+  +L   CHPWLFIEEAASREVE+DF+SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN +HD+AH QMDVK RSLIC GL 
Sbjct:    2 SGSYTPAPGGP--FSALTPSMWPQDILAKYHQKDQNMDSEPQYDEFGFRIDSEDGVEPREWLRGDGAPQTEDPQQRLRWQAHLEFTHNHTV-GDLTWDKISPSLPRSERLRSLVLG-GIPHSMRPQLWMRLSGALQKKRTSEISYREIIKNSSNDDTTAAKQIEKDLLRTMPTNACFSTLTSVGVPRLKRVLRGLAWLYPDIGYCQGTGMVVSCLLLFLEEEDALWMMCALIEDLLPPSYFSSTLLGVQTDQRVLRQLIVQYLPSLDQLLQEHDIELSLISLHWFLTSFASVVDIRILLRIWDLLFYDGSIVLFQVTLGMLKIKEEELVSSENSASIFNTLSDLPSQLEDGAAVLGEAVRLAGSLSQDTLDSHRRKHLAYILAEQAQLNSNNSHTLNTNLNKVVRRQSLRRKSTLSSLLF--------GEDEAEALKAKNIKQTELVAALREAITRTAEHFHCLDPRHC-SMDLTPDYSMESHQRDHENFLVVSRNRRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSLAGDDSVTEAITDLVRGTLCPALKAIFQHGLKKPSILGGPCHPWLFIEEAASREVERDFNSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDSAHVQMDVKFRSLICVGLK 667          
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Match: tbc1d2 (TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-100])

HSP 1 Score: 164.466 bits (415), Expect = 1.738e-41
Identity = 119/387 (30.75%), Postives = 197/387 (50.90%), Query Frame = 1
Query:   73 VSNNSMEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDG---------------QTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIK--RKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLE-EEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSY 1179
             SN  ME    +YL    K     L N  Q +    L      +NI+  + E         +DE+GF++I                 + R   +L+ +      LA     +++ L G  S DD+ +    S +LK ++  +GIP   R ++W  M     K  R+     ++++   + +     S+QI+ DL RTL +N  FS  SS  + +L R+L   AW  P++GYCQG+  + +  LL L+ EED FW +  I++ L+P  YY+  L+G QADQ   ++ + + LP++   L EH++++SLIT +WFL +F   L    LL+VWD FFYEG+ V+FR  L + + KE ++L+  ++ +I+  L      +TD  KL+ +++
Sbjct:  391 ASNCQME---SRYLGVLRKLQDTKLLNAQQRDTVRTLIEDALQENIKDVIKE---------FDEYGFKLIPDYEVEDMKLLSKIQALEIRSNNLLQQDIGDKSLLAR----WTQYLGGR-SPDDLAL----SPELKGLLR-WGIPREYRRRVWSWMVRTRTKSDRERHPDLFQQLCEKSLTTPHPASRQIQLDLHRTLTTNQHFSSPSSPALQQLHRVLLAFAWQNPEVGYCQGLNRLAALALLVLQNEEDAFWCLVTIVQSLMPQDYYTKTLLGSQADQRVFKDFMAEKLPRLVAHLEEHNVDVSLITFNWFLVVFVESLPSEILLKVWDAFFYEGTKVIFRYALALFKYKEEDILKIHDSTEIYQYLRFFTKTVTDSRKLMTIAF 755          
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Match: tbc1d2 (TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-100])

HSP 1 Score: 160.999 bits (406), Expect = 1.790e-40
Identity = 121/387 (31.27%), Postives = 199/387 (51.42%), Query Frame = 1
Query:   73 VSNNSMEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDG---------------QTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIK--RKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGS-LVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSY 1179
             SN  ME    +YL    K     L N  Q +    L      +NI+  +   + D VEF  DE+GF++I                 + R   +L+ +      LA     +++ L G  S DD+ +    S +LK ++  +GIP   R ++W  M     K  R+     ++++   + +     S+QI+ DL RTL +N  FS  SS  + +L R+L   AW  P++GYCQG+ +    LL+   EED FW +  I++ L+P  YY+  L+G QADQ   ++ + + LP++   L EH++++SLIT +WFL +F   L    LL+VWD FFYEG+  V+FR  L + + KE ++L+  ++ +I+  L      +TD +KL+ +++
Sbjct:  356 ASNCQME---SRYLGVLRKLQDTKLLNAQQRDTVRTLIEDALQENIKDVI---KLDSVEF--DEYGFKLIPDYEVEDMKLLSKIQALEIRSNNLLQQDIGDKSLLAR----WTQYLGGR-SPDDLAL----SPELKGLLR-WGIPREYRRRVWSWMVRTRTKSDRERHPDLFQQLCEKSLTTPHPASRQIQLDLHRTLTTNQHFSSPSSPALQQLHRVLLAFAWQNPEVGYCQGLNLAALALLVLQNEEDAFWCLVTIVQSLMPQDYYTKTLLGSQADQRVFKDFMAEKLPRLVAHLEEHNVDVSLITFNWFLVVFVESLPSEILLKVWDAFFYEGTKQVIFRYALALFKYKEEDILKIHDSTEIYQYLRFFTKTVTD-SKLMTIAF 723          
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Match: tbc1d2b (TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB-GENE-100922-148])

HSP 1 Score: 177.563 bits (449), Expect = 3.523e-46
Identity = 104/318 (32.70%), Postives = 176/318 (55.35%), Query Frame = 1
Query:  256 YDEFGFRVIDGQTRQKYVLENEAHRL--QWLAHLEFTYSKNLEGELSWDDI-----EIIIHPSIKLKSMIHEYGIPHSLRPQLW---MRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSY 1179
            YD++GFR       ++  L  +A  L  + L+ +E     +L   + W+++     E    P +K   M+   G+PH LR ++W   +      I+ ++  + Y E++  +   H   ++Q+E DL RTLP+N  F   SS GI +LRR+L   AW  P++GYCQG+  + +  L++LEEE  FW + AI+E L+P  YYS  L+  Q DQ   +EL+ + LP++     +H +++SLIT +WFL +F   +    + R+WD F YEG+ V+FR  L M++ +E ++++  + + IFN L      I D  +L  +++
Sbjct:  587 YDQYGFRTEPDGLGEEERLAAKALALDRRSLSIIETRLDASLR--VKWENMLAASREPSRSPELK---MLMRSGVPHELRSRVWRWAVEQHVRAIRGRHAASYYCELLERSHGQHNPAARQVELDLPRTLPNNRHFETQSSEGIVKLRRVLLAYAWHNPEVGYCQGLNRLAAIALIYLEEEQAFWCLVAIVECLMPPDYYSKTLLASQVDQRLFKELVTEKLPRLAAHFEQHGVDVSLITFNWFLVLFVDSVGSDMVFRIWDAFLYEGTKVIFRYALAMLKCREEQLIKHHSNSAIFNYLRIFTHSIHDYRQLATIAF 899          
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Match: TBC1D9 (TBC1 domain family member 9 [Source:HGNC Symbol;Acc:HGNC:21710])

HSP 1 Score: 139.428 bits (350), Expect = 4.110e-34
Identity = 83/238 (34.87%), Postives = 132/238 (55.46%), Query Frame = 1
Query:  454 GIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLI 1167
            GIP  LR +LW+  SGA+    +    Y E+V+ +     + +++IE+DL R+LP +  F H    GI  LRR+L   A   P IGYCQ M ++ S LL+F  EE+ FWL+ A+ E LLP  YY+  ++G   DQ    ELI ++LP +HE L E    I+  +L WFLT+F S+L + +   V D F  +G+ VLF++ L ++      +L   +  +    L +    + +++ ++
Sbjct:  443 GIPVRLRRELWLLFSGAVHDMGSNPGHYAELVDRSLGRASIATEEIERDLHRSLPEHPAFQH--PLGIDALRRVLTAYAHRNPRIGYCQAMNIVTSALLIFASEEEAFWLLVALCERLLP-DYYNNRVVGALIDQGVFEELIAEFLPTLHERLQELGF-IATTSLSWFLTLFLSVLPLESAACVLDCFMLDGARVLFQLALAVLHANAEPLLACRDDGEAMMLLGRYLDSVVNVDSIL 676          
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006389.1 (pep scaffold:Pmarinus_7.0:GL481951:143257:161898:-1 gene:ENSPMAG00000005741.1 transcript:ENSPMAT00000006389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 2.396e-32
Identity = 81/225 (36.00%), Postives = 129/225 (57.33%), Query Frame = 1
Query:  454 GIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLS 1128
            GIP SLR +LWM  SGA+ +  +    Y EIV ++     + + +IE+DL R+LP +  F   S  GI  LRR+L   A   P IGYCQ M ++ S LLL+ +EE+ FWL+ A+ E +LP  YY+T ++    DQ    EL  ++LP++ E + +  + IS I+L WFLT+F S+L   + + V D F  +G  ++F++ L ++     ++L   +  +    L+
Sbjct:  432 GIPESLRGELWMHFSGAIHEMNSYPGYYAEIVRSSMGRMSLVTDEIERDLHRSLPEHPAFQ--SEMGIAALRRVLTAYAHRNPSIGYCQAMNIVTSVLLLYTKEEEAFWLLVALCERMLP-DYYNTRVVVALVDQGVFEELTREHLPQLCERMQDLGV-ISTISLSWFLTLFLSVLPFSSAVCVVDCFMLDGVRMIFQLALAVLHANMGKLLSCHDDGEAMTILA 652          
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Match: tbc1d10b (TBC1 domain family, member 10b [Source:ZFIN;Acc:ZDB-GENE-030131-7754])

HSP 1 Score: 102.064 bits (253), Expect = 2.590e-23
Identity = 92/358 (25.70%), Postives = 160/358 (44.69%), Query Frame = 1
Query:  391 WDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNC---------LSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLK--NIRQTEM 1431
            WD      +  +KL+      GIP SLR + W  +SG+    +     ++E+         +  + I+KDL R  P +  F      G   L R+L+      P+ GYCQG   + + LL+ +  E+ FW    I E  LP  YYS  L  +Q D   L  L+ K     +  L  H ++  L    WF+ +F   L   ++LRVWD+FF EG   +FR+  G++ L+ +      N+ ++  C         L  +P E   +++  LV   L  D++   I+      L + + + G   +P+H+   +L   R +++ +S   + L   +   VA + +    ++   ++RQ E+
Sbjct:   20 WDKWITKGYKKVKLRC---RKGIPPSLRARAWEHLSGSKYIMEQMPGKFEELDKLPGDPKWL--EVIQKDLHRQFPFHELFRAKGGQGQQDLFRVLKAYTVYRPEEGYCQGQAPVAAVLLMHMPAEEAFWCFVQICEKYLP-GYYSAGLESLQLDGEILFALLRKVSLIGYRHLKWHSVDPVLYMTEWFMCVFSRTLPWDSVLRVWDMFFCEGVKTMFRV--GLVLLRHA----LGNSERVRMCPGLYETMEQLKNIPHE--QLHEEYLVRAILELDISEMDIEKEHAVQLQRWIESRG---EPSHSSTHRLHGARAIRQEKSSTYKRLTFKHPPPVALAPNTWGARVPKFHVRQKEL 360          
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009273.1 (pep scaffold:Pmarinus_7.0:GL480906:1861:20274:1 gene:ENSPMAG00000008384.1 transcript:ENSPMAT00000009273.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 1.261e-15
Identity = 54/147 (36.73%), Postives = 82/147 (55.78%), Query Frame = 1
Query:  421 SIKLKSMIHEYGIPHSLRPQLWMRMSGALI---KRKNCKTSYKEIVNATTSDHIMC-SKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQ 849
            S +LK ++   G+PH+LRP++W   +G  +   +R      Y  +V+   ++     ++ IE DL RTLP+N  F  +S   +     +L   AW  P IGYCQG+  + + LLL LEEE+ FW + A+IE ++P  YYS  LI  Q
Sbjct:  560 SPELKQLVR-GGVPHTLRPRVWAWCAGRRVSEERRHQPPGYYHALVSQAQNERTNPDARHIELDLARTLPNNCHFEALSPKVVELRNVLLAF-AWRNPHIGYCQGLNRLTAILLLCLEEEEAFWCLVALIEFIMPADYYSKKLIASQ 704          
BLAST of TBC1 domain family member 2B vs. Ensembl Yeast
Match: MDR1 (Cytoplasmic GTPase-activating protein; activates Ypt/Rab transport GTPases Ypt6p, Ypt31p and Sec4p; involved in recycling of internalized proteins and regulation of Golgi secretory function [Source:SGD;Acc:S000003332])

HSP 1 Score: 143.665 bits (361), Expect = 1.473e-35
Identity = 70/216 (32.41%), Postives = 124/216 (57.41%), Query Frame = 1
Query:  454 GIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDN 1101
            G+P+ +R ++W   SGA+  R      Y+ I+N           +IEKDL R+LP    +   +  GI RLR +L   +W  PD+GYCQ M ++V+  L+F+ EE  FW +C + +  +P  YYS  + G   DQ      +   +P + E + +HDI++S+++L WFL++F + + +   +R+ D+FF  GS+ LF++ L ++++   ++L+ D+
Sbjct:  244 GVPNRMRGEIWELCSGAMYMRYANSGEYERILNENAGKTSQAIDEIEKDLKRSLPEYSAYQ--TEEGIQRLRNVLTAYSWKNPDVGYCQAMNIVVAGFLIFMSEEQAFWCLCNLCDIYVP-GYYSKTMYGTLLDQRVFESFVEDRMPVLWEYILQHDIQLSVVSLPWFLSLFFTSMPLEYAVRIMDIFFMNGSITLFQVALAVLKINADDILQADD 456          
BLAST of TBC1 domain family member 2B vs. Ensembl Yeast
Match: MSB4 (GTPase-activating protein of the Ras superfamily; acts primarily on Sec4p, localizes to the bud site and bud tip; msb3 msb4 double mutation causes defects in secretion and actin organization; similar to the TBC-domain Tre2 oncogene; MSB4 has a paralog, MSB3, that arose from the whole genome duplication; human homolog USP6NL can complement yeast msb3 msb4 double null mutant [Source:SGD;Acc:S000005472])

HSP 1 Score: 110.538 bits (275), Expect = 5.958e-26
Identity = 89/321 (27.73%), Postives = 142/321 (44.24%), Query Frame = 1
Query:  253 SYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFT--YSKNLEGELSWDDIEI-----IIHPSI--KLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSK---QIEKDLVRTLPSNVCF---SHISSTXXXXXXXXXXXXAWLYPD--IGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKI------------------------HELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLE 1092
            ++D +GF      +++ Y +  E +   W  +  +T    K  E  L  + IE+     +++P+   +L   + + GIP   R   W   +G   ++ +      + + +   +  +  K    IE+DL RT P N+ F   S  +             +A+   D  IGYCQ M  +V  LLLF+EEE  FW++  I    LP   Y ++L G   DQ  L   I +YLP+I                         E L      ++L T  WF++ F  ++ I   LR+WD  FYE S  LF++ LG+++L ESE LE
Sbjct:   78 NFDRYGF------SKKGYFISQEEYDKWWTEYNRYTERRKKKWENFLLKNKIELHNDNPLVYPARTDELSKFVRK-GIPAEWRGNAWWYFAGGQ-RQLDANVGVYDRLKSDCREGAVSGKDMEAIERDLYRTFPDNIHFHKESFQNGEPAIIRSLRRVLMAFSVYDKTIGYCQSMNFLVGLLLLFMEEEKAFWMLVIITGKYLP-GVYESDLEGANVDQGVLVLCIKEYLPEIWSHIESSYMNGNGSTDQISGPASGEEYLCRLPT-LTLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVALGILKLSESEFLE 388          
BLAST of TBC1 domain family member 2B vs. Ensembl Yeast
Match: MSB3 (Rab GTPase-activating protein; regulates endocytosis via inactivation of Vps21p at endosomes and vacuole fusion via inactivation of Ypt7p at vacuoles; also acts on Ypt52p and Sec4p; localizes to plasma membrane, sites of polarized growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; similar to TBC-domain Tre2 oncogene; MSB3 has a paralog, MSB4, that arose from the whole genome duplication; human homolog USP6NL can complement yeast msb3 msb4 double null [Source:SGD;Acc:S000005237])

HSP 1 Score: 83.1889 bits (204), Expect = 6.654e-17
Identity = 73/265 (27.55%), Postives = 112/265 (42.26%), Query Frame = 1
Query:  421 SIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNA--------TTSDHIMCSKQIEKDLVRTLPSNVCFS---HISSTXXXXXXXXXXXXAW-LY-PDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLA---EHDIE---------------------------ISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEM 1086
            S +LK  + + GIP   R   W   +    K    K  Y +++               +     IE+DL RT P N+ F    H               +A+ LY P IGYCQ M  +   LLLFL+EE  FW++  I    LP   ++ NL GV  DQ  L   + +Y+P++   +    +H  +                           I+L T  WF++ F  ++ I   LR+WD  FYE S  LF++ L +++L E ++
Sbjct:  213 SERLKRYVRK-GIPAEWRGNAWWHFARGQEKLNKNKGVYSQLLRKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNIHFQSSLHNKEGPPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVIITSRYLP-GVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNNKTFSPSNKKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVSLAVLKLSEHDL 475          
BLAST of TBC1 domain family member 2B vs. Ensembl Yeast
Match: GYP5 (GTPase-activating protein (GAP) for yeast Rab family members; involved in ER to Golgi trafficking; exhibits GAP activity toward Ypt1p that is stimulated by Gyl1p, also acts on Sec4p; interacts with Gyl1p, Rvs161p and Rvs167p; involved in recruiting Rvs167p to the bud tip during polarized growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; GYP5 has a paralog, GYL1, that arose from the whole genome duplication [Source:SGD;Acc:S000006170])

HSP 1 Score: 68.1662 bits (165), Expect = 3.716e-12
Identity = 95/416 (22.84%), Postives = 183/416 (43.99%), Query Frame = 1
Query:  454 GIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEE-DTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILG--------MIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILV---SYELTEDLTFS-------------------TIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHN----NNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYN-TQPDYSLHSH--AEDLERYVQVSRNRQ 1587
            GIP  +R  +W  M+ +  K +  +  Y+ +++       +    I +DL RT         ++   +  L ++++  +   PD+GY QGMG I + LL+  E E ++F L+  ++++      +   + G+         L+ ++ P ++  L    I  ++    WFLT F     +  +LR++D+ F EG  VL +  +         +++L+  E+L+F    ++FN       +   + ++ L    S++  +D TFS                   T++  R +Y+ +I   E    D   +L    I   QL+R     +Q L H+    N  +++++N++    ++N    EML+D +N ++  I   ++         N   PD SL      EDLER   +SRN +
Sbjct:  451 GIPPQIRGIIWQLMANS--KSREMEDIYETLLDT----ECLHEATIRRDLRRT-------KFVAEDKMESLYKVIKVYSVYDPDVGYTQGMGFIAAPLLINCENEAESFGLLVGLMKNYGLRELFLPGMPGLMLMLYQFDRLLEEHSPSLYNRLIREGISSTMYATQWFLTFFAYKFPLEFVLRIFDIVFVEGIEVLLKFAVNLMLKNEETLVKLRFDELLDFLKD-ELFNYYLMGNQDDASVVQMGLSNGNSFKGNDDGTFSYNVDLFVHDAMTGVYITPLTLRRYRGEYV-EIHEKEQKKEDHYESL---RIQNHQLQRE----AQKLEHDYSILNKENISAANEL----IQNRLNMEMLLDEKNDLINTITDIKSQIEEEIRKQNLPNPDASLPKADLREDLERT--ISRNNE 838          
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Match: EDO35021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP1])

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 414/759 (54.55%), Postives = 552/759 (72.73%), Query Frame = 1
Query:  193 MWPQNI--EIPLTEDESDEVEFSYDEFGFRVIDGQTRQ---------KYVL-ENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDP--NHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            MWPQ+I   I  TED     E  YDEFGF ++DG+  +          +V  E+++ RL+W A+LEFT ++++ G+++WD +      S KL+ ++   GIPHS+R  +WMR+SGAL K+ N + +YK++V A++ ++   SKQIEKDL+RT+P+N CFS  +STG+ R+RRILR LAWLYPDIGYCQGMG+IV+ LLLF+EEED FWL   IIEDL P SYYS+ LIGVQADQ  LR+LI  YLP   + L EHDIE+SLITLHWFLT F S+++ + LLR+WD++FYEGS+ LFR  LGM++LK+  +L  DN+AQIFN LS +P +ITD + LI  + + +  LT   + A RKK++A +M + G+ VD     ++ K  + +RQL  +RS  + L++  +N S+         K KNI+QTE + DLR +I+ I RHF+  +       N       ++   D ER++ ++RNR++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFV+ILDERSK+Y  AGDDSV+E +TDL+RG  CPALK IFEHGM+R  +L   CHPWLFIEEA+ REVE+DF SVYSRL+LCKTFRLDEDGKVL+PEEIL++A+QS+N +HD A AQMDVK RSL+C GLN+Q LHLWLE+LC+  D V KWYHPWSF+RSPGW+QIKCELR+L+ F+F L+ +WELV            + +  Q+V + M++ +R++L+ H+LFSW+L
Sbjct:    1 MWPQDILSRIQQTEDSGHRPEGQYDEFGF-IMDGEDLEHEYKDPDPGNFVTNEDDSLRLKWTAYLEFTQNQDV-GDMTWDKVSPSFPHSDKLRELVCS-GIPHSMRAPIWMRISGALQKKINAEFTYKQVVRASSDENSPASKQIEKDLLRTMPNNACFSTPTSTGLLRMRRILRSLAWLYPDIGYCQGMGMIVASLLLFVEEEDAFWLTSTIIEDLNPPSYYSSTLIGVQADQRVLRQLIVSYLPHTDQQLKEHDIELSLITLHWFLTAFASVVHTKILLRIWDIYFYEGSVTLFRATLGMLKLKQEYILTLDNSAQIFNVLSDIPGDITDADVLIQAAQKASASLTEVILDAHRKKHMAFLMADLGVVVDKETGKHITKHQVQRRQLGSNRSFFN-LIFGKSNFSLE--------KAKNIKQTEFVADLREAIMHIARHFDAIDPKKVMQQNC----DFNAITRDHERFINMTRNRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVQILDERSKEYSTAGDDSVSETVTDLVRGGLCPALKNIFEHGMRRPSILGGPCHPWLFIEEASQREVERDFQSVYSRLVLCKTFRLDEDGKVLSPEEILYRAVQSINMSHDAASAQMDVKFRSLVCYGLNEQCLHLWLESLCACEDTVAKWYHPWSFLRSPGWIQIKCELRVLATFAFNLNVEWELVHTSKVVEALKEDKSL--QEVTQPMKDGVRDMLVKHHLFSWDL 741          
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Match: EDO27581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8V3])

HSP 1 Score: 290.812 bits (743), Expect = 1.740e-93
Identity = 128/176 (72.73%), Postives = 150/176 (85.23%), Query Frame = 1
Query: 1720 GWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCE 2247
            GWFPAKFV+ILDERSK+Y  AGDDSV+E +TDL+RG  CPALK IFEHGM+R  +L   CHPWLFIEEA+ REVE+DF SVYSRL+LCKTFRLDEDGKVL+PEEIL++A+QS+N +HD A AQMDVK RSL C   ++Q LHLWLE+LC+  D V KWYHPWSF+RSPGW+QIKCE
Sbjct:    1 GWFPAKFVQILDERSKEYSTAGDDSVSETVTDLVRGGLCPALKNIFEHGMRRPSILGGPCHPWLFIEEASQREVERDFQSVYSRLVLCKTFRLDEDGKVLSPEEILYRAVQSINMSHDAASAQMDVKFRSLPCLSCSEQCLHLWLESLCACEDTVAKWYHPWSFLRSPGWIQIKCE 176          
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Match: EDO34196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ41])

HSP 1 Score: 146.362 bits (368), Expect = 1.108e-39
Identity = 79/211 (37.44%), Postives = 129/211 (61.14%), Query Frame = 1
Query:  421 SIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTS---YKEIVNATTSD--HIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLV 1038
            +++LKSM+   GIP+  R Q+W +     ++          Y  ++++  S+      +KQIE DL+RTLP+NV ++   + GI  LR +L   +W  P++GYCQG+  +V+  +L L+EE+ FW + AI+E ++P  Y+S  L+  QADQ  LR+L+ + LP+++       +++SLIT +WFLT+F     I+ +LRVWD F YEG+ V
Sbjct:   27 TMELKSMVRG-GIPNEYRSQIWRQCINHFVRGTKSMAGPNYYAHLLDSIASNIKFSPATKQIELDLLRTLPNNVHYNKPDANGIGMLRNVLMAYSWHNPEVGYCQGLNRLVAIAMLILKEEEAFWCLVAIVEHIMPKDYFSRTLLAAQADQRVLRDLLMEKLPRLYTHFENVRVDLSLITFNWFLTVFIDSFPIQTILRVWDTFLYEGNKV 236          
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Match: EDO34047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQE4])

HSP 1 Score: 137.117 bits (344), Expect = 7.847e-36
Identity = 89/293 (30.38%), Postives = 152/293 (51.88%), Query Frame = 1
Query:  259 DEFGFRV---IDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLE-EEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCL 1125
            DE+GF      D +T  K++    +  ++ LAH    +   L+G          +  S K+K  + + G+P S R Q+WM +SGA  + K     Y+ ++ +   D  +    I  D+ RT P N+ F   S +   +L+ IL   A   P IGYCQG+  I   LLL ++ EE  FWL+ A++   LP  YY+ +++G+Q +Q  L EL+   LP +H  +    +  S+ +  WF+ ++  +L +  +LR+WD  FYEGS +L R+ + ++ L + ++L   +  Q+ N +
Sbjct:    2 DEYGFHRPDDFDYETYSKFM----SSYIRILAHRATRWGSVLKGSSK-------VKKSRKIKRFVRK-GVPSSHRAQVWMDISGARKRMKKLPGYYQSLLESELDD--IVRNSILTDIDRTFPENIYFGSSSDSLKQKLKNILVAYAVHNPKIGYCQGLNYIAGLLLLIIKTEEPAFWLLEAMMMKRLP-DYYAKDMMGLQVEQEVLSELVKIKLPTLHHHIESIGLSYSIFSTKWFICLYIDVLPVETVLRIWDSLFYEGSKILLRVAITLLALHQDKLLAAKDFPQLCNVM 279          
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Match: EDO49828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REP1])

HSP 1 Score: 139.813 bits (351), Expect = 7.650e-34
Identity = 94/302 (31.13%), Postives = 157/302 (51.99%), Query Frame = 1
Query:  406 IIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCL-----------SKLP------------------SEITDINKLILVSYELTEDLTFSTIQALR 1224
            + ++ ++K   +I + GIP +LR ++W+  SGA+ + +     Y  +V        +   +IE+DL R+LP +  F   S  GI  LRR+L   AW  P IGYCQ M ++ S LLL+  EE  FWL+ A+ E LLP  YY+T ++G   DQ    +L   +LP++++ L +  I +++I+L WFLT+F S++     + + D FFY+G+ VLF+I L  +    +++L  ++  +    L           S +P                  S   D++ LIL SY+    +T   I+++R
Sbjct:  505 VCMYRTVKTHELILK-GIPDNLRAEIWLIFSGAINEIETHPGYYVSLVEQCEGKSSLAFDEIERDLHRSLPEHPAFQ--SDVGIGALRRVLTAYAWRNPSIGYCQAMNIVASVLLLYCTEEQAFWLLVAVCERLLP-DYYNTKVVGALVDQGVFEDLTRDHLPELYDHLKDLGI-LNMISLSWFLTLFLSVMPFVCAVNIIDCFFYDGAKVLFQIALACLDANRTKLLSIEDDGEAMTILGAYLDHVTNRDSSIPATTMSVNNRSLGIPSPGFSTSVDVSNLILESYQKFGFITAENIESMR 801          
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:101173226])

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 429/776 (55.28%), Postives = 566/776 (72.94%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNIEIPL-TEDESDEVEFSYDEFGFRVI---DGQ------TRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQL-INKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G Y      P  F+ALT SMWPQ+I      +D  D+ E  YDEFGF+V    DG+      +      E+   RL+W AHLEFT++  + G+L+WD I+ ++  S +L+S++   GIPHS+RPQLWMR+SGAL K++  + SYKEIV  +++D    SKQIEKDL+RT+P+N CF+ ++S G+PRLRR+LR LAWLYPDIGYCQG G+++S LLLFLEEED  W+MCA+IEDLLP SY+S+ L+GVQADQ  LR+LI +YLP I  LL EHDIE+SLITLHWFLT F S+++IR LLR+WDL FY+GSLVLF++ LGM+++KE E++  +N+A IFN LS LPS++ D   ++  +  L   L+  T++A R K++A I+  +    + N+       + +RQ  R RS ++ LL+          ++ +++K KNI+QTE++  LR +I +   HF   +  HS    T PDYS+ SH  D E ++ VSR R++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVEILDERSK+Y  AGDDSV E +TDL+RG  CPALKAIF HG+K+  +L   CHPWLFIEEAASREVE+DF+SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN +HD+AHAQMDVK RSLIC GLN+QVLHLWLE LCSS+  V+KWYHPWSF+RSPGWVQIKCELR+LS+F+F LS D                     ++  + ++E ++++L+ H+LFSW++
Sbjct:    2 SGTYTPAPGGP--FSALTPSMWPQDILAKYHQKDPKDQPEIQYDEFGFKVNTENDGELQSCLGSEGSPQREDPQQRLRWQAHLEFTHNHTV-GDLTWDLIDPVLPRSERLRSLVLG-GIPHSMRPQLWMRLSGALQKKRTSEISYKEIVKNSSNDDSSTSKQIEKDLLRTMPTNACFNTLNSVGVPRLRRLLRSLAWLYPDIGYCQGTGMVISCLLLFLEEEDALWMMCALIEDLLPPSYFSSTLLGVQADQRVLRQLIIQYLPSIDHLLQEHDIELSLITLHWFLTSFASVVDIRLLLRIWDLLFYQGSLVLFQVTLGMLKIKEEELVSSENSASIFNTLSDLPSQLRDGASVLGEAMRLAGGLSQETVEAQRHKHVAYILNEQAQLNNGNNTTLNLNKVVRRQSLRRRSTLTSLLF--------GQDEAEALKSKNIKQTELVASLREAIARTAEHFHCLDPRHSSAELT-PDYSMESHQRDHETFLVVSRYRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEILDERSKEYSLAGDDSVTEAVTDLVRGTLCPALKAIFLHGLKKPSILGGPCHPWLFIEEAASREVERDFNSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDSAHAQMDVKFRSLICVGLNEQVLHLWLEVLCSSMAAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQD-------------CELPEKKEEKEQKPLKEGVQDMLVKHHLFSWDI 751          
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:101173226])

HSP 1 Score: 810.446 bits (2092), Expect = 0.000e+0
Identity = 429/776 (55.28%), Postives = 566/776 (72.94%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNIEIPL-TEDESDEVEFSYDEFGFRVI---DGQ------TRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQL-INKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G Y      P  F+ALT SMWPQ+I      +D  D+ E  YDEFGF+V    DG+      +      E+   RL+W AHLEFT++  + G+L+WD I+ ++  S +L+S++   GIPHS+RPQLWMR+SGAL K++  + SYKEIV  +++D    SKQIEKDL+RT+P+N CF+ ++S G+PRLRR+LR LAWLYPDIGYCQG G+++S LLLFLEEED  W+MCA+IEDLLP SY+S+ L+GVQADQ  LR+LI +YLP I  LL EHDIE+SLITLHWFLT F S+++IR LLR+WDL FY+GSLVLF++ LGM+++KE E++  +N+A IFN LS LPS++ D   ++  +  L   L+  T++A R K++A I+  +    + N+       + +RQ  R RS ++ LL+          ++ +++K KNI+QTE++  LR +I +   HF   +  HS    T PDYS+ SH  D E ++ VSR R++RAKA+LDFERHDDDELGF+KNDII IIS KDEHCW+GELNGLRGWFPAKFVEILDERSK+Y  AGDDSV E +TDL+RG  CPALKAIF HG+K+  +L   CHPWLFIEEAASREVE+DF+SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN +HD+AHAQMDVK RSLIC GLN+QVLHLWLE LCSS+  V+KWYHPWSF+RSPGWVQIKCELR+LS+F+F LS D                     ++  + ++E ++++L+ H+LFSW++
Sbjct:    2 SGTYTPAPGGP--FSALTPSMWPQDILAKYHQKDPKDQPEIQYDEFGFKVNTENDGELQSCLGSEGSPQREDPQQRLRWQAHLEFTHNHTV-GDLTWDLIDPVLPRSERLRSLVLG-GIPHSMRPQLWMRLSGALQKKRTSEISYKEIVKNSSNDDSSTSKQIEKDLLRTMPTNACFNTLNSVGVPRLRRLLRSLAWLYPDIGYCQGTGMVISCLLLFLEEEDALWMMCALIEDLLPPSYFSSTLLGVQADQRVLRQLIIQYLPSIDHLLQEHDIELSLITLHWFLTSFASVVDIRLLLRIWDLLFYQGSLVLFQVTLGMLKIKEEELVSSENSASIFNTLSDLPSQLRDGASVLGEAMRLAGGLSQETVEAQRHKHVAYILNEQAQLNNGNNTTLNLNKVVRRQSLRRRSTLTSLLF--------GQDEAEALKSKNIKQTELVASLREAIARTAEHFHCLDPRHSSAELT-PDYSMESHQRDHETFLVVSRYRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEILDERSKEYSLAGDDSVTEAVTDLVRGTLCPALKAIFLHGLKKPSILGGPCHPWLFIEEAASREVERDFNSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDSAHAQMDVKFRSLICVGLNEQVLHLWLEVLCSSMAAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQD-------------CELPEKKEEKEQKPLKEGVQDMLVKHHLFSWDI 751          
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:101173226])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 429/782 (54.86%), Postives = 566/782 (72.38%), Query Frame = 1
Query:  133 NGEYLDNNSQPEAFAALTSSMWPQNIEIPL-TEDESDEVEFSYDEFGFRVI---DGQ------TRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQL-INKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDII------NIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            +G Y      P  F+ALT SMWPQ+I      +D  D+ E  YDEFGF+V    DG+      +      E+   RL+W AHLEFT++  + G+L+WD I+ ++  S +L+S++   GIPHS+RPQLWMR+SGAL K++  + SYKEIV  +++D    SKQIEKDL+RT+P+N CF+ ++S G+PRLRR+LR LAWLYPDIGYCQG G+++S LLLFLEEED  W+MCA+IEDLLP SY+S+ L+GVQADQ  LR+LI +YLP I  LL EHDIE+SLITLHWFLT F S+++IR LLR+WDL FY+GSLVLF++ LGM+++KE E++  +N+A IFN LS LPS++ D   ++  +  L   L+  T++A R K++A I+  +    + N+       + +RQ  R RS ++ LL+          ++ +++K KNI+QTE++  LR +I +   HF   +  HS    T PDYS+ SH  D E ++ VSR R++RAKA+LDFERHDDDELGF+KNDII       IIS KDEHCW+GELNGLRGWFPAKFVEILDERSK+Y  AGDDSV E +TDL+RG  CPALKAIF HG+K+  +L   CHPWLFIEEAASREVE+DF+SVYSRL+LCKT+RLDEDGKVLTPEE+L++A+QSVN +HD+AHAQMDVK RSLIC GLN+QVLHLWLE LCSS+  V+KWYHPWSF+RSPGWVQIKCELR+LS+F+F LS D                     ++  + ++E ++++L+ H+LFSW++
Sbjct:    2 SGTYTPAPGGP--FSALTPSMWPQDILAKYHQKDPKDQPEIQYDEFGFKVNTENDGELQSCLGSEGSPQREDPQQRLRWQAHLEFTHNHTV-GDLTWDLIDPVLPRSERLRSLVLG-GIPHSMRPQLWMRLSGALQKKRTSEISYKEIVKNSSNDDSSTSKQIEKDLLRTMPTNACFNTLNSVGVPRLRRLLRSLAWLYPDIGYCQGTGMVISCLLLFLEEEDALWMMCALIEDLLPPSYFSSTLLGVQADQRVLRQLIIQYLPSIDHLLQEHDIELSLITLHWFLTSFASVVDIRLLLRIWDLLFYQGSLVLFQVTLGMLKIKEEELVSSENSASIFNTLSDLPSQLRDGASVLGEAMRLAGGLSQETVEAQRHKHVAYILNEQAQLNNGNNTTLNLNKVVRRQSLRRRSTLTSLLF--------GQDEAEALKSKNIKQTELVASLREAIARTAEHFHCLDPRHSSAELT-PDYSMESHQRDHETFLVVSRYRRRRAKALLDFERHDDDELGFRKNDIITVKNIVGIISQKDEHCWVGELNGLRGWFPAKFVEILDERSKEYSLAGDDSVTEAVTDLVRGTLCPALKAIFLHGLKKPSILGGPCHPWLFIEEAASREVERDFNSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDSAHAQMDVKFRSLICVGLNEQVLHLWLEVLCSSMAAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQD-------------CELPEKKEEKEQKPLKEGVQDMLVKHHLFSWDI 757          
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Match: tbc1d2b (TBC1 domain family member 2B [Source:NCBI gene;Acc:101174263])

HSP 1 Score: 158.303 bits (399), Expect = 2.779e-39
Identity = 92/278 (33.09%), Postives = 150/278 (53.96%), Query Frame = 1
Query:  421 SIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKN---CKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQI 1245
            S +LKS+I   G+PH  R ++W       +K+         Y+ ++N         SKQIE DL+RTLP+N  ++  S+ GI +LR +L   +W  PDIGYCQG+  + +  LL+L++ED FW + AI+E  +P  YY+  L+G Q DQ   ++L+ + LP++H    +  ++ SLIT +WFL +F   +    L ++WD F +EG  ++FR  L + + KE E L+  ++   F  L      I D  KL+ +++          I   R  +L ++
Sbjct:  659 SPELKSLIR-CGVPHEHRSKVWRWCVSFHVKKFRDHLAPDYYETLLNVAREKPNPASKQIELDLLRTLPNNKHYASPSAAGIQKLRNVLVAFSWRNPDIGYCQGLNRLAAITLLYLDQEDAFWALVAIVEVFMPRDYYTKTLLGSQVDQRVFKDLMSEKLPRLHAHFEQQMVDFSLITFNWFLVVFVDSVVSDILFKIWDAFLFEGPKIIFRFALALFKYKEEEFLKLHDSTATFKYLRYFTRTILDSRKLMNIAFAGMNPFPMKQIHNRRAFHLEKV 935          
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Match: tbc1d2b (TBC1 domain family member 2B [Source:NCBI gene;Acc:101174263])

HSP 1 Score: 157.918 bits (398), Expect = 2.829e-39
Identity = 92/278 (33.09%), Postives = 150/278 (53.96%), Query Frame = 1
Query:  421 SIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKN---CKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQI 1245
            S +LKS+I   G+PH  R ++W       +K+         Y+ ++N         SKQIE DL+RTLP+N  ++  S+ GI +LR +L   +W  PDIGYCQG+  + +  LL+L++ED FW + AI+E  +P  YY+  L+G Q DQ   ++L+ + LP++H    +  ++ SLIT +WFL +F   +    L ++WD F +EG  ++FR  L + + KE E L+  ++   F  L      I D  KL+ +++          I   R  +L ++
Sbjct:  618 SPELKSLIR-CGVPHEHRSKVWRWCVSFHVKKFRDHLAPDYYETLLNVAREKPNPASKQIELDLLRTLPNNKHYASPSAAGIQKLRNVLVAFSWRNPDIGYCQGLNRLAAITLLYLDQEDAFWALVAIVEVFMPRDYYTKTLLGSQVDQRVFKDLMSEKLPRLHAHFEQQMVDFSLITFNWFLVVFVDSVVSDILFKIWDAFLFEGPKIIFRFALALFKYKEEEFLKLHDSTATFKYLRYFTRTILDSRKLMNIAFAGMNPFPMKQIHNRRAFHLEKV 894          
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Match: SMESG000012909.1 (SMESG000012909.1)

HSP 1 Score: 1466.83 bits (3796), Expect = 0.000e+0
Identity = 749/788 (95.05%), Postives = 764/788 (96.95%), Query Frame = 1
Query:   64 MDVVSNNSMEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            MDVVSNNSMEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPRLRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCELRLL QFSF L+ D EL ++ +    ++           + ++ N+R++L+ H+LFSWE+
Sbjct:    1 MDVVSNNSMEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPRLRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCELRLLCQFSFTLNKDIELQSLLSISSIKN-----------DSVQRNVRDMLVKHHLFSWEI 777          
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Match: SMESG000012909.1 (SMESG000012909.1)

HSP 1 Score: 1449.49 bits (3751), Expect = 0.000e+0
Identity = 741/780 (95.00%), Postives = 756/780 (96.92%), Query Frame = 1
Query:   88 MEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            MEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPRLRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCELRLL QFSF L+ D EL ++ +    ++           + ++ N+R++L+ H+LFSWE+
Sbjct:    1 MEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPRLRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCELRLLCQFSFTLNKDIELQSLLSISSIKN-----------DSVQRNVRDMLVKHHLFSWEI 769          
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Match: SMESG000012909.1 (SMESG000012909.1)

HSP 1 Score: 1441.79 bits (3731), Expect = 0.000e+0
Identity = 740/783 (94.51%), Postives = 756/783 (96.55%), Query Frame = 1
Query:   88 MEVSSQKYLNYSA---KTNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCEXXXXXXXXXXXXXDWELVTMDNYDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL 2427
            MEVSSQKYLNYSA   +TNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPRLRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCELRLL QFSF L+ D EL ++ +    ++           + ++ N+R++L+ H+LFSWE+
Sbjct:    1 MEVSSQKYLNYSATHSETNGEYLDNNSQPEAFAALTSSMWPQNIEIPLTEDESDEVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTYSKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPRLRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGLFVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKNIRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERYVQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNGLRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEHGMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCELRLLCQFSFTLNKDIELQSLLSISSIKN-----------DSVQRNVRDMLVKHHLFSWEI 772          
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Match: SMESG000015478.1 (SMESG000015478.1)

HSP 1 Score: 134.42 bits (337), Expect = 7.575e-32
Identity = 87/279 (31.18%), Postives = 150/279 (53.76%), Query Frame = 1
Query:  454 GIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLY--PDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLP---KIHELL------AEHDIE--ISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKL---------PSEITDINKLILVSYELTEDLTFSTIQALR 1224
            G+ + LR ++WM +SGA  +       Y  +V+ T +     S++IE+DL R+LP +  +     T            A+ Y  P+IGYCQ M ++ S LLLF  EE+ FWL+ AI E LLP  YY+  +IGV+ DQ  L++L+  +L       +        A + +   I ++++ WFLTI+ ++++  N + + D FFY+G+ V+F+I L +++  ++ +++  +  +   C+ KL         P ++T I +LI  +YE    +T S I+ LR
Sbjct:  472 GLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYH----TDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLP-DYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLT-IEELIGSAYENFGTVTNSLIKQLR 744          
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Match: SMESG000015478.1 (SMESG000015478.1)

HSP 1 Score: 134.42 bits (337), Expect = 8.037e-32
Identity = 90/277 (32.49%), Postives = 156/277 (56.32%), Query Frame = 1
Query:  454 GIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTXXXXXXXXXXXXAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLP---KIHELL------AEHDIE--ISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKL---------PSEITDINKLILVSYELTEDLTFSTIQALR 1224
            G+ + LR ++WM +SGA  +       Y  +V+ T +     S++IE+DL R+LP +  +   +  G+  LRR+L   A+  P+IGYCQ M ++ S LLLF  EE+ FWL+ AI E LLP  YY+  +IGV+ DQ  L++L+  +L       +        A + +   I ++++ WFLTI+ ++++  N + + D FFY+G+ V+F+I L +++  ++ +++  +  +   C+ KL         P ++T I +LI  +YE    +T S I+ LR
Sbjct:  489 GLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYH--TDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLP-DYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLT-IEELIGSAYENFGTVTNSLIKQLR 761          
The following BLAST results are available for this feature:
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SGSM30.000e+056.04small G protein signaling modulator 3 [Source:HGNC... [more]
SGSM37.390e-10160.78small G protein signaling modulator 3 [Source:HGNC... [more]
SGSM31.789e-8277.44small G protein signaling modulator 3 [Source:HGNC... [more]
TBC1D28.263e-4631.82TBC1 domain family member 2 [Source:HGNC Symbol;Ac... [more]
TBC1D27.075e-4532.10TBC1 domain family member 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc-180.000e+043.99TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-22.321e-3833.22TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-22.321e-3833.22TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-92.380e-3533.86TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-92.803e-3533.86TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG122410.000e+054.49gene:FBgn0038304 transcript:FBtr0083051[more]
CG73242.936e-3330.41gene:FBgn0037074 transcript:FBtr0331797[more]
CG73243.003e-3330.41gene:FBgn0037074 transcript:FBtr0078404[more]
CG59167.423e-3030.63gene:FBgn0038401 transcript:FBtr0344009[more]
CG59167.423e-3030.63gene:FBgn0038401 transcript:FBtr0083251[more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgsm30.000e+055.01small G protein signaling modulator 3 [Source:NCBI... [more]
sgsm31.677e-8173.37small G protein signaling modulator 3 [Source:NCBI... [more]
tbc1d21.074e-4131.90TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-... [more]
tbc1d2b8.480e-3932.04TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB... [more]
tbc1d2b1.178e-3832.04TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mak0.000e+056.92male germ cell associated kinase [Source:Xenbase;A... [more]
mak0.000e+056.92male germ cell associated kinase [Source:Xenbase;A... [more]
mak0.000e+056.79male germ cell associated kinase [Source:Xenbase;A... [more]
mak0.000e+054.57male germ cell associated kinase [Source:Xenbase;A... [more]
mak0.000e+057.44male germ cell associated kinase [Source:Xenbase;A... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sgsm30.000e+055.56small G protein signaling modulator 3 [Source:MGI ... [more]
Sgsm30.000e+055.29small G protein signaling modulator 3 [Source:MGI ... [more]
Sgsm36.179e-7357.14small G protein signaling modulator 3 [Source:MGI ... [more]
Tbc1d25.550e-4331.38TBC1 domain family, member 2 [Source:MGI Symbol;Ac... [more]
Tbc1d2b1.005e-4031.96TBC1 domain family, member 2B [Source:MGI Symbol;A... [more]
back to top
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KI13|SGSM3_BOVIN0.000e+056.03Small G protein signaling modulator 3 OS=Bos tauru... [more]
sp|Q96HU1|SGSM3_HUMAN0.000e+056.04Small G protein signaling modulator 3 OS=Homo sapi... [more]
sp|A6H8I2|SGSM3_XENLA0.000e+055.78Small G protein signaling modulator 3 homolog OS=X... [more]
sp|Q6P6R7|SGSM3_RAT0.000e+055.89Small G protein signaling modulator 3 OS=Rattus no... [more]
sp|Q8VCZ6|SGSM3_MOUSE0.000e+055.56Small G protein signaling modulator 3 OS=Mus muscu... [more]
back to top
BLAST of TBC1 domain family member 2B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210Q0E70.000e+058.32Small G protein signaling modulator 3-like OS=Mizu... [more]
A0A0B7ACK40.000e+058.70Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A0B7AA750.000e+058.40Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A433T8050.000e+060.05Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
K1Q6P10.000e+058.48Small G protein signaling modulator 3-like protein... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgsm30.000e+054.50small G protein signaling modulator 3 [Source:NCBI... [more]
sgsm30.000e+054.50small G protein signaling modulator 3 [Source:NCBI... [more]
sgsm30.000e+055.08small G protein signaling modulator 3 [Source:NCBI... [more]
tbc1d21.738e-4130.75TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-... [more]
tbc1d21.790e-4031.27TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d2b3.523e-4632.70TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB... [more]
TBC1D94.110e-3434.87TBC1 domain family member 9 [Source:HGNC Symbol;Ac... [more]
ENSPMAT00000006389.12.396e-3236.00pep scaffold:Pmarinus_7.0:GL481951:143257:161898:-... [more]
tbc1d10b2.590e-2325.70TBC1 domain family, member 10b [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000009273.11.261e-1536.73pep scaffold:Pmarinus_7.0:GL480906:1861:20274:1 ge... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
MDR11.473e-3532.41Cytoplasmic GTPase-activating protein; activates Y... [more]
MSB45.958e-2627.73GTPase-activating protein of the Ras superfamily; ... [more]
MSB36.654e-1727.55Rab GTPase-activating protein; regulates endocytos... [more]
GYP53.716e-1222.84GTPase-activating protein (GAP) for yeast Rab fami... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO350210.000e+054.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275811.740e-9372.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341961.108e-3937.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340477.847e-3630.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498287.650e-3431.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgsm30.000e+055.28small G protein signaling modulator 3 [Source:NCBI... [more]
sgsm30.000e+055.28small G protein signaling modulator 3 [Source:NCBI... [more]
sgsm30.000e+054.86small G protein signaling modulator 3 [Source:NCBI... [more]
tbc1d2b2.779e-3933.09TBC1 domain family member 2B [Source:NCBI gene;Acc... [more]
tbc1d2b2.829e-3933.09TBC1 domain family member 2B [Source:NCBI gene;Acc... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012909.10.000e+095.05SMESG000012909.1[more]
SMESG000012909.10.000e+095.00SMESG000012909.1[more]
SMESG000012909.10.000e+094.51SMESG000012909.1[more]
SMESG000015478.17.575e-3231.18SMESG000015478.1[more]
SMESG000015478.18.037e-3232.49SMESG000015478.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004335 ID=SMED30004335|Name=TBC1 domain family member 2B|organism=Schmidtea mediterranea sexual|type=transcript|length=2525bp
GATCTATCAAGGTCCTTTGGTAATTTTTACACAATCTTTCTAGATTTATC
TTATAGTTAATTTATGGACGTTGTTAGTAATAATTCGATGGAAGTGAGCA
GTCAAAAATATTTAAATTATTCTGCAAAAACGAATGGAGAATATCTAGAT
AATAATTCACAACCAGAAGCTTTTGCTGCTTTAACCTCCTCAATGTGGCC
ACAAAATATTGAAATTCCACTAACGGAAGATGAATCAGATGAAGTAGAAT
TTAGTTATGATGAATTTGGTTTTCGAGTTATTGACGGGCAAACGAGACAA
AAATATGTCCTCGAAAATGAAGCTCATCGATTACAATGGTTAGCTCATCT
GGAATTTACATACTCAAAAAATCTGGAAGGAGAGTTGTCATGGGATGATA
TTGAAATCATCATTCATCCTTCGATAAAATTAAAATCAATGATTCACGAA
TATGGGATCCCCCATTCCCTTCGACCTCAATTATGGATGCGAATGTCTGG
GGCATTGATTAAGCGAAAAAACTGTAAAACGTCGTACAAAGAAATCGTCA
ACGCAACTACATCAGATCATATTATGTGTTCTAAGCAGATTGAAAAAGAT
CTTGTTCGGACTCTTCCAAGCAATGTTTGTTTTTCTCACATATCAAGTAC
AGGAATTCCCCGTCTTCGTAGAATTCTTCGTGGATTGGCATGGCTTTATC
CTGATATTGGTTATTGCCAAGGAATGGGAGTAATCGTGTCTCACTTGTTG
CTGTTCCTGGAGGAAGAAGACACCTTCTGGCTGATGTGTGCAATAATAGA
AGATCTGTTGCCAGTGTCATATTATTCCACAAATTTGATTGGCGTTCAAG
CGGATCAAATGACATTACGGGAATTGATTCCCAAATATCTGCCAAAAATC
CATGAATTATTAGCAGAACACGATATAGAAATTTCACTCATTACTCTACA
TTGGTTTCTCACAATCTTCGGTAGTATTTTAAATATTCGAAATTTGTTAC
GCGTTTGGGATTTGTTCTTTTATGAAGGTTCTCTTGTTTTATTCAGAATC
ATTCTCGGCATGATCCAATTGAAAGAATCAGAAATGTTAGAATTCGATAA
CACAGCTCAGATTTTTAATTGTTTGTCAAAATTACCTTCCGAAATAACAG
ATATTAATAAACTAATTTTGGTATCTTATGAACTCACTGAAGATCTAACT
TTTTCTACAATTCAAGCCCTCAGAAAAAAATATCTCGCACAAATCATGAC
AAATGAGGGGCTATTTGTTGACCCTAATCACAATTTACCAAAACAGTTGA
TTAATAAACGCCAATTAAAGCGATCTAGATCATTGATCTCTCAGTTATTA
TGGCACAATAATAACAGCTCTGTTGCCAGTTCAAACGATATAGATTCTAT
TAAATTGAAAAACATTCGTCAAACTGAAATGTTAGTCGACTTAAGAAATT
CTATTCTTCAGATAATTCGGCATTTTGAAAATTACAACACTTCTCATTCA
TTCCATTATAACACTCAACCCGATTACAGTTTACATAGCCATGCTGAGGA
TCTTGAGCGATATGTTCAAGTTTCTAGAAATAGACAGAAAAGAGCTAAAG
CAATTTTAGACTTTGAACGACATGACGATGATGAATTGGGTTTCAAGAAA
AATGATATAATTAATATTATTAGCATGAAAGATGAACATTGTTGGATCGG
GGAACTCAATGGATTGAGAGGCTGGTTTCCAGCTAAATTTGTAGAAATTC
TAGATGAACGCAGTAAAGATTATTGTGCAGCTGGAGATGACAGTGTTAAT
GAGGAAATAACAGATTTAATACGAGGATTATTTTGTCCAGCTTTAAAAGC
AATTTTCGAGCATGGAATGAAAAGAGCTCATCTATTAGAATCAAAATGTC
ATCCTTGGTTATTTATCGAAGAAGCTGCTTCTAGAGAAGTGGAAAAAGAT
TTTCATTCAGTTTATTCACGACTTATGTTATGCAAAACATTCAGATTGGA
TGAAGATGGGAAAGTTTTAACACCGGAAGAGATTCTTTTCAAAGCAATAC
AAAGTGTTAATTTTACTCATGACAATGCACATGCACAAATGGATGTTAAA
CTTAGATCTTTAATATGTTGCGGCTTGAATGATCAAGTACTTCATCTTTG
GTTAGAAACATTATGTTCAAGTTTAGATGTTGTCAAAAAATGGTATCACC
CTTGGTCATTTATCAGAAGTCCAGGTTGGGTACAAATAAAATGTGAATTG
CGGTTATTATCACAGTTCTCCTTCCAACTGTCATCAGATTGGGAATTGGT
CACAATGGACAATTACGACCACAAGCAAAGTACGGGAGAATATATACTCA
ATCAGCAAGTTGCCGAGAAAATGCGCGAAAACATCCGCGAGATATTAATG
CATCATAATTTATTCAGTTGGGAATTGTAAAATCCGATTTTTCTATTATT
ATTTTCTTTCATGATGTTTCATTCTGTGATAAGTCTTTGTCTATTTTTGT
CTATAAATTATATTTACCTCAACAT
back to top

protein sequence of SMED30004335-orf-1

>SMED30004335-orf-1 ID=SMED30004335-orf-1|Name=SMED30004335-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=789bp
MDVVSNNSMEVSSQKYLNYSAKTNGEYLDNNSQPEAFAALTSSMWPQNIE
IPLTEDESDEVEFSYDEFGFRVIDGQTRQKYVLENEAHRLQWLAHLEFTY
SKNLEGELSWDDIEIIIHPSIKLKSMIHEYGIPHSLRPQLWMRMSGALIK
RKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPR
LRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLP
VSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIEISLITLHWFLT
IFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQI
FNCLSKLPSEITDINKLILVSYELTEDLTFSTIQALRKKYLAQIMTNEGL
FVDPNHNLPKQLINKRQLKRSRSLISQLLWHNNNSSVASSNDIDSIKLKN
IRQTEMLVDLRNSILQIIRHFENYNTSHSFHYNTQPDYSLHSHAEDLERY
VQVSRNRQKRAKAILDFERHDDDELGFKKNDIINIISMKDEHCWIGELNG
LRGWFPAKFVEILDERSKDYCAAGDDSVNEEITDLIRGLFCPALKAIFEH
GMKRAHLLESKCHPWLFIEEAASREVEKDFHSVYSRLMLCKTFRLDEDGK
VLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETL
CSSLDVVKKWYHPWSFIRSPGWVQIKCELRLLSQFSFQLSSDWELVTMDN
YDHKQSTGEYILNQQVAEKMRENIREILMHHNLFSWEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR037213Run_dom_sf
IPR035833SGSM3_SH3
IPR035969Rab-GTPase_TBC_sf
IPR036028SH3-like_dom_sf
IPR004012Run_dom
IPR001452SH3_domain
IPR000195Rab-GTPase-TBC_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005096GTPase activator activity
GO:0017137Rab GTPase binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
GO:0005829cytosol
GO:0012505endomembrane system
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0007049cell cycle
GO:0007050cell cycle arrest
GO:0031338regulation of vesicle fusion
GO:0032483regulation of Rab protein signal transduction
GO:0032486Rap protein signal transduction
GO:0048227plasma membrane to endosome transport
GO:0090630activation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000195Rab-GTPase-TBC domainSMARTSM00164tbc_4coord: 128..345
e-value: 1.8E-55
score: 200.3
IPR000195Rab-GTPase-TBC domainPFAMPF00566RabGAP-TBCcoord: 135..341
e-value: 7.3E-49
score: 166.3
IPR000195Rab-GTPase-TBC domainPROSITEPS50086TBC_RABGAPcoord: 131..322
score: 35.126
IPR001452SH3 domainSMARTSM00326SH3_2coord: 509..564
e-value: 2.2E-17
score: 73.7
IPR001452SH3 domainPFAMPF00018SH3_1coord: 512..557
e-value: 3.9E-11
score: 42.4
IPR001452SH3 domainPROSITEPS50002SH3coord: 506..565
score: 23.902
IPR004012RUN domainSMARTSM00593893paper3coord: 680..742
e-value: 1.8E-19
score: 80.7
IPR004012RUN domainPFAMPF02759RUNcoord: 590..742
e-value: 7.4E-31
score: 106.9
IPR004012RUN domainPROSITEPS50826RUNcoord: 581..744
score: 28.131
NoneNo IPR availableGENE3DG3DSA:1.10.8.270coord: 146..253
e-value: 2.9E-27
score: 96.5
NoneNo IPR availableGENE3DG3DSA:1.10.472.80coord: 254..375
e-value: 6.0E-28
score: 99.2
NoneNo IPR availablePANTHERPTHR22957:SF296SMALL G PROTEIN SIGNALING MODULATOR 3coord: 81..549
NoneNo IPR availablePANTHERPTHR22957TBC1 DOMAIN FAMILY MEMBER GTPASE-ACTIVATING PROTEINcoord: 81..549
IPR037213RUN domain superfamilyGENE3DG3DSA:1.20.58.900coord: 450..750
e-value: 3.5E-44
score: 152.5
IPR037213RUN domain superfamilySUPERFAMILYSSF140741RUN domain-likecoord: 590..743
IPR035833SGSM3, SH3 domainCDDcd11813SH3_SGSM3coord: 510..562
e-value: 2.16298E-31
score: 114.519
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 120..280
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 257..374
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 498..568