Coiled-coil domain containing 88C

Overview
NameCoiled-coil domain containing 88C
Smed IDSMED30004319
Length (bp)5746
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain containing 88C (SMED30004319) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain containing 88C (SMED30004319) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain containing 88C (SMED30004319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain containing 88C (SMED30004319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v6_5291_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30004319SMESG000066575.1 SMESG000066583.1 dd_Smed_v4_5291_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain containing 88C vs. Ensembl Human
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 359.762 bits (922), Expect = 7.118e-100
Identity = 396/1412 (28.05%), Postives = 746/1412 (52.83%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEK-FVKMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC---IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ-----MVKQLRCVTEQWEDSFIEDTKAILS---QNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXD-QVIEKTNAKLLRLEIENRSLLEKLSDIKFD-DTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKS--YQDNLQ-LSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETL---EEN----------------MKELAMENQRKTS---QLMKKISELESELVKTK----------TENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXX---XXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK 4102
            F P++  F+TS  + + K F  + A     L  ++ L              DG FLN+V  +I+P      Q V  +   D    + N  IL++ I+ YY   LQQ  ++ LP+++ I  +P S +   E+ K + L+LG AVQC++KE FI+ I  +  +   +  +  +I+++T + + V +   +E     Q     ++K +    ++  D   E ++ I+    + D L        +      + G+        + S + +++ELA+ KAK+R+L+ EL++K + + D + +LE  + E  +L++  M L +++R  RM +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E        +I +L  + M+++      +     L  EL+++  +   S         +V E T+++LL+LE+EN+SL + + +++   D+ E N  K  I ++E+EN RL  KV  L+    +E Q     +   + L +EK QL+  I++++EN+ R+I+ L QENE+L++T+  +R+RS+ S + RV ++EKEN  LH S+ E + KLSK+EF+ +++ ++        +++   ++ L  L K+N  L+K++ NLK+   ++E L+ + S LE E  +L   +  +     Q  S+  E     EEN                M +L +EN+   S   QL K +  L++   KT+           EN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++ +LE++ KQL+KEN R + Q  A++    + +N +        +  L+K +K   +++ +   E+  RL + E++N+EL+++   + +   TLRE+L++E++ +Q + N ++ L+ ELE+IG+       + ++ ++++K+LESK+ ST++ ++  KEE+I +L++RL  S   N++L  +L+  +  Y +L+Q+ +EE  V S        +         T+ LL +KD LI+VER NA L +EKQ L +Q + L+ + +  + + +    Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q +++E    S + +   L      L      L+ L+ + ++EYE L  +  + KS +K++  +     D   Q  K+   L+ L+++L+ E+  +    +   ++  E   L  E ND L   Y ++  E + L  ++K LK  LNN K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K
Sbjct:    6 FTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALV-------------DGVFLNQVMLQINPK--LESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI--QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKR------TESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASK--ILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEKGERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKMAQLQLENKELESEKEQLKKGLELLKASFKKTERLEVSYQGLDIENQRLQKTLENSNKKIQQLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKRLRQQ--AEIKDTTLEENNVK-------IGNLEKENKTLSKEIGI-YKESCVRLKELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDRYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSSPPISGEDNKWERESQETTRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENESVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHRDLEDRYNQLLKQKGQLEDLEKMLKVEQEKMLLENKNHETVAAEYKKLCGE-NDRLNHTYSQLLKETEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYK 1381          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Human
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 358.992 bits (920), Expect = 1.134e-99
Identity = 397/1413 (28.10%), Postives = 744/1413 (52.65%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEK-FVKMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC---IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ-----MVKQLRCVTEQWEDSFIEDTKAILS---QNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXD-QVIEKTNAKLLRLEIENRSLLEKLSDIKFD-DTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKS--YQDNLQ-LSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETL---EEN----------------MKELAMENQRKTS---QLMKKISELESELVKTK----------TENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXX---XXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK 4102
            F P++  F+TS  + + K F  + A     L  ++ L              DG FLN+V  +I+P      Q V  +   D    + N  IL++ I+ YY   LQQ  ++ LP+++ I  +P S +   E+ K + L+LG AVQC++KE FI+ I  +  +   +  +  +I+++T + + V +   +E     Q     ++K +    ++  D   E ++ I+    + D L        +      + G+        + S + +++ELA+ KAK+R+L+ EL++K + + D + +LE  + E  +L++  M L +++R  RM +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E        +I +L  + M+++      +     L  EL+++  +   S         +V E T+++LL+LE+EN+SL + + +++   D+ E N  K  I ++E+EN RL  KV  L+    +E Q     +   + L +EK QL+  I++++EN+ R+I+ L QENE+L++T+  +R+RS+ S + RV ++EKEN  LH S+ E + KLSK+EF+ +++ ++        +++   ++ L  L K+N  L+K++ NLK+   ++E L+ + S LE E  +L   +  +     Q  S+  E     EEN                M +L +EN+   S   QL K +  L++   KT+           EN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++ +LE++ KQL+KEN R + Q  A++    + +N +        +  L+K +K   +++ +   E+  RL + E++N+EL+++   + +   TLRE+L++E++ +Q + N ++ L+ ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I +L++RL  S   N++L  +L+  +  Y +L+Q+ +EE  V S        +         T+ LL +KD LI+VER NA L +EKQ L +Q + L+ + +  + + +    Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q +++E    S + +   L      L      L+ L+ + ++EYE L  +  + KS +K++  +     D   Q  K+   L+ L+++L+ E+  +    +   ++  E   L  E ND L   Y ++  E + L  ++K LK  LNN K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K
Sbjct:    6 FTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALV-------------DGVFLNQVMLQINPK--LESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI--QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKR------TESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASK--ILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEKGERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKMAQLQLENKELESEKEQLKKGLELLKASFKKTERLEVSYQGLDIENQRLQKTLENSNKKIQQLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKRLRQQ--AEIKDTTLEENNVK-------IGNLEKENKTLSKEIGI-YKESCVRLKELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDSRYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSSPPISGEDNKWERESQETTRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENESVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHRDLEDRYNQLLKQKGQLEDLEKMLKVEQEKMLLENKNHETVAAEYKKLCGE-NDRLNHTYSQLLKETEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYK 1382          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Human
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 356.295 bits (913), Expect = 9.270e-99
Identity = 398/1428 (27.87%), Postives = 751/1428 (52.59%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEK-FVKMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC---IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ-----MVKQLRCVTEQWEDSFIEDTKAILS---QNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXD-QVIEKTNAKLLRLEIENRSLLEKLSDIKFD-DTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKS--YQDNLQ-LSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETL---EEN----------------MKELAMENQRKTS---QLMKKISELESELVKTK----------TENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAV---IXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F P++  F+TS  + + K F  + A     L  ++ L              DG FLN+V  +I+P      Q V  +   D    + N  IL++ I+ YY   LQQ  ++ LP+++ I  +P S +   E+ K + L+LG AVQC++KE FI+ I  +  +   +  +  +I+++T + + V +   +E     Q     ++K +    ++  D   E ++ I+    + D L        +      + G+        + S + +++ELA+ KAK+R+L+ EL++K + + D + +LE  + E  +L++  M L +++R  RM +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E        +I +L  + M+++      +     L  EL+++  +   S         +V E T+++LL+LE+EN+SL + + +++   D+ E N  K  I ++E+EN RL  KV  L+    +E Q     +   + L +EK QL+  I++++EN+ R+I+ L QENE+L++T+  +R+RS+ S + RV ++EKEN  LH S+ E + KLSK+EF+ +++ ++        +++   ++ L  L K+N  L+K++ NLK+   ++E L+ + S LE E  +L   +  +     Q  S+  E     EEN                M +L +EN+   S   QL K +  L++   KT+           EN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++ +LE++ KQL+KEN R + Q  A++    + +N +        +  L+K +K   +++ +   E+  RL + E++N+EL+++   + +   TLRE+L++E++ +Q + N ++ L+ ELE+IG+       + ++ ++++K+LESK+ ST++ ++  KEE+I +L++RL  S   N++L  +L+  +  Y +L+Q+ +EE  V     +    +         T+ LL +KD LI+VER NA L +EKQ L +Q + L+ + +  + + +    Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q +++E    S + +   L      L      L+ L+ + ++EYE L  +  + KS +K++  +     D   Q  K+   L+ L+++L+ E+  +    +   ++  E   L  E ND L   Y ++  E + L  ++K LK  LNN K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALV-------------DGVFLNQVMLQINPK--LESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI--QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKR------TESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASK--ILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEKGERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKMAQLQLENKELESEKEQLKKGLELLKASFKKTERLEVSYQGLDIENQRLQKTLENSNKKIQQLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKRLRQQ--AEIKDTTLEENNVK-------IGNLEKENKTLSKEIGI-YKESCVRLKELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDRYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSSPPISGEDNKWERESQETTRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENESVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHRDLEDRYNQLLKQKGQLEDLEKMLKVEQEKMLLENKNHETVAAEYKKLCGE-NDRLNHTYSQLLKETEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITL 1397          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Human
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 355.91 bits (912), Expect = 1.423e-98
Identity = 399/1429 (27.92%), Postives = 749/1429 (52.41%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEK-FVKMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC---IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ-----MVKQLRCVTEQWEDSFIEDTKAILS---QNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXD-QVIEKTNAKLLRLEIENRSLLEKLSDIKFD-DTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKS--YQDNLQ-LSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETL---EEN----------------MKELAMENQRKTS---QLMKKISELESELVKTK----------TENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAV---IXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F P++  F+TS  + + K F  + A     L  ++ L              DG FLN+V  +I+P      Q V  +   D    + N  IL++ I+ YY   LQQ  ++ LP+++ I  +P S +   E+ K + L+LG AVQC++KE FI+ I  +  +   +  +  +I+++T + + V +   +E     Q     ++K +    ++  D   E ++ I+    + D L        +      + G+        + S + +++ELA+ KAK+R+L+ EL++K + + D + +LE  + E  +L++  M L +++R  RM +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E        +I +L  + M+++      +     L  EL+++  +   S         +V E T+++LL+LE+EN+SL + + +++   D+ E N  K  I ++E+EN RL  KV  L+    +E Q     +   + L +EK QL+  I++++EN+ R+I+ L QENE+L++T+  +R+RS+ S + RV ++EKEN  LH S+ E + KLSK+EF+ +++ ++        +++   ++ L  L K+N  L+K++ NLK+   ++E L+ + S LE E  +L   +  +     Q  S+  E     EEN                M +L +EN+   S   QL K +  L++   KT+           EN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++ +LE++ KQL+KEN R + Q  A++    + +N +        +  L+K +K   +++ +   E+  RL + E++N+EL+++   + +   TLRE+L++E++ +Q + N ++ L+ ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I +L++RL  S   N++L  +L+  +  Y +L+Q+ +EE  V     +    +         T+ LL +KD LI+VER NA L +EKQ L +Q + L+ + +  + + +    Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q +++E    S + +   L      L      L+ L+ + ++EYE L  +  + KS +K++  +     D   Q  K+   L+ L+++L+ E+  +    +   ++  E   L  E ND L   Y ++  E + L  ++K LK  LNN K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALV-------------DGVFLNQVMLQINPK--LESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI--QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKR------TESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASK--ILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEKGERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKMAQLQLENKELESEKEQLKKGLELLKASFKKTERLEVSYQGLDIENQRLQKTLENSNKKIQQLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKRLRQQ--AEIKDTTLEENNVK-------IGNLEKENKTLSKEIGI-YKESCVRLKELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDSRYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSSPPISGEDNKWERESQETTRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENESVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHRDLEDRYNQLLKQKGQLEDLEKMLKVEQEKMLLENKNHETVAAEYKKLCGE-NDRLNHTYSQLLKETEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITL 1398          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Human
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 355.91 bits (912), Expect = 1.423e-98
Identity = 399/1429 (27.92%), Postives = 749/1429 (52.41%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEK-FVKMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC---IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ-----MVKQLRCVTEQWEDSFIEDTKAILS---QNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXD-QVIEKTNAKLLRLEIENRSLLEKLSDIKFD-DTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKS--YQDNLQ-LSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETL---EEN----------------MKELAMENQRKTS---QLMKKISELESELVKTK----------TENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAV---IXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F P++  F+TS  + + K F  + A     L  ++ L              DG FLN+V  +I+P      Q V  +   D    + N  IL++ I+ YY   LQQ  ++ LP+++ I  +P S +   E+ K + L+LG AVQC++KE FI+ I  +  +   +  +  +I+++T + + V +   +E     Q     ++K +    ++  D   E ++ I+    + D L        +      + G+        + S + +++ELA+ KAK+R+L+ EL++K + + D + +LE  + E  +L++  M L +++R  RM +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E        +I +L  + M+++      +     L  EL+++  +   S         +V E T+++LL+LE+EN+SL + + +++   D+ E N  K  I ++E+EN RL  KV  L+    +E Q     +   + L +EK QL+  I++++EN+ R+I+ L QENE+L++T+  +R+RS+ S + RV ++EKEN  LH S+ E + KLSK+EF+ +++ ++        +++   ++ L  L K+N  L+K++ NLK+   ++E L+ + S LE E  +L   +  +     Q  S+  E     EEN                M +L +EN+   S   QL K +  L++   KT+           EN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++ +LE++ KQL+KEN R + Q  A++    + +N +        +  L+K +K   +++ +   E+  RL + E++N+EL+++   + +   TLRE+L++E++ +Q + N ++ L+ ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I +L++RL  S   N++L  +L+  +  Y +L+Q+ +EE  V     +    +         T+ LL +KD LI+VER NA L +EKQ L +Q + L+ + +  + + +    Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q +++E    S + +   L      L      L+ L+ + ++EYE L  +  + KS +K++  +     D   Q  K+   L+ L+++L+ E+  +    +   ++  E   L  E ND L   Y ++  E + L  ++K LK  LNN K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALV-------------DGVFLNQVMLQINPK--LESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI--QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKR------TESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASK--ILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEKGERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKMAQLQLENKELESEKEQLKKGLELLKASFKKTERLEVSYQGLDIENQRLQKTLENSNKKIQQLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKRLRQQ--AEIKDTTLEENNVK-------IGNLEKENKTLSKEIGI-YKESCVRLKELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDSRYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSSPPISGEDNKWERESQETTRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENESVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHRDLEDRYNQLLKQKGQLEDLEKMLKVEQEKMLLENKNHETVAAEYKKLCGE-NDRLNHTYSQLLKETEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITL 1398          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Celegans
Match: grdn-1 (Girdin homolog [Source:UniProtKB/Swiss-Prot;Acc:F3Y5P4])

HSP 1 Score: 68.1662 bits (165), Expect = 7.745e-11
Identity = 98/384 (25.52%), Postives = 179/384 (46.61%), Query Frame = 2
Query: 3272 KLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQ---LSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSL-----NQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRS-RSCGTILGSIESIKN-SSIGDKSTDYQIDHTDTSEKEDFL 4393
            +L++ I   + Q D ++  N  L +++  ++K       +++ L    + L    S LQ+L+N L+ +Y+  KKE+   +   ++I  Q     + N   L+ K   E  +  +E LE E              R    NL ++  +++Q++ ++  EL+       N+NN+          E+  QL +KIS           ++ KL +KIEAL++ N    EEN+ L  Q++ +L QN++L+   L ++     E    +D+LS L+RHKE+LE+KIM+Q+++M + K T        P+  +    + AK ++ R  + S+    G +  E+ S      RS   + G+ E + +       S D+ +   D S K   L
Sbjct:  835 RLQVSIRNSQIQEDLVKQENTKLRDELQEMQKMSKKRSQNLDELENMHKTLLVDHSRLQQLHNLLTRDYDEAKKESMELRQKVQNIPRQQAVFMNANIRELEAKLSEEISR--REQLEKEHK----------MCRIHCENLRRDITELVQTRDELSLELRRAHDTCHNKNNQI--------DELKKQLNQKIS-----------EVNKLSSKIEALSQLNRTYNEENRNLSRQLEILLTQNKELLQRALHDKDQYHLEMKDFQDQLSALRRHKEKLEDKIMDQYRTMENKKST--------PERKQPLVKRAAKALINRRRATSN----GGSTTEDSSVYSADERSSPPLAGTNEDVDHLPPTCSSSDDHDVISPDFSAKNPLL 1175          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Celegans
Match: grdn-1 (Girdin homolog [Source:UniProtKB/Swiss-Prot;Acc:F3Y5P4])

HSP 1 Score: 67.3958 bits (163), Expect = 1.194e-10
Identity = 98/384 (25.52%), Postives = 179/384 (46.61%), Query Frame = 2
Query: 3272 KLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQ---LSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSL-----NQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRS-RSCGTILGSIESIKN-SSIGDKSTDYQIDHTDTSEKEDFL 4393
            +L++ I   + Q D ++  N  L +++  ++K       +++ L    + L    S LQ+L+N L+ +Y+  KKE+   +   ++I  Q     + N   L+ K   E  +  +E LE E              R    NL ++  +++Q++ ++  EL+       N+NN+          E+  QL +KIS           ++ KL +KIEAL++ N    EEN+ L  Q++ +L QN++L+   L ++     E    +D+LS L+RHKE+LE+KIM+Q+++M + K T        P+  +    + AK ++ R  + S+    G +  E+ S      RS   + G+ E + +       S D+ +   D S K   L
Sbjct:  669 RLQVSIRNSQIQEDLVKQENTKLRDELQEMQKMSKKRSQNLDELENMHKTLLVDHSRLQQLHNLLTRDYDEAKKESMELRQKVQNIPRQQAVFMNANIRELEAKLSEEISR--REQLEKEHK----------MCRIHCENLRRDITELVQTRDELSLELRRAHDTCHNKNNQI--------DELKKQLNQKIS-----------EVNKLSSKIEALSQLNRTYNEENRNLSRQLEILLTQNKELLQRALHDKDQYHLEMKDFQDQLSALRRHKEKLEDKIMDQYRTMENKKST--------PERKQPLVKRAAKALINRRRATSN----GGSTTEDSSVYSADERSSPPLAGTNEDVDHLPPTCSSSDDHDVISPDFSAKNPLL 1009          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Celegans
Match: grdn-1 (Girdin homolog [Source:UniProtKB/Swiss-Prot;Acc:F3Y5P4])

HSP 1 Score: 64.3142 bits (155), Expect = 8.989e-10
Identity = 80/293 (27.30%), Postives = 146/293 (49.83%), Query Frame = 2
Query: 3272 KLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQ---LSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSL-----NQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKT 4126
            +L++ I   + Q D ++  N  L +++  ++K       +++ L    + L    S LQ+L+N L+ +Y+  KKE+   +   ++I  Q     + N   L+ K   E  +  +E LE E              R    NL ++  +++Q++ ++  EL+       N+NN+          E+  QL +KIS           ++ KL +KIEAL++ N    EEN+ L  Q++ +L QN++L+   L ++     E    +D+LS L+RHKE+LE+KIM+Q+++M + K T
Sbjct:  835 RLQVSIRNSQIQEDLVKQENTKLRDELQEMQKMSKKRSQNLDELENMHKTLLVDHSRLQQLHNLLTRDYDEAKKESMELRQKVQNIPRQQAVFMNANIRELEAKLSEEISR--REQLEKEHK----------MCRIHCENLRRDITELVQTRDELSLELRRAHDTCHNKNNQI--------DELKKQLNQKIS-----------EVNKLSSKIEALSQLNRTYNEENRNLSRQLEILLTQNKELLQRALHDKDQYHLEMKDFQDQLSALRRHKEKLEDKIMDQYRTMENKKST 1096          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Fly
Match: Girdin (gene:FBgn0283724 transcript:FBtr0332097)

HSP 1 Score: 112.464 bits (280), Expect = 2.594e-24
Identity = 184/711 (25.88%), Postives = 333/711 (46.84%), Query Frame = 2
Query:  128 VDNELFSWLK-LFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLV-----KCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESI--QHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQ-------WEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-------------MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRK--NEELEQSIS-SHLAEITKLEYKLMSMQEKDNVYIS-SKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSL---LEKLSDIKFDDTSE----------------------LNKLKERISELE-------EENDRLHNKVSRLQQSNKKEI-------QQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSN---------DLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLD------SSLDKSYQDNLQLSKKNAELEKE 2002
            V++ + SWL+     ++ +  Y  L DG+ ++ V+ +IDP    N   +     K  SI    KN+E +++N++ ++   L Q  ++ LP   T+ + P S     ++   + L+LGAAVQC  KE FI     R+ E  +  QH ++G IKQ+T+SH  V+    LE  +   M   +  +T++       W D    +T+   S N                L   G    +    SN   T             +A+E A+ ++K RKL+ EL++K++ + +LR++L+ +++   KL++   +   E++R    +DE+D  RE   R   +E + QK +EK+ + ++Y+ R EELRED  V+      L ++++  +K  E A +LE E  K  +K  +  LE+ +  S L E+ +   +L  +    N  +   KS  ENE          +   +S+S+Q+      + L+LE+ENR L   LE+L +  F +++                       +N+L ++  ELE       EEN +L + V   Q+S  ++        Q+  + E+  + L +EKQ+    I+++ E+  RR  +L +  E+ ++ +    E+S +           + RVS  E+EN+ L   + E++      E    +++   N+LD        L K+ +D+ Q+ +K  ELEK+
Sbjct:   16 VNSSIISWLESCLPRAELLAGYTSLLDGHIIHSVWLQIDPEPQNNPSELNDLNGKSLSIARA-KNFECVVRNLKSFFEEELGQTILV-LPDAFTLGHHPESKNGLEQMKTLLTLLLGAAVQCPNKELFI----ARIKELDLETQHAIVGLIKQVTDSHSLVLTEDSLERLTPQSMYTHILRLTKERDVMYLKWIDLACVETEMTASDN----------------LVECGQGVSVTRSPSNGTATSTPSSSSNSESNHLAVECADLRSKNRKLRQELEEKSENLLELREELDDKKARFDKLRQESQEWFTEAKRASAYRDEVDILRERAERADRLEVEVQKYREKLGDSDFYKSRVEELREDNRVLLESKEMLEEQLQRYRKRSEHAISLESEIIKYKQKINDMALERDVDRSKLEELLEENSQLQLVARNLNSTMDLDKSFSENE-------DDCNSGDNSLSEQLTNNAQTRALKLELENRRLTAALEQLKESSFHESTSKMLELEKEKKKLSLKIEQMQENINRLTQQNVELEGVFKNALEENKKLQDAVDNRQKSYDRQSLEREADRQKLSDAEQHVETLNKEKQR----IQTLNESIQRRADDLERLAESKTKELEQYLEKSRQYELTKQKLYEIEARVSTYERENASL---LKEVSKLKEGSEQKSVQLDDSINRLDVQSKELQKLGKALEDSEQVHQKLVELEKQ 690          

HSP 2 Score: 79.337 bits (194), Expect = 3.209e-14
Identity = 94/368 (25.54%), Postives = 184/368 (50.00%), Query Frame = 2
Query: 3221 QLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNL---SNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEK----EITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPST---KKTNLSILYDEPKGGRNKFLKKAKEILRR---NDSKS---------SVEQEGKNKNENP 4258
            +L  ++  +++L   N +L + ++ L SQ+ +L T +V L   ++Q+   + +LL  +D +    + K  L+ Q + LQ L++QLS EYE L K+ +  K+  + +  +L  T       +++  +L+   E L  + +N+   +  L  LR E++ L+ +  ++  +  + + E K++ +  K ++ E ++ K    E++ +L  K   +  +  +Y K    ++ + E L + N  L  E K L+  +  +L Q Q+L+  +L+++K+   EE    +++  L+R KE+LEEKIME +K   +T   KK   S+L    K   +  + K     RR   +D+++         S   E  N NE P
Sbjct:  833 ELTRIKDSNTQLQTENARLSVDVAALGSQITSLNTQHVALQLANSQLAAEKDSLLKEIDSLQQ--EHKHALQDQVT-LQCLHDQLSAEYESLNKDKEQLKAAVRDLRQELRDT-------REQQSALEQRIEELTIQNSNMKTCSEDLSILRTEHSKLTDDFRNLFATSDRFKNEYKNIQEQYKMVRMEHSSLKLQNTELSGELNAKSDQVRCLQMEYSK----VQQRCEMLIQNNAELDSERKALMDNVSQLLSQYQELLAISLEDKKHFHEEEKNYTERVHSLKRQKEKLEEKIMEHYKKSETTVHKKKPFASMLVRRVKKASSDLMNKVPSRNRRSWVDDARTNSQFVIGSESGGNESDNSNEEP 1186          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Fly
Match: Girdin (gene:FBgn0283724 transcript:FBtr0332099)

HSP 1 Score: 112.079 bits (279), Expect = 3.497e-24
Identity = 182/713 (25.53%), Postives = 337/713 (47.27%), Query Frame = 2
Query:  128 VDNELFSWLK-LFWTXXXXXXXXXXXXGYFLNEVFKEIDP---------NSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESI--QHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQ-------WEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-------------MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRK--NEELEQSIS-SHLAEITKLEYKLMSMQEKDNVYIS-SKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSL---LEKLSDIKFDDTSE----------------------LNKLKERISELE-------EENDRLHNKVSRLQQSNKKEI-------QQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSN---------DLRVSELEKENSKLHLSMNELN----HKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKE 2002
            V++ + SWL+     ++ +  Y  L DG+ ++ V+ +IDP         N +  + L   R+     KN+E +++N++ ++   L Q  ++ LP   T+ + P S     ++   + L+LGAAVQC  KE FI     R+ E  +  QH ++G IKQ+T+SH  V+    LE  +   M   +  +T++       W D    +T+   S N                L   G    +    SN   T             +A+E A+ ++K RKL+ EL++K++ + +LR++L+ +++   KL++   +   E++R    +DE+D  RE   R   +E + QK +EK+ + ++Y+ R EELRED  V+      L ++++  +K  E A +LE E  K  +K  +  LE+ +  S L E+ +   +L  +    N  +   KS  ENE          +   +S+S+Q+      + L+LE+ENR L   LE+L +  F +++                       +N+L ++  ELE       EEN +L + V   Q+S  ++        Q+  + E+  + L +EKQ+    I+++ E+  RR  +L +  E+ ++ +    E+S +           + RVS  E+EN+ L   +++L      K  +++  + R++ +  +L   L K+ +D+ Q+ +K  ELEK+
Sbjct:   16 VNSSIISWLESCLPRAELLAGYTSLLDGHIIHSVWLQIDPEPQNNPSELNDLNGKSLSIARA-----KNFECVVRNLKSFFEEELGQTILV-LPDAFTLGHHPESKNGLEQMKTLLTLLLGAAVQCPNKELFI----ARIKELDLETQHAIVGLIKQVTDSHSLVLTEDSLERLTPQSMYTHILRLTKERDVMYLKWIDLACVETEMTASDN----------------LVECGQGVSVTRSPSNGTATSTPSSSSNSESNHLAVECADLRSKNRKLRQELEEKSENLLELREELDDKKARFDKLRQESQEWFTEAKRASAYRDEVDILRERAERADRLEVEVQKYREKLGDSDFYKSRVEELREDNRVLLESKEMLEEQLQRYRKRSEHAISLESEIIKYKQKINDMALERDVDRSKLEELLEENSQLQLVARNLNSTMDLDKSFSENE-------DDCNSGDNSLSEQLTNNAQTRALKLELENRRLTAALEQLKESSFHESTSKMLELEKEKKKLSLKIEQMQENINRLTQQNVELEGVFKNALEENKKLQDAVDNRQKSYDRQSLEREADRQKLSDAEQHVETLNKEKQR----IQTLNESIQRRADDLERLAESKTKELEQYLEKSRQYELTKQKLYEIEARVSTYERENASLLKEVSKLKEGSEQKSVQLDDSINRLDVQSKEL-QKLGKALEDSEQVHQKLVELEKQ 690          

HSP 2 Score: 83.1889 bits (204), Expect = 2.574e-15
Identity = 105/419 (25.06%), Postives = 200/419 (47.73%), Query Frame = 2
Query: 3221 QLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNL---SNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEK----EITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPST---KKTNLSILYDEPKGGRNKFLKKAKEILRR---NDSKS---------SVEQEGKNKNENP-----------------SRMQRSRSCGTILGSIESIKNSSIGDKSTDYQID 4360
            +L  ++  +++L   N +L + ++ L SQ+ +L T +V L   ++Q+   + +LL  +D +    + K  L+ Q + LQ L++QLS EYE L K+ +  K+  + +  +L  T       +++  +L+   E L  + +N+   +  L  LR E++ L+ +  ++  +  + + E K++ +  K ++ E ++ K    E++ +L  K   +  +  +Y K    ++ + E L + N  L  E K L+  +  +L Q Q+L+  +L+++K+   EE    +++  L+R KE+LEEKIME +K   +T   KK   S+L    K   +  + K     RR   +D+++         S   E  N NE P                   +QRS     + GS  S+   + G + T Y ID
Sbjct:  833 ELTRIKDSNTQLQTENARLSVDVAALGSQITSLNTQHVALQLANSQLAAEKDSLLKEIDSLQQ--EHKHALQDQVT-LQCLHDQLSAEYESLNKDKEQLKAAVRDLRQELRDT-------REQQSALEQRIEELTIQNSNMKTCSEDLSILRTEHSKLTDDFRNLFATSDRFKNEYKNIQEQYKMVRMEHSSLKLQNTELSGELNAKSDQVRCLQMEYSK----VQQRCEMLIQNNAELDSERKALMDNVSQLLSQYQELLAISLEDKKHFHEEEKNYTERVHSLKRQKEKLEEKIMEHYKKSETTVHKKKPFASMLVRRVKKASSDLMNKVPSRNRRSWVDDARTNSQFVIGSESGGNESDNSNEEPLSIASDTHLLQRNVPLRQSLQRSLEAPDVTGS--SLTLGTAGSRRTVYLID 1235          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Fly
Match: Girdin (gene:FBgn0283724 transcript:FBtr0073035)

HSP 1 Score: 110.153 bits (274), Expect = 1.360e-23
Identity = 184/711 (25.88%), Postives = 333/711 (46.84%), Query Frame = 2
Query:  128 VDNELFSWLK-LFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLV-----KCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESI--QHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQ-------WEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-------------MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRK--NEELEQSIS-SHLAEITKLEYKLMSMQEKDNVYIS-SKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSL---LEKLSDIKFDDTSE----------------------LNKLKERISELE-------EENDRLHNKVSRLQQSNKKEI-------QQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSN---------DLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLD------SSLDKSYQDNLQLSKKNAELEKE 2002
            V++ + SWL+     ++ +  Y  L DG+ ++ V+ +IDP    N   +     K  SI    KN+E +++N++ ++   L Q  ++ LP   T+ + P S     ++   + L+LGAAVQC  KE FI     R+ E  +  QH ++G IKQ+T+SH  V+    LE  +   M   +  +T++       W D    +T+   S N                L   G    +    SN   T             +A+E A+ ++K RKL+ EL++K++ + +LR++L+ +++   KL++   +   E++R    +DE+D  RE   R   +E + QK +EK+ + ++Y+ R EELRED  V+      L ++++  +K  E A +LE E  K  +K  +  LE+ +  S L E+ +   +L  +    N  +   KS  ENE          +   +S+S+Q+      + L+LE+ENR L   LE+L +  F +++                       +N+L ++  ELE       EEN +L + V   Q+S  ++        Q+  + E+  + L +EKQ+    I+++ E+  RR  +L +  E+ ++ +    E+S +           + RVS  E+EN+ L   + E++      E    +++   N+LD        L K+ +D+ Q+ +K  ELEK+
Sbjct:   16 VNSSIISWLESCLPRAELLAGYTSLLDGHIIHSVWLQIDPEPQNNPSELNDLNGKSLSIARA-KNFECVVRNLKSFFEEELGQTILV-LPDAFTLGHHPESKNGLEQMKTLLTLLLGAAVQCPNKELFI----ARIKELDLETQHAIVGLIKQVTDSHSLVLTEDSLERLTPQSMYTHILRLTKERDVMYLKWIDLACVETEMTASDN----------------LVECGQGVSVTRSPSNGTATSTPSSSSNSESNHLAVECADLRSKNRKLRQELEEKSENLLELREELDDKKARFDKLRQESQEWFTEAKRASAYRDEVDILRERAERADRLEVEVQKYREKLGDSDFYKSRVEELREDNRVLLESKEMLEEQLQRYRKRSEHAISLESEIIKYKQKINDMALERDVDRSKLEELLEENSQLQLVARNLNSTMDLDKSFSENE-------DDCNSGDNSLSEQLTNNAQTRALKLELENRRLTAALEQLKESSFHESTSKMLELEKEKKKLSLKIEQMQENINRLTQQNVELEGVFKNALEENKKLQDAVDNRQKSYDRQSLEREADRQKLSDAEQHVETLNKEKQR----IQTLNESIQRRADDLERLAESKTKELEQYLEKSRQYELTKQKLYEIEARVSTYERENASL---LKEVSKLKEGSEQKSVQLDDSINRLDVQSKELQKLGKALEDSEQVHQKLVELEKQ 690          

HSP 2 Score: 77.7962 bits (190), Expect = 9.860e-14
Identity = 94/368 (25.54%), Postives = 184/368 (50.00%), Query Frame = 2
Query: 3221 QLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNL---SNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEK----EITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPST---KKTNLSILYDEPKGGRNKFLKKAKEILRR---NDSKS---------SVEQEGKNKNENP 4258
            +L  ++  +++L   N +L + ++ L SQ+ +L T +V L   ++Q+   + +LL  +D +    + K  L+ Q + LQ L++QLS EYE L K+ +  K+  + +  +L  T       +++  +L+   E L  + +N+   +  L  LR E++ L+ +  ++  +  + + E K++ +  K ++ E ++ K    E++ +L  K   +  +  +Y K    ++ + E L + N  L  E K L+  +  +L Q Q+L+  +L+++K+   EE    +++  L+R KE+LEEKIME +K   +T   KK   S+L    K   +  + K     RR   +D+++         S   E  N NE P
Sbjct:  833 ELTRIKDSNTQLQTENARLSVDVAALGSQITSLNTQHVALQLANSQLAAEKDSLLKEIDSLQQ--EHKHALQDQVT-LQCLHDQLSAEYESLNKDKEQLKAAVRDLRQELRDT-------REQQSALEQRIEELTIQNSNMKTCSEDLSILRTEHSKLTDDFRNLFATSDRFKNEYKNIQEQYKMVRMEHSSLKLQNTELSGELNAKSDQVRCLQMEYSK----VQQRCEMLIQNNAELDSERKALMDNVSQLLSQYQELLAISLEDKKHFHEEEKNYTERVHSLKRQKEKLEEKIMEHYKKSETTVHKKKPFASMLVRRVKKASSDLMNKVPSRNRRSWVDDARTNSQFVIGSESGGNESDNSNEEP 1186          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Fly
Match: Girdin (gene:FBgn0283724 transcript:FBtr0073036)

HSP 1 Score: 109.768 bits (273), Expect = 1.993e-23
Identity = 184/711 (25.88%), Postives = 333/711 (46.84%), Query Frame = 2
Query:  128 VDNELFSWLK-LFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLV-----KCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESI--QHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQ-------WEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-------------MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRK--NEELEQSIS-SHLAEITKLEYKLMSMQEKDNVYIS-SKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSL---LEKLSDIKFDDTSE----------------------LNKLKERISELE-------EENDRLHNKVSRLQQSNKKEI-------QQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSN---------DLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLD------SSLDKSYQDNLQLSKKNAELEKE 2002
            V++ + SWL+     ++ +  Y  L DG+ ++ V+ +IDP    N   +     K  SI    KN+E +++N++ ++   L Q  ++ LP   T+ + P S     ++   + L+LGAAVQC  KE FI     R+ E  +  QH ++G IKQ+T+SH  V+    LE  +   M   +  +T++       W D    +T+   S N                L   G    +    SN   T             +A+E A+ ++K RKL+ EL++K++ + +LR++L+ +++   KL++   +   E++R    +DE+D  RE   R   +E + QK +EK+ + ++Y+ R EELRED  V+      L ++++  +K  E A +LE E  K  +K  +  LE+ +  S L E+ +   +L  +    N  +   KS  ENE          +   +S+S+Q+      + L+LE+ENR L   LE+L +  F +++                       +N+L ++  ELE       EEN +L + V   Q+S  ++        Q+  + E+  + L +EKQ+    I+++ E+  RR  +L +  E+ ++ +    E+S +           + RVS  E+EN+ L   + E++      E    +++   N+LD        L K+ +D+ Q+ +K  ELEK+
Sbjct:   16 VNSSIISWLESCLPRAELLAGYTSLLDGHIIHSVWLQIDPEPQNNPSELNDLNGKSLSIARA-KNFECVVRNLKSFFEEELGQTILV-LPDAFTLGHHPESKNGLEQMKTLLTLLLGAAVQCPNKELFI----ARIKELDLETQHAIVGLIKQVTDSHSLVLTEDSLERLTPQSMYTHILRLTKERDVMYLKWIDLACVETEMTASDN----------------LVECGQGVSVTRSPSNGTATSTPSSSSNSESNHLAVECADLRSKNRKLRQELEEKSENLLELREELDDKKARFDKLRQESQEWFTEAKRASAYRDEVDILRERAERADRLEVEVQKYREKLGDSDFYKSRVEELREDNRVLLESKEMLEEQLQRYRKRSEHAISLESEIIKYKQKINDMALERDVDRSKLEELLEENSQLQLVARNLNSTMDLDKSFSENE-------DDCNSGDNSLSEQLTNNAQTRALKLELENRRLTAALEQLKESSFHESTSKMLELEKEKKKLSLKIEQMQENINRLTQQNVELEGVFKNALEENKKLQDAVDNRQKSYDRQSLEREADRQKLSDAEQHVETLNKEKQR----IQTLNESIQRRADDLERLAESKTKELEQYLEKSRQYELTKQKLYEIEARVSTYERENASL---LKEVSKLKEGSEQKSVQLDDSINRLDVQSKELQKLGKALEDSEQVHQKLVELEKQ 690          

HSP 2 Score: 78.1814 bits (191), Expect = 8.506e-14
Identity = 94/368 (25.54%), Postives = 184/368 (50.00%), Query Frame = 2
Query: 3221 QLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNL---SNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEK----EITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPST---KKTNLSILYDEPKGGRNKFLKKAKEILRR---NDSKS---------SVEQEGKNKNENP 4258
            +L  ++  +++L   N +L + ++ L SQ+ +L T +V L   ++Q+   + +LL  +D +    + K  L+ Q + LQ L++QLS EYE L K+ +  K+  + +  +L  T       +++  +L+   E L  + +N+   +  L  LR E++ L+ +  ++  +  + + E K++ +  K ++ E ++ K    E++ +L  K   +  +  +Y K    ++ + E L + N  L  E K L+  +  +L Q Q+L+  +L+++K+   EE    +++  L+R KE+LEEKIME +K   +T   KK   S+L    K   +  + K     RR   +D+++         S   E  N NE P
Sbjct:  833 ELTRIKDSNTQLQTENARLSVDVAALGSQITSLNTQHVALQLANSQLAAEKDSLLKEIDSLQQ--EHKHALQDQVT-LQCLHDQLSAEYESLNKDKEQLKAAVRDLRQELRDT-------REQQSALEQRIEELTIQNSNMKTCSEDLSILRTEHSKLTDDFRNLFATSDRFKNEYKNIQEQYKMVRMEHSSLKLQNTELSGELNAKSDQVRCLQMEYSK----VQQRCEMLIQNNAELDSERKALMDNVSQLLSQYQELLAISLEDKKHFHEEEKNYTERVHSLKRQKEKLEEKIMEHYKKSETTVHKKKPFASMLVRRVKKASSDLMNKVPSRNRRSWVDDARTNSQFVIGSESGGNESDNSNEEP 1186          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Fly
Match: Girdin (gene:FBgn0283724 transcript:FBtr0332098)

HSP 1 Score: 109.383 bits (272), Expect = 2.063e-23
Identity = 184/711 (25.88%), Postives = 333/711 (46.84%), Query Frame = 2
Query:  128 VDNELFSWLK-LFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLV-----KCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESI--QHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQ-------WEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-------------MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRK--NEELEQSIS-SHLAEITKLEYKLMSMQEKDNVYIS-SKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSL---LEKLSDIKFDDTSE----------------------LNKLKERISELE-------EENDRLHNKVSRLQQSNKKEI-------QQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSN---------DLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLD------SSLDKSYQDNLQLSKKNAELEKE 2002
            V++ + SWL+     ++ +  Y  L DG+ ++ V+ +IDP    N   +     K  SI    KN+E +++N++ ++   L Q  ++ LP   T+ + P S     ++   + L+LGAAVQC  KE FI     R+ E  +  QH ++G IKQ+T+SH  V+    LE  +   M   +  +T++       W D    +T+   S N                L   G    +    SN   T             +A+E A+ ++K RKL+ EL++K++ + +LR++L+ +++   KL++   +   E++R    +DE+D  RE   R   +E + QK +EK+ + ++Y+ R EELRED  V+      L ++++  +K  E A +LE E  K  +K  +  LE+ +  S L E+ +   +L  +    N  +   KS  ENE          +   +S+S+Q+      + L+LE+ENR L   LE+L +  F +++                       +N+L ++  ELE       EEN +L + V   Q+S  ++        Q+  + E+  + L +EKQ+    I+++ E+  RR  +L +  E+ ++ +    E+S +           + RVS  E+EN+ L   + E++      E    +++   N+LD        L K+ +D+ Q+ +K  ELEK+
Sbjct:   16 VNSSIISWLESCLPRAELLAGYTSLLDGHIIHSVWLQIDPEPQNNPSELNDLNGKSLSIARA-KNFECVVRNLKSFFEEELGQTILV-LPDAFTLGHHPESKNGLEQMKTLLTLLLGAAVQCPNKELFI----ARIKELDLETQHAIVGLIKQVTDSHSLVLTEDSLERLTPQSMYTHILRLTKERDVMYLKWIDLACVETEMTASDN----------------LVECGQGVSVTRSPSNGTATSTPSSSSNSESNHLAVECADLRSKNRKLRQELEEKSENLLELREELDDKKARFDKLRQESQEWFTEAKRASAYRDEVDILRERAERADRLEVEVQKYREKLGDSDFYKSRVEELREDNRVLLESKEMLEEQLQRYRKRSEHAISLESEIIKYKQKINDMALERDVDRSKLEELLEENSQLQLVARNLNSTMDLDKSFSENE-------DDCNSGDNSLSEQLTNNAQTRALKLELENRRLTAALEQLKESSFHESTSKMLELEKEKKKLSLKIEQMQENINRLTQQNVELEGVFKNALEENKKLQDAVDNRQKSYDRQSLEREADRQKLSDAEQHVETLNKEKQR----IQTLNESIQRRADDLERLAESKTKELEQYLEKSRQYELTKQKLYEIEARVSTYERENASL---LKEVSKLKEGSEQKSVQLDDSINRLDVQSKELQKLGKALEDSEQVHQKLVELEKQ 690          

HSP 2 Score: 78.1814 bits (191), Expect = 7.371e-14
Identity = 94/368 (25.54%), Postives = 184/368 (50.00%), Query Frame = 2
Query: 3221 QLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNL---SNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEK----EITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPST---KKTNLSILYDEPKGGRNKFLKKAKEILRR---NDSKS---------SVEQEGKNKNENP 4258
            +L  ++  +++L   N +L + ++ L SQ+ +L T +V L   ++Q+   + +LL  +D +    + K  L+ Q + LQ L++QLS EYE L K+ +  K+  + +  +L  T       +++  +L+   E L  + +N+   +  L  LR E++ L+ +  ++  +  + + E K++ +  K ++ E ++ K    E++ +L  K   +  +  +Y K    ++ + E L + N  L  E K L+  +  +L Q Q+L+  +L+++K+   EE    +++  L+R KE+LEEKIME +K   +T   KK   S+L    K   +  + K     RR   +D+++         S   E  N NE P
Sbjct:  833 ELTRIKDSNTQLQTENARLSVDVAALGSQITSLNTQHVALQLANSQLAAEKDSLLKEIDSLQQ--EHKHALQDQVT-LQCLHDQLSAEYESLNKDKEQLKAAVRDLRQELRDT-------REQQSALEQRIEELTIQNSNMKTCSEDLSILRTEHSKLTDDFRNLFATSDRFKNEYKNIQEQYKMVRMEHSSLKLQNTELSGELNAKSDQVRCLQMEYSK----VQQRCEMLIQNNAELDSERKALMDNVSQLLSQYQELLAISLEDKKHFHEEEKNYTERVHSLKRQKEKLEEKIMEHYKKSETTVHKKKPFASMLVRRVKKASSDLMNKVPSRNRRSWVDDARTNSQFVIGSESGGNESDNSNEEP 1186          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Zebrafish
Match: ccdc88c (coiled-coil domain containing 88C [Source:ZFIN;Acc:ZDB-GENE-100419-3])

HSP 1 Score: 321.627 bits (823), Expect = 4.364e-88
Identity = 394/1485 (26.53%), Postives = 737/1485 (49.63%), Query Frame = 2
Query:  116 MTATVDNELFSWLKLFWTXXXXXXXXXXX-----XGYFLNEVFKEIDP---NSVTNEQL---VKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE--EFSTGQ-------MVKQLRCVTEQWEDS---FIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFD----DTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFD----------MQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETLEENMKELAMEN--QRKTSQLMK----KISELESELVKTKTENEKCFR-------QINKSENKIKS----------LEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQ---TQSLKLEQNIKQLDKE--------------NHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPS----------FTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQK---------------------LNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSM-PSTKKTNLSILYDEPKGGR--NKFLKKAKEILR-RNDS 4213
            M+  +D+ L  W+K F          L       DG FL+++   IDP   N   N+Q+   V  R     I+N   ++++I+ YY   LQQ  V+ LP+++ I  DP S K+  E+ + + LILG AVQC+RKE  I+ I  +L +   Q  ++ +I+++T + + V++   +E  E    Q       M   LR + ++ ++S    IE T+    + D LQ+Q           +   + + I   S    + +A+ELA+ KAKLR+ + EL++K + + D ++++E   S+  KLK+   +L  E+R +R  +DE+DS RE   ++  +E +  + KEK+N++ +Y+ R EELRED   +    S L +++   +   ++   LE E  +   K  ++E    S    + +L  + M ++      ++  + L  EL++L ++   +    S   ++ E  +++LL+LE EN+ L   + +++      +  +L+ L     ELE+EN  L  K+ RLQ    +E Q   ++E   + L +EKQ+++  ++++Q    R+I EL QE E+L++ +  +R+R++ +++ RV E+E EN  LH +++E   KL+++E +          ++   ++C +L+  + +       L +   +L++E   LK+   R E L+ + + LE +  +L  L         Q+ ++    LE++ ++L  EN  QR+  + ++    ++++L+ E  + + E+E+  R       Q  +SE   KS          L+Q LE+S T++ G   +ES+L+  E  + +++ E E L+   T +  LE+  + +++E                RF+ Q + + +++     ++  ME +   L       KE   ++  A     RL + ER+N++L +Q   +K+  +TLREEL+NE++  Q   N+++ LS ELE+IG+        E    + K+KILE+K+ S ++ T+  +EE+I SL+SRL  S   N++L  +L   +    +L+Q++EEE A   +      ++ ++P            T  LL LKD LI VE+ NA L +EK  L  Q               + Q+DS   ++++LN   + L+ Q ++L+    +L      L  + + +     S +    +L    Q LE++  SLQK                     ++ + ++EYE L  +  + K+  +++  +  +  ++ +   K+ ++++ L+E L+ ++ +L +  R+   +  EN +L +E + +     ++  E  SL    K LK  LN  +   N+ + +   L+      +  + KL+   E L R    L EEN  LL Q++ +  QNQ L+  T+++++    E+    DKL+ L+R KE+LEEKIM+Q+K   P+ KK+   +      G +   KF+K  KE  R R D+
Sbjct:    9 MSNFMDSPLVVWVKTFGPLGFSSEDKLSMFMDLVDGVFLHKIMTHIDPSPMNQRVNKQVNNDVNLR-----IQNLNTVIRHIKNYYQEHLQQLIVMNLPNVLAIAKDPLSGKSMEEMKRMLLLILGCAVQCDRKEEIIEKI--KLLDIETQAAIVTHIQEVTHNQENVLDLQWMEVAEIPAEQLDPLSRTMAFHLRKLIDERDESAELVIELTQ----ERDYLQSQQPSGLLGFPSPERTSL-SPITLLSKEDRQHLAVELADTKAKLRRSRQELEEKTEQLIDAKNEIERLDSDIQKLKQENTQLLAEARSVRAYRDEVDSLRERAGKVDRLETELSRFKEKLNDVHFYKTRIEELREDNLTLLETKSMLEEQLTGARGRCDKLHELEKENLQLRSKLHDIEIDRDSDKKRLEELLEENMLLEISQKQSMNESAHLGWELEQLAKNNEVNEARKSFVFELNESASSRLLKLEKENQCLQSTIQELREASINMEEGQLHSL-----ELEKENQSLSKKLERLQSQLDQEKQTTQDMENLGEELIKEKQRMEKTLETIQAEKDRQISELEQEKEHLTQAVSSLRKRAQANSEARVREVETENRILHQTISETGGKLARLEAEKRQVTKELESLRERGERCEELEREVPR-------LERVREQLQREAAALKIGSERAEALERENATLEQDNRRLKKLADTA-----QNATLRLAVLEKDHQQLEEENLEQRRALETLRPAAARLAQLQQEHAELEREHEEMCRTMEELRSQAKRSERLEKSCGSLSLENQRLQQTLENSSTKMQG---LESELRQNEAEMKDLQRELEGLRQKVTWAETLEKENRGMEQELSQLEKEKKQLEKEARRFRQQLEVKEAALEENCLRLASMEKEGTAL------SKELGRVKEAAG----RLKELERENKDLQKQATMDKKTLATLREELVNEKLRVQQQCNELEKLSHELEKIGLNREKLLQEEHSCEDNKYKILETKIESALKKTLELREEKIQSLESRLEESSSLNQQLRTELTTVKKNLEALKQRHEEEAAHSEISQQTLGQTRSLPDKEKWEMEQREATAELLKLKDRLIDVEKNNAALQTEKYLLKDQ---------------LKQIDS---QNAQLNAQTLALQKQAASLQEHNTSLHKETAKLQVENSTLSSQSSSLMAQYGALQAQLQTLESEAESLQKQREEASAARDRVTQDHERLLGVHERQASEYEQLIAQHAALKASQRALEQENRTLENKYMVLLKQKDAMEALEESLQRDRESLGEEIRKNTLILGENRSLREEVDRVSHMHTQLRQEYDSLQLQTKELKTSLNESQLELNRWQARYDQLKEQHQGLDISMTKLDNHCELLTRLKGNLEEENHHLLSQIQMLSQQNQTLLERTMESKELYHEEQKQYIDKLNSLRRQKEKLEEKIMDQYKFYDPTPKKSRQWV------GAKAIAKFIKPKKESSRERPDA 1427          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Zebrafish
Match: ccdc88c (coiled-coil domain containing 88C [Source:ZFIN;Acc:ZDB-GENE-100419-3])

HSP 1 Score: 312.768 bits (800), Expect = 2.854e-85
Identity = 392/1494 (26.24%), Postives = 742/1494 (49.67%), Query Frame = 2
Query:  116 MTATVDNELFSWLKLFWTXXXXXXXXXXX-----XGYFLNEVFKEIDP---NSVTNEQL---VKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE--EFSTGQ-------MVKQLRCVTEQWEDS---FIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFD----DTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFD----------MQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETLEENMKELAMEN--QRKTSQLMK----KISELESELVKTKTENEKCFR-------QINKSENKIKS----------LEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQ---TQSLKLEQNIKQLDKE--------------NHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPS----------FTQHLLDLKDDLIKVER----KNAQLDSEKQHLN---SQCEDLKDKMSAAENKYI--HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQK---------------------LNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSM-PSTKKTNLSILYDEPKGGR--NKFLKKAKEILR-RNDS 4213
            M+  +D+ L  W+K F          L       DG FL+++   IDP   N   N+Q+   V  R     I+N   ++++I+ YY   LQQ  V+ LP+++ I  DP S K+  E+ + + LILG AVQC+RKE  I+ I  +L +   Q  ++ +I+++T + + V++   +E  E    Q       M   LR + ++ ++S    IE T+    + D LQ+Q           +   + + I   S    + +A+ELA+ KAKLR+ + EL++K + + D ++++E   S+  KLK+   +L  E+R +R  +DE+DS RE   ++  +E +  + KEK+N++ +Y+ R EELRED   +    S L +++   +   ++   LE E  +   K  ++E    S    + +L  + M ++      ++  + L  EL++L ++   +    S   ++ E  +++LL+LE EN+ L   + +++      +  +L+ L     ELE+EN  L  K+ RLQ    +E Q   ++E   + L +EKQ+++  ++++Q    R+I EL QE E+L++ +  +R+R++ +++ RV E+E EN  LH +++E   KL+++E +          ++   ++C +L+  + +       L +   +L++E   LK+   R E L+ + + LE +  +L  L         Q+ ++    LE++ ++L  EN  QR+  + ++    ++++L+ E  + + E+E+  R       Q  +SE   KS          L+Q LE+S T++ G   +ES+L+  E  + +++ E E L+   T +  LE+  + +++E                RF+ Q + + +++     ++  ME +   L       KE   ++  A     RL + ER+N++L +Q   +K+  +TLREEL+NE++  Q   N+++ LS ELE+IG+        E    + K+KILE+K+ S ++ T+  +EE+I SL+SRL  S   N++L  +L   +    +L+Q++EEE A   +      ++ ++P            T  LL LKD LI VE+    ++  +D  +   +     C+ L++     E KY+   QL  +  ++++LN   + L+ Q ++L+    +L      L  + + +     S +    +L    Q LE++  SLQK                     ++ + ++EYE L  +  + K+  +++  +  +  ++ +   K+ ++++ L+E L+ ++ +L +  R+   +  EN +L +E + +     ++  E  SL    K LK  LN  +   N+ + +   L+      +  + KL+   E L R    L EEN  LL Q++ +  QNQ L+  T+++++    E+    DKL+ L+R KE+LEEKIM+Q+K   P+ KK+   +      G +   KF+K  KE  R R D+
Sbjct:    9 MSNFMDSPLVVWVKTFGPLGFSSEDKLSMFMDLVDGVFLHKIMTHIDPSPMNQRVNKQVNNDVNLR-----IQNLNTVIRHIKNYYQEHLQQLIVMNLPNVLAIAKDPLSGKSMEEMKRMLLLILGCAVQCDRKEEIIEKI--KLLDIETQAAIVTHIQEVTHNQENVLDLQWMEVAEIPAEQLDPLSRTMAFHLRKLIDERDESAELVIELTQ----ERDYLQSQQPSGLLGFPSPERTSL-SPITLLSKEDRQHLAVELADTKAKLRRSRQELEEKTEQLIDAKNEIERLDSDIQKLKQENTQLLAEARSVRAYRDEVDSLRERAGKVDRLETELSRFKEKLNDVHFYKTRIEELREDNLTLLETKSMLEEQLTGARGRCDKLHELEKENLQLRSKLHDIEIDRDSDKKRLEELLEENMLLEISQKQSMNESAHLGWELEQLAKNNEVNEARKSFVFELNESASSRLLKLEKENQCLQSTIQELREASINMEEGQLHSL-----ELEKENQSLSKKLERLQSQLDQEKQTTQDMENLGEELIKEKQRMEKTLETIQAEKDRQISELEQEKEHLTQAVSSLRKRAQANSEARVREVETENRILHQTISETGGKLARLEAEKRQVTKELESLRERGERCEELEREVPR-------LERVREQLQREAAALKIGSERAEALERENATLEQDNRRLKKLADTA-----QNATLRLAVLEKDHQQLEEENLEQRRALETLRPAAARLAQLQQEHAELEREHEEMCRTMEELRSQAKRSERLEKSCGSLSLENQRLQQTLENSSTKMQG---LESELRQNEAEMKDLQRELEGLRQKVTWAETLEKENRGMEQELSQLEKEKKQLEKEARRFRQQLEVKEAALEENCLRLASMEKEGTAL------SKELGRVKEAAG----RLKELERENKDLQKQATMDKKTLATLREELVNEKLRVQQQCNELEKLSHELEKIGLNREKLLQEEHSCEDNKYKILETKIESALKKTLELREEKIQSLESRLEESSSLNQQLRTELTTVKKNLEALKQRHEEEAAHSEISQQTLGQTRSLPDKEKWEMEQREATAELLKLKDRLIDVEKNVRQRHVSIDIHRVIFSIVICFCDSLQNAALQTE-KYLLKDQLKQIDSQNAQLNAQTLALQKQAASLQEHNTSLHKETAKLQVENSTLSSQSSSLMAQYGALQAQLQTLESEAESLQKQREEASAARDRVTQDHERLLGVHERQASEYEQLIAQHAALKASQRALEQENRTLENKYMVLLKQKDAMEALEESLQRDRESLGEEIRKNTLILGENRSLREEVDRVSHMHTQLRQEYDSLQLQTKELKTSLNESQLELNRWQARYDQLKEQHQGLDISMTKLDNHCELLTRLKGNLEEENHHLLSQIQMLSQQNQTLLERTMESKELYHEEQKQYIDKLNSLRRQKEKLEEKIMDQYKFYDPTPKKSRQWV------GAKAIAKFIKPKKESSRERPDA 1453          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Zebrafish
Match: ccdc88aa (coiled-coil domain containing 88Aa [Source:ZFIN;Acc:ZDB-GENE-100701-2])

HSP 1 Score: 127.102 bits (318), Expect = 1.155e-28
Identity = 190/672 (28.27%), Postives = 338/672 (50.30%), Query Frame = 2
Query: 2408 NEREELQTQSLK-----LEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI------IEFEA-NEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDE---LLQYKKEAESL-KHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYD--EPKGGRNKFLKKAKEILR-----RNDSKSSVEQEGKNKNENPSRMQRSRSCGTILGSI---ESIKNSSIGD 4336
            N + ++Q QS+      LEQ+   L+KEN R + Q   Q +S++    KI  +E +   L       K+  ++    +E   +  + E+ N+ELIQQ   +KR   TLREELL++R+  Q  +  ++    ELER+ +       + EA ++ + K LES++ S++  ++  K+E++ +L++RL  S + N++L   L+  +  Y ++ QK EEE         R     +  + T  LL +KD +I+VER NA L +EKQ L +Q + L+ +    + + I    Q  SLQ+ ++ L   N +L+++ ST+ SQ  +L   N  L  +  + E     +V +   L    + L      L  L+ + + E E+L     + +S ++++  +  S  D    LLQ + + E L K L+E  +  +N +        ++  E   L  EK+ + Q+  K+  E + L   +K +K +LN+ +    QL+ ++S L+ +  + E  I+KL  + E L++    + EEN+ LL Q++S++LQN+ L+ +T++++     E+    DKL++L+R KE+LEEKIM+Q+K             YD   P+   N    K +++++     +   +SS  Q G    E    + R    G+ +GS    ES  NS  GD
Sbjct:  572 NAQADIQNQSITHENGYLEQDKSSLEKENRRLRQQVKIQEASLDSSSLKIAVVEKENRTL------VKKISNI----SEACAKYKELEKDNQELIQQAGVDKRMLITLREELLDQRLKLQQKECDVEKYIYELERMRLNQETRMGDHEAVDQGQCKQLESELESSLMKSLKIKKERMATLEARLQESAKINQQLRQDLKTVKQNYEAMLQKDEEEKPGQCSPPERMWHRESQEA-TWALLKVKDRVIEVERNNATLQAEKQALQTQLQTLQTQSDGLQAQIIVLQQQTASLQENNTALQTHNAQLQVEKSTVLSQNSSLVAHNTQLQRERHSSEAEREGAVREREDLRTVNELLLRDHERLSVLHERQAAELEVLSHRYSTMESSHRTLEIEHRSLEDRYNTLLQQRAQLEGLEKALREEQKKMQNEICTNR----NVTAECQRLRDEKDWLNQTYQKLLVENEGLQLEHKSMKSQLNSIQLEQTQLESELSKLKDLNQQLEISIIKLTNQCELLSQLKGNVEEENRHLLDQIQSLMLQNRTLLDQTMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYK------------FYDPSPPRRRGNWITLKMRKLMKTKSRDQEHVRSSSPQLGSESCEGLDDL-RCHDNGSFMGSQGSEESASNSLNGD 1215          

HSP 2 Score: 120.553 bits (301), Expect = 1.148e-26
Identity = 120/446 (26.91%), Postives = 239/446 (53.59%), Query Frame = 2
Query:  206 GYFLNEVFKEIDPNSVTNEQLVKCRS-IVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWED---SFIEDTKAILSQNDALXXXXXXXXXXXXVLKNV--GVDNGIVSYSSN----SDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYK--LMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIK 1507
            G FLN+V  +I+P   T + L K  + I    +N  +L+ +I+ YY   L Q  +I  P+++ +  +P   +   EI K + L+LG AVQCERKE +I+ I     +   +  +   I+++T   + V + +H  E              E+WE+   S   + K ++ Q D     I +     +++K+   G D+ +    S+    S + +ALEL   KAK+++L+ EL++K++   D R DL+  ++E  +L++  M+L  ++R  RM +DELD+ +E  +R   +E++  + ++K++ + +Y+ + EEL+ED  V+    + L +++++ K   ++   LE        K  ++E+  +++  +I +L  +  ++ + +K ++  S +   E EL +    ++ + +  S+S +V EKT ++LL+LE EN+ LL+ L +++
Sbjct:   44 GIFLNKVMNQINPEG-TVQGLNKVNNDIGQRAQNLSVLMYHIKSYYQETLHQMIMIPPPNVLLLGKNPVCEEGLEEIRKLLLLLLGCAVQCERKEEYIEKIQNL--DFDTKAEIAAQIQEVTHCQENVFD-LHWLEMEG--------LCPEEWENLCRSLSVNLKMLVDQRDRQFEAIVELMQGKEMMKSAVFGSDSSLSEPESSRLPLSQQHLALELTHAKAKIKRLRQELEEKSEQFLDSRQDLDSVEAELKRLQQENMQLLTDARAARMYRDELDTMKERAIRADKLESEVTRYRDKLHNMNFYKAKLEELKEDNQVLMESKAMLEEQLQSIKTRSDKLQPLEKHNLLLEAKLHDMEEERTANRRQIEELMERNVILELSQKRSMEESQRLGWELELAK-SPQQNSATELKSLSQEVNEKTCSRLLKLEKENQRLLKALEELQ 476          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Zebrafish
Match: ccdc88b (coiled-coil domain containing 88B [Source:ZFIN;Acc:ZDB-GENE-080303-31])

HSP 1 Score: 111.309 bits (277), Expect = 1.023e-23
Identity = 94/332 (28.31%), Postives = 167/332 (50.30%), Query Frame = 2
Query:  206 GYFLNEVFKEIDPNS--------VTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFS-----TGQMVKQLRCVTEQWEDSFIEDTKAILSQNDA-LXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVR-------CEELREDLAVI 1138
            G +LNEV + IDPN         V ++++ +       ++N+ IL +++R YY   LQQ  ++ LP++  +  DP +     E+ + + L+LG AVQCERKE FIQ I  +  +   Q  +   I+++T+    V+      EF       G  ++ L C       S  +  + +L+Q D  L+   +  + Q   + ++   +G   +   S + +A +LAE KAKLR+L+ EL+DK D + D + +++  + E  KL++    L  E R  R L+DELD  RE   R+  ++ + +    ++  +E YR +       C  L+E+ A++
Sbjct:   60 GVYLNEVMRIIDPNPKVEQIYHNVGDDKIRR-------VQNFSILNRHLRSYYQENLQQLVLMPLPNVAVLGRDPLTEGAVAELRRLLLLLLGCAVQCERKETFIQQI--QCLDIDTQAEIALCIQEVTQDRSAVLPL----EFGDLCGLNGAELQILFC-------SMAKQIQNLLAQRDTQLERIAELCQEQESSVNHINTSSG---FGDGSPEGLAFQLAESKAKLRRLKQELEDKGDQLLDYKQEMQTMEEEIKKLQKESRALQVEVRASRGLKDELDCLRERAARVEQLQTELKNCTHRLRSMELYRTQLKEQQQYCASLQENKALL 368          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Zebrafish
Match: hook1 (hook microtubule-tethering protein 1 [Source:NCBI gene;Acc:570393])

HSP 1 Score: 53.9138 bits (128), Expect = 1.936e-6
Identity = 132/571 (23.12%), Postives = 255/571 (44.66%), Query Frame = 2
Query:  140 LFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCR-SIVDCIK----NWEILLKNIRVYYMLVL-QQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLK----NVGVDNGIVSYSSNSDKTM---ALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTK----LKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKAT----------RKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETI 1771
            L  WL+ F T+    + + L+ G  +++   +IDP+  +   L + +  + D ++    N + +L+ I  YY  VL QQ     LP ++ +           E+ + + LILG AV+C+RK+ +IQ I+T   EES+QH +M  I+++            +   S  Q+  +    TEQ     +ED   ++++ + L  + Q+   Q+ VL+    ++  +N +++  S+  +T    +       ++L+    +L ++N  +   +DD  +   E  K    L+    +LT+ +   R L+DELD  R    R   +EA  +  ++K+ +L   R + + L E                  N   +    +LE E RKA           R+ +EL + +S        L +++  +QEK +  +  +  +  E   L+E+  +   + +  DQ++     K       + +L  ++  I++         +E+   L+ E     NK+ RLQQ  + E Q+  E+++  +   R + QLD D +  +E    RI EL Q+ E+L + +
Sbjct:   12 LIIWLQTFKTAAPCKTVEDLTSGAAMSQALHQIDPSWFSESWLARIKEDVGDNVRLKMNNLKKILQMIVDYYNEVLAQQMSDFPLPDLMRVV----EQSDQVELGRLLQLILGCAVKCDRKQEYIQIIMTL--EESVQHVVMTAIQEL------------MSRESVSQLGAEPAGDTEQQLKKALEDLTEVMAEKEELAQRCQELDMQVTVLQEERNSLLAENDLLTDRSSQLETFDDPSTPSGRKHSQLQFQLEQLQEENFRLEAAKDDYRIHCEELEKQLVELQHRNDELTSLAEESRSLKDELDILRSCSDRAVKLEASVETYRKKLEDLSDLRRQMKALEE-----------------KNMTYMHNTVSLEEELRKANAARAQLETYKRQVQELHKKLSDESRRADNLVFEMKKLQEKYDALVKERERISIERDTLRETNEELRCTQAQQDQLL--LAGKYQTGSPSHDNLAAEMLPIEY---------REKFIRLQHE-----NKMLRLQQ-EESEKQRITELQQQLEEARRGRSQLDTDNRLNRE----RISELQQQVEDLQKAL 526          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Xenopus
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:100380128])

HSP 1 Score: 357.066 bits (915), Expect = 5.089e-99
Identity = 447/1603 (27.89%), Postives = 799/1603 (49.84%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEKFVKMTATVDNELFSWLKLFWTXXXXXXX-----XXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE--EFSTGQMVKQL--------RCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-----MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXD-QVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAE---LEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQ---------QLQQ---STSISNETLEENMKELAMENQ------------RKTSQLMK----KISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKIN----EMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSF-------TQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLK---DKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQL-------STEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTN-----LSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQ-----------EGKNKNENPSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNEESEMDCGAPTPKLKSSRLSNSDTYSMISSISQQESF-VSNSTKLIPGS 4546
            F PI+ NF++S                  L  W+K F T              L DG FLNEV  +I+P +       K  +     I+N  +L+K ++ YY   LQQ  ++ LP+++TI  +P+S +   E+ K + L+LG AVQCERKE FI+ I  ++ +   +  +  +I+++T + + V +   LE  E S+  +   L        R + E+  D + E    +  + D+L                + +     S S    +T     +++ELA+ KAK+R+L+ EL++K +   D + ++   ++E  ++++  M L  ++R  R+ +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E         I +L  + MS++      +     L  EL++L ++             +V E T+++LL+LE+EN++LL  + +++    S   K   +I +LE+EN RL  K+ +L+     E Q     +     L +EK +L+  I+++QEN+ R+I+ L QENE+L++TI  +R+RS+ S + RV ++EKEN  LH S+ E + KL+KMEF+ ++M ++        ++S +   +L +   E   L+K++ +L +   + E L+ + + LE+E    K  LD+L +  YQ         QL++   S   S E+L+    ++A                RK  +LMK    K   LE       TEN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++  LE++ KQL+KEN R + Q  A++  + + +N +     E E K+   E + F             E+  R+ + E +N+EL+++   +K+   TLRE+L+NE++ +Q + N+++ LS ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I SL++RL  S   N++L  +L+  +  Y +L+Q+ EEE  V +       ++  V  +       T+ LL +KD LI+VER NA L +EKQ L +Q + L+   D + A       Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q + +E       ++  SLTK +++L++    L K + +L       + EYE L  +  S KS +K++  +     D   Q  K+   L+ L++ L+ E+  +    +Q   L  +   L++E   +  +  ++  E +SL  ++K LK  LN+ K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N     +  L    K    + L+       R++S     Q            G N  E+   +   +S   +   I S  +S IG    D+ + H           DNE      G+P P L   RL  S   S +  +   ++   S  +KL+PGS
Sbjct:    6 FAPILENFMSS-----------------PLVIWIKTFGTLLRGTGTLLDEYVALIDGVFLNEVMFQINPKADNQRIYRKINNDASLRIQNLSVLVKQMKSYYQESLQQLVMMSLPNVLTIGKNPYSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKI--QVLDFDTKAAVAAHIQEVTHNQENVFDLQLLEPTEMSSEDLEALLKNTSFHLKRLIDER--DEYTETIIELTEERDSLH------------FAPLAISAQSPSGSPGMRRTESRQHLSVELADAKAKIRRLRQELEEKTEQYLDSKQEVGHMEAELKRVQQENMNLLADARSARVYRDELDALREKAIRVDKLESELSRYKERMHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGARARSDKLHELEKENLQLKAKFHDMETERDLERKRIEELMEENMSLEMAQKQSMDESLHLGWELEQLSKTSDLPEIPQKSLGHEVNELTSSRLLKLEMENQTLLSTVEELRNTMGSTDGK-NTKILKLEKENQRLCKKMEKLEAEINHERQNNQSSQHLSSDLMKEKSELEKTIETLQENSERQIKGLEQENEHLNQTITSLRQRSQISAEARVKDIEKENKILHESIKETSSKLNKMEFEKKQMKKELEHFKEMGERSEELEKELHRVEKETELLQKKITSLNIVCEKTEVLEQENAGLELENRKLKKTLDSLKNLKYQMESLEKENNQLEEENLSLRRSVESLKSTNIKVAQLELENKELENEKEQLRKGLELMKASCRKTERLEVSYQGLDTENQRLQKALENSNKKIQQLENELQDLEAENQTLQKNLEELKISSKRLEQLEKETKLLEQETCLLEKDKKQLEKENKRLRQQ--AEVKDITLEENNVRISNLERENKLLSKETNAF------------KESCSRVKELEMENKELVKRATIDKKTLITLREDLVNEKLKTQQINNELEKLSHELEKIGLNKERLLHDEQTTDDSRYKLLESKLESTLKKSLEIKEEKIASLEARLEESANFNQQLRQELKTVKKNYEALKQRQEEERLVQTSPPRPGEENVPVTKWERESQETTRELLKIKDRLIEVERNNATLQAEKQALKTQLKQLENQNDNLQAQILALQKQTISLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNSQLLIQQSTLE-------NENESLTKEREELKSVYDLLVKDHEKLAQVHERQAAEYESLISKHGSLKSAHKNLEVEHKDLEDRYNQLLKQKVQLEELEKALKEEQAKMLQEKKQHEMLSSDYQRLTEEHGRLNHTYRQLLRENESLQSDHKNLKSLLNSGKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFQVEQRQYIDKLNELRRQKEKLEEKIMDQYKFHEPSPPRRRGNWITLKMRKLIKSKKDNNRERLRSLPMAPSRSESSEGFLQLPLGDSQDSSSVGSNSLEDGHPLGAKKSSRVVTAQIRS--HSHIGG---DFSLHH-----------DNEPLN-GSGSPVPYL-GHRLKKSAASSPMLRLKLGDTPETSLQSKLMPGS 1535          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Xenopus
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:100380128])

HSP 1 Score: 350.903 bits (899), Expect = 3.634e-97
Identity = 415/1451 (28.60%), Postives = 749/1451 (51.62%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEKFVKMTATVDNELFSWLKLFWTXXXXXXX-----XXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE--EFSTGQMVKQL--------RCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-----MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXX-XXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAE---LEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQ---------QLQQ---STSISNETLEENMKELAMENQ------------RKTSQLMK----KISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKIN----EMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSF-------TQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLK---DKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQL-------STEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F PI+ NF++S                  L  W+K F T              L DG FLNEV  +I+P +       K  +     I+N  +L+K ++ YY   LQQ  ++ LP+++TI  +P+S +   E+ K + L+LG AVQCERKE FI+ I  ++ +   +  +  +I+++T + + V +   LE  E S+  +   L        R + E+  D + E    +  + D+L                + +     S S    +T     +++ELA+ KAK+R+L+ EL++K +   D + ++   ++E  ++++  M L  ++R  R+ +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E         I +L  + MS++      +     L  EL++L ++         S+  +V E T+++LL+LE+EN++LL  + +++    S   K   +I +LE+EN RL  K+ +L+     E Q     +     L +EK +L+  I+++QEN+ R+I+ L QENE+L++TI  +R+RS+ S + RV ++EKEN  LH S+ E + KL+KMEF+ ++M ++        ++S +   +L +   E   L+K++ +L +   + E L+ + + LE+E    K  LD+L +  YQ         QL++   S   S E+L+    ++A                RK  +LMK    K   LE       TEN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++  LE++ KQL+KEN R + Q  A++  + + +N +     E E K+   E + F             E+  R+ + E +N+EL+++   +K+   TLRE+L+NE++ +Q + N+++ LS ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I SL++RL  S   N++L  +L+  +  Y +L+Q+ EEE  V +       ++  V  +       T+ LL +KD LI+VER NA L +EKQ L +Q + L+   D + A       Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q + +E       ++  SLTK +++L++    L K + +L       + EYE L  +  S KS +K++  +     D   Q  K+   L+ L++ L+ E+  +    +Q   L  +   L++E   +  +  ++  E +SL  ++K LK  LN+ K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FAPILENFMSS-----------------PLVIWIKTFGTLLRGTGTLLDEYVALIDGVFLNEVMFQINPKADNQRIYRKINNDASLRIQNLSVLVKQMKSYYQESLQQLVMMSLPNVLTIGKNPYSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKI--QVLDFDTKAAVAAHIQEVTHNQENVFDLQLLEPTEMSSEDLEALLKNTSFHLKRLIDER--DEYTETIIELTEERDSLH------------FAPLAISAQSPSGSPGMRRTESRQHLSVELADAKAKIRRLRQELEEKTEQYLDSKQEVGHMEAELKRVQQENMNLLADARSARVYRDELDALREKAIRVDKLESELSRYKERMHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGARARSDKLHELEKENLQLKAKFHDMETERDLERKRIEELMEENMSLEMAQKQSMDESLHLGWELEQLSKTSDLPEIPQKSLGHEVNELTSSRLLKLEMENQTLLSTVEELRNTMGSTDGK-NTKILKLEKENQRLCKKMEKLEAEINHERQNNQSSQHLSSDLMKEKSELEKTIETLQENSERQIKGLEQENEHLNQTITSLRQRSQISAEARVKDIEKENKILHESIKETSSKLNKMEFEKKQMKKELEHFKEMGERSEELEKELHRVEKETELLQKKITSLNIVCEKTEVLEQENAGLELENRKLKKTLDSLKNLKYQMESLEKENNQLEEENLSLRRSVESLKSTNIKVAQLELENKELENEKEQLRKGLELMKASCRKTERLEVSYQGLDTENQRLQKALENSNKKIQQLENELQDLEAENQTLQKNLEELKISSKRLEQLEKETKLLEQETCLLEKDKKQLEKENKRLRQQ--AEVKDITLEENNVRISNLERENKLLSKETNAF------------KESCSRVKELEMENKELVKRATIDKKTLITLREDLVNEKLKTQQINNELEKLSHELEKIGLNKERLLHDEQTTDDSRYKLLESKLESTLKKSLEIKEEKIASLEARLEESANFNQQLRQELKTVKKNYEALKQRQEEERLVQTSPPRPGEENVPVTKWERESQETTRELLKIKDRLIEVERNNATLQAEKQALKTQLKQLENQNDNLQAQILALQKQTISLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNSQLLIQQSTLE-------NENESLTKEREELKSVYDLLVKDHEKLAQVHERQAAEYESLISKHGSLKSAHKNLEVEHKDLEDRYNQLLKQKVQLEELEKALKEEQAKMLQEKKQHEMLSSDYQRLTEEHGRLNHTYRQLLRENESLQSDHKNLKSLLNSGKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFQVEQRQYIDKLNELRRQKEKLEEKIMDQYKFHEPSPPRRRGNWITL 1401          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Xenopus
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:100380128])

HSP 1 Score: 351.288 bits (900), Expect = 3.667e-97
Identity = 414/1451 (28.53%), Postives = 747/1451 (51.48%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEKFVKMTATVDNELFSWLKLFWTXXXXXXX-----XXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE--EFSTGQMVKQL--------RCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-----MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXD-QVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAE---LEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQ---------QLQQ---STSISNETLEENMKELAMENQ------------RKTSQLMK----KISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKIN----EMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSF-------TQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLK---DKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQL-------STEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F PI+ NF++S                  L  W+K F T              L DG FLNEV  +I+P +       K  +     I+N  +L+K ++ YY   LQQ  ++ LP+++TI  +P+S +   E+ K + L+LG AVQCERKE FI+ I  ++ +   +  +  +I+++T + + V +   LE  E S+  +   L        R + E+  D + E    +  + D+L                + +     S S    +T     +++ELA+ KAK+R+L+ EL++K +   D + ++   ++E  ++++  M L  ++R  R+ +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E         I +L  + MS++      +     L  EL++L ++             +V E T+++LL+LE+EN++LL  + +++    S   K   +I +LE+EN RL  K+ +L+     E Q     +     L +EK +L+  I+++QEN+ R+I+ L QENE+L++TI  +R+RS+ S + RV ++EKEN  LH S+ E + KL+KMEF+ ++M ++        ++S +   +L +   E   L+K++ +L +   + E L+ + + LE+E    K  LD+L +  YQ         QL++   S   S E+L+    ++A                RK  +LMK    K   LE       TEN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++  LE++ KQL+KEN R + Q  A++  + + +N +     E E K+   E + F             E+  R+ + E +N+EL+++   +K+   TLRE+L+NE++ +Q + N+++ LS ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I SL++RL  S   N++L  +L+  +  Y +L+Q+ EEE  V +       ++  V  +       T+ LL +KD LI+VER NA L +EKQ L +Q + L+   D + A       Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q + +E       ++  SLTK +++L++    L K + +L       + EYE L  +  S KS +K++  +     D   Q  K+   L+ L++ L+ E+  +    +Q   L  +   L++E   +  +  ++  E +SL  ++K LK  LN+ K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FAPILENFMSS-----------------PLVIWIKTFGTLLRGTGTLLDEYVALIDGVFLNEVMFQINPKADNQRIYRKINNDASLRIQNLSVLVKQMKSYYQESLQQLVMMSLPNVLTIGKNPYSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKI--QVLDFDTKAAVAAHIQEVTHNQENVFDLQLLEPTEMSSEDLEALLKNTSFHLKRLIDER--DEYTETIIELTEERDSLH------------FAPLAISAQSPSGSPGMRRTESRQHLSVELADAKAKIRRLRQELEEKTEQYLDSKQEVGHMEAELKRVQQENMNLLADARSARVYRDELDALREKAIRVDKLESELSRYKERMHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGARARSDKLHELEKENLQLKAKFHDMETERDLERKRIEELMEENMSLEMAQKQSMDESLHLGWELEQLSKTSDLPEIPQKSLGHEVNELTSSRLLKLEMENQTLLSTVEELRNTMGSTDGK-NTKILKLEKENQRLCKKMEKLEAEINHERQNNQSSQHLSSDLMKEKSELEKTIETLQENSERQIKGLEQENEHLNQTITSLRQRSQISAEARVKDIEKENKILHESIKETSSKLNKMEFEKKQMKKELEHFKEMGERSEELEKELHRVEKETELLQKKITSLNIVCEKTEVLEQENAGLELENRKLKKTLDSLKNLKYQMESLEKENNQLEEENLSLRRSVESLKSTNIKVAQLELENKELENEKEQLRKGLELMKASCRKTERLEVSYQGLDTENQRLQKALENSNKKIQQLENELQDLEAENQTLQKNLEELKISSKRLEQLEKETKLLEQETCLLEKDKKQLEKENKRLRQQ--AEVKDITLEENNVRISNLERENKLLSKETNAF------------KESCSRVKELEMENKELVKRATIDKKTLITLREDLVNEKLKTQQINNELEKLSHELEKIGLNKERLLHDEQTTDDSRYKLLESKLESTLKKSLEIKEEKIASLEARLEESANFNQQLRQELKTVKKNYEALKQRQEEERLVQTSPPRPGEENVPVTKWERESQETTRELLKIKDRLIEVERNNATLQAEKQALKTQLKQLENQNDNLQAQILALQKQTISLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNSQLLIQQSTLE-------NENESLTKEREELKSVYDLLVKDHEKLAQVHERQAAEYESLISKHGSLKSAHKNLEVEHKDLEDRYNQLLKQKVQLEELEKALKEEQAKMLQEKKQHEMLSSDYQRLTEEHGRLNHTYRQLLRENESLQSDHKNLKSLLNSGKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFQVEQRQYIDKLNELRRQKEKLEEKIMDQYKFHEPSPPRRRGNWITL 1401          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Xenopus
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:100380128])

HSP 1 Score: 350.903 bits (899), Expect = 5.696e-97
Identity = 415/1451 (28.60%), Postives = 749/1451 (51.62%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEKFVKMTATVDNELFSWLKLFWTXXXXXXX-----XXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE--EFSTGQMVKQL--------RCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-----MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXX-XXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAE---LEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQ---------QLQQ---STSISNETLEENMKELAMENQ------------RKTSQLMK----KISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKIN----EMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSF-------TQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLK---DKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQL-------STEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F PI+ NF++S                  L  W+K F T              L DG FLNEV  +I+P +       K  +     I+N  +L+K ++ YY   LQQ  ++ LP+++TI  +P+S +   E+ K + L+LG AVQCERKE FI+ I  ++ +   +  +  +I+++T + + V +   LE  E S+  +   L        R + E+  D + E    +  + D+L                + +     S S    +T     +++ELA+ KAK+R+L+ EL++K +   D + ++   ++E  ++++  M L  ++R  R+ +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E         I +L  + MS++      +     L  EL++L ++         S+  +V E T+++LL+LE+EN++LL  + +++    S   K   +I +LE+EN RL  K+ +L+     E Q     +     L +EK +L+  I+++QEN+ R+I+ L QENE+L++TI  +R+RS+ S + RV ++EKEN  LH S+ E + KL+KMEF+ ++M ++        ++S +   +L +   E   L+K++ +L +   + E L+ + + LE+E    K  LD+L +  YQ         QL++   S   S E+L+    ++A                RK  +LMK    K   LE       TEN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++  LE++ KQL+KEN R + Q  A++  + + +N +     E E K+   E + F             E+  R+ + E +N+EL+++   +K+   TLRE+L+NE++ +Q + N+++ LS ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I SL++RL  S   N++L  +L+  +  Y +L+Q+ EEE  V +       ++  V  +       T+ LL +KD LI+VER NA L +EKQ L +Q + L+   D + A       Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q + +E       ++  SLTK +++L++    L K + +L       + EYE L  +  S KS +K++  +     D   Q  K+   L+ L++ L+ E+  +    +Q   L  +   L++E   +  +  ++  E +SL  ++K LK  LN+ K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FAPILENFMSS-----------------PLVIWIKTFGTLLRGTGTLLDEYVALIDGVFLNEVMFQINPKADNQRIYRKINNDASLRIQNLSVLVKQMKSYYQESLQQLVMMSLPNVLTIGKNPYSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKI--QVLDFDTKAAVAAHIQEVTHNQENVFDLQLLEPTEMSSEDLEALLKNTSFHLKRLIDER--DEYTETIIELTEERDSLH------------FAPLAISAQSPSGSPGMRRTESRQHLSVELADAKAKIRRLRQELEEKTEQYLDSKQEVGHMEAELKRVQQENMNLLADARSARVYRDELDALREKAIRVDKLESELSRYKERMHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGARARSDKLHELEKENLQLKAKFHDMETERDLERKRIEELMEENMSLEMAQKQSMDESLHLGWELEQLSKTSDLPEIPQKSLGHEVNELTSSRLLKLEMENQTLLSTVEELRNTMGSTDGK-NTKILKLEKENQRLCKKMEKLEAEINHERQNNQSSQHLSSDLMKEKSELEKTIETLQENSERQIKGLEQENEHLNQTITSLRQRSQISAEARVKDIEKENKILHESIKETSSKLNKMEFEKKQMKKELEHFKEMGERSEELEKELHRVEKETELLQKKITSLNIVCEKTEVLEQENAGLELENRKLKKTLDSLKNLKYQMESLEKENNQLEEENLSLRRSVESLKSTNIKVAQLELENKELENEKEQLRKGLELMKASCRKTERLEVSYQGLDTENQRLQKALENSNKKIQQLENELQDLEAENQTLQKNLEELKISSKRLEQLEKETKLLEQETCLLEKDKKQLEKENKRLRQQ--AEVKDITLEENNVRISNLERENKLLSKETNAF------------KESCSRVKELEMENKELVKRATIDKKTLITLREDLVNEKLKTQQINNELEKLSHELEKIGLNKERLLHDEQTTDDSRYKLLESKLESTLKKSLEIKEEKIASLEARLEESANFNQQLRQELKTVKKNYEALKQRQEEERLVQTSPPRPGEENVPVTKWERESQETTRELLKIKDRLIEVERNNATLQAEKQALKTQLKQLENQNDNLQAQILALQKQTISLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNSQLLIQQSTLE-------NENESLTKEREELKSVYDLLVKDHEKLAQVHERQAAEYESLISKHGSLKSAHKNLEVEHKDLEDRYNQLLKQKVQLEELEKALKEEQAKMLQEKKQHEMLSSDYQRLTEEHGRLNHTYRQLLRENESLQSDHKNLKSLLNSGKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFQVEQRQYIDKLNELRRQKEKLEEKIMDQYKFHEPSPPRRRGNWITL 1401          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Xenopus
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:100380128])

HSP 1 Score: 349.747 bits (896), Expect = 9.209e-97
Identity = 415/1451 (28.60%), Postives = 749/1451 (51.62%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEKFVKMTATVDNELFSWLKLFWTXXXXXXX-----XXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE--EFSTGQMVKQL--------RCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-----MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXX-XXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAE---LEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQ---------QLQQ---STSISNETLEENMKELAMENQ------------RKTSQLMK----KISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKIN----EMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSF-------TQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLK---DKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQL-------STEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F PI+ NF++S                  L  W+K F T              L DG FLNEV  +I+P +       K  +     I+N  +L+K ++ YY   LQQ  ++ LP+++TI  +P+S +   E+ K + L+LG AVQCERKE FI+ I  ++ +   +  +  +I+++T + + V +   LE  E S+  +   L        R + E+  D + E    +  + D+L                + +     S S    +T     +++ELA+ KAK+R+L+ EL++K +   D + ++   ++E  ++++  M L  ++R  R+ +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E         I +L  + MS++      +     L  EL++L ++         S+  +V E T+++LL+LE+EN++LL  + +++    S   K   +I +LE+EN RL  K+ +L+     E Q     +     L +EK +L+  I+++QEN+ R+I+ L QENE+L++TI  +R+RS+ S + RV ++EKEN  LH S+ E + KL+KMEF+ ++M ++        ++S +   +L +   E   L+K++ +L +   + E L+ + + LE+E    K  LD+L +  YQ         QL++   S   S E+L+    ++A                RK  +LMK    K   LE       TEN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++  LE++ KQL+KEN R + Q  A++  + + +N +     E E K+   E + F             E+  R+ + E +N+EL+++   +K+   TLRE+L+NE++ +Q + N+++ LS ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I SL++RL  S   N++L  +L+  +  Y +L+Q+ EEE  V +       ++  V  +       T+ LL +KD LI+VER NA L +EKQ L +Q + L+   D + A       Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q + +E       ++  SLTK +++L++    L K + +L       + EYE L  +  S KS +K++  +     D   Q  K+   L+ L++ L+ E+  +    +Q   L  +   L++E   +  +  ++  E +SL  ++K LK  LN+ K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FAPILENFMSS-----------------PLVIWIKTFGTLLRGTGTLLDEYVALIDGVFLNEVMFQINPKADNQRIYRKINNDASLRIQNLSVLVKQMKSYYQESLQQLVMMSLPNVLTIGKNPYSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKI--QVLDFDTKAAVAAHIQEVTHNQENVFDLQLLEPTEMSSEDLEALLKNTSFHLKRLIDER--DEYTETIIELTEERDSLH------------FAPLAISAQSPSGSPGMRRTESRQHLSVELADAKAKIRRLRQELEEKTEQYLDSKQEVGHMEAELKRVQQENMNLLADARSARVYRDELDALREKAIRVDKLESELSRYKERMHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGARARSDKLHELEKENLQLKAKFHDMETERDLERKRIEELMEENMSLEMAQKQSMDESLHLGWELEQLSKTSDLPEIPQKSLGHEVNELTSSRLLKLEMENQTLLSTVEELRNTMGSTDGK-NTKILKLEKENQRLCKKMEKLEAEINHERQNNQSSQHLSSDLMKEKSELEKTIETLQENSERQIKGLEQENEHLNQTITSLRQRSQISAEARVKDIEKENKILHESIKETSSKLNKMEFEKKQMKKELEHFKEMGERSEELEKELHRVEKETELLQKKITSLNIVCEKTEVLEQENAGLELENRKLKKTLDSLKNLKYQMESLEKENNQLEEENLSLRRSVESLKSTNIKVAQLELENKELENEKEQLRKGLELMKASCRKTERLEVSYQGLDTENQRLQKALENSNKKIQQLENELQDLEAENQTLQKNLEELKISSKRLEQLEKETKLLEQETCLLEKDKKQLEKENKRLRQQ--AEVKDITLEENNVRISNLERENKLLSKETNAF------------KESCSRVKELEMENKELVKRATIDKKTLITLREDLVNEKLKTQQINNELEKLSHELEKIGLNKERLLHDEQTTDDSRYKLLESKLESTLKKSLEIKEEKIASLEARLEESANFNQQLRQELKTVKKNYEALKQRQEEERLVQTSPPRPGEENVPVTKWERESQETTRELLKIKDRLIEVERNNATLQAEKQALKTQLKQLENQNDNLQAQILALQKQTISLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNSQLLIQQSTLE-------NENESLTKEREELKSVYDLLVKDHEKLAQVHERQAAEYESLISKHGSLKSAHKNLEVEHKDLEDRYNQLLKQKVQLEELEKALKEEQAKMLQEKKQHEMLSSDYQRLTEEHGRLNHTYRQLLRENESLQSDHKNLKSLLNSGKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFQVEQRQYIDKLNELRRQKEKLEEKIMDQYKFHEPSPPRRRGNWITL 1401          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Mouse
Match: Ccdc88a (coiled coil domain containing 88A [Source:MGI Symbol;Acc:MGI:1925177])

HSP 1 Score: 373.244 bits (957), Expect = 2.546e-104
Identity = 410/1436 (28.55%), Postives = 750/1436 (52.23%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEK-FVKMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC---IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ---------MVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXD-QVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRM----------NQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQ--QLQQSTS-ISNETLE------------ENMKELAMENQ---------RKTSQLM----KKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAV---IXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F P++  F+TS  + + K F  + A     L  ++ L              DG FLN+V  +I+P S +  Q V  +   D    I N  IL+K I+ YY   LQQ  ++ LP I+ I  +P S +   E+ K + L+LG AVQC++KE FI+ I  +  +   +  +  +I+++T + + V +   +E     Q         MV  LR + ++  D   E    +  + D +        +      + G+        + S + +++ELA+ KAK+R+L+ EL++K + + D + +LE  + E  +L++  M L +++R  RM +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E        +I +L  + M+++      +     L  EL+++  +   +         +V E T++KLL+LE+EN+SL + + +++    S       +I ++E+EN RL+ KV  L+    +E Q     +   + L +EK QL+  I++++EN+ R+I+ L QENE+L++T+  +R+RS+ S + RV ++EKEN  LH S+ E   KLSK+EF+ ++M           ++  +L++ L+        L K+N  L+K++ NLK+   +LE L+ + S LE E    K  LD+  +  +Q   L++  S +  E LE              M +L +EN+         RK  +LM    KK   LE       TEN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++ +LE++ KQL+KEN R + Q  A++    + +N +        +  L+K +K  F+++ +   E+  RL + E++N+EL+++   + +   TLRE+L++E++ +Q + N ++ L+ ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I +L++RL  S   N++L  +L+  +  Y +L+Q+ +EE  V   I V              T+ LL +KD LI+VER NA L +EKQ L +Q + L+ + +  + + +    Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q +++E    S + +   L      L      L+ L+ + ++EYE L  +  + KS +K++  +     D   Q  K+   L+ L++++++E+  +   ++    +  E   L  E ND L   Y ++  E + L  ++K LK  LNN K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALV-------------DGVFLNQVMLQINPKSES--QRVNKKVNNDASLRIHNLSILVKQIKFYYQETLQQLIMMPLPDILIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIEKI--QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMVSHLRRLIDE-RDEHSETIVELSEERDGVHFLPHASSSAQSPCGSPGMKR------TESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQIEVELKRLQQENMNLLSDARSARMYRDELDALREKAVRVDKLESELSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELAEAPQKSLGHEVNELTSSKLLKLEMENQSLTKTVEELRSTADSAAGSTS-KILKVEKENQRLNKKVEILENEIIQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETCGKLSKIEFEKRQMKKELELYKEKGERAEELENELN-------HLGKENELLQKKITNLKITCEKLETLEQENSELERENRKFKKTLDSFKNLTFQLESLEKENSQLDEENLELRRSVESLKCASMRMAQLQLENKELESEKEQLRKGLELMRASFKKTERLEVSYQGLDTENQRLQKALENSNKKIQQLESELQDLEMENQTLQKSLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKRLRQQ--AEIKDTTLEENNVK-------IGNLEKENKTLFKEINV-YKESCVRLKELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDSRYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRHELKTVKKNYEALKQRQDEERMVQSSIPVSGEDDKWGRESQEATRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENESIMKEREDLKSLYDALIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHKDLEDRYNQLLKQKGQLEDLEKMIKTEQEKMLLESKNHEVVASEYKKLCGE-NDRLNYTYSQLLKETEILQMDHKNLKSVLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITL 1398          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Mouse
Match: Ccdc88c (coiled-coil domain containing 88C [Source:MGI Symbol;Acc:MGI:1915589])

HSP 1 Score: 322.013 bits (824), Expect = 4.467e-88
Identity = 421/1585 (26.56%), Postives = 770/1585 (48.58%), Query Frame = 2
Query:  128 VDNELFSWLKLFWTXXXXXXXXXX-----XXGYFLNEVFKEIDPNSVTNEQLVK-CRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQ-----DIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE---------EFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKL--EYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXX-XDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNL------QLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQ--RKTSQLMK----KISELESE----------------LVKT---------------KTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIE--FEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYE----------EELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLST-------EYEILKKETKSQKSINKSI---NAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSM-PSTKKTNLSILYDEPKGGRN--KFLKKAKEILRR-----NDSKS-----------SVEQEGKNKNENPSRMQRSRSC-----------GTILGSIESIKNSSIGDKSTDYQIDHTDTS------------EKEDFLTDNEESEMDCGAPTPK-LKSSRLSNSD 4471
            + + L +W+K F +       +L       DG FLN++  +IDP   +N+++ K   + V+  I+N  IL++NI+ YY  VLQQ  V+ LP+++ I  DP S K+  EI K + L+LG AVQCERKE FI+     DI T       Q G++ +I+++T + + V +   L+         E  +  MV  LR + ++  D   E    +  + D LQ Q      +     +        S  S+ DK  +A+ELA+ KA+LR+++ EL++K + ++D R +++    E  K K+  ++L  ++R  R  +DELDS RE   R+  +E D  + KEK++++++Y+ R EELRED  ++    + L +++  ++   ++   LE E  +   K  +LE    +   +I KL  EY ++ M +K ++  S+   L  EL++L ++   S  S      ++ E  ++++L+LE EN+SL   +  ++ D +  L +   +  ELE+EN +L  K+ +LQ   ++E Q   ++E   + L REK+QL   +++++ + +R+I++L QE  +L + +  +RER + ++     ++EKEN  LH ++ E   KLS++E + Q++++    L+ + +K  Q         +L K+N +L KE+ +LK    ++E L+ +   LE+E    +  LD L         Q+ S+  E LE + ++L  EN   RK  + M+    K++++E+E                L+KT                 EN +    +  S +K ++L++EL   + E     R    L+L  + L   E +R+ L+ +  +LE++ K L+KE  R   Q + + + ++    K++  E +   L+      KE    +   +    +L + E+ NR+L +Q+    R  +TLRE+L+ E++ SQ L +++  LS ELE++G+ +      ++     + K  S ++ T+  KEE+I  L++++      +++L ++L+  + ++  L Q  E               ++    + +   +    T  LL +KD  I++ER NA L +E+Q L  Q + L+ +  +    +  Q+ +LQK+ + L      L+ Q + L+ +  TL + N  LS Q T ++    +   +   L + ++QL A   +L + +  L T       EYE L ++    K++++++   + +L   + +L Q K E   L+ L+++L +E+  L    +       EN  L  E + I     +++ E + L+ + K LK  LNN +   ++ + +   L+      +  + K++   E L+R    L EEN  LL Q++ +  QNQ L+ + +++++    E+    DKL+ L+RHKE+LEEKIM+Q+K   P+ KK N  I      G +   K +K  KE  R       DS             S  Q  +++ ENP       +C           G   G ++  + S  G       +D TDTS                F T    + +    P PK L  ++  NSD
Sbjct:   13 LQSPLVTWVKTFGSFGSGHQDNLTLYMDLVDGIFLNQIMLQIDPRP-SNQRINKHVNNDVNLRIQNLSILVRNIKTYYQEVLQQLIVMNLPNVLMIGKDPLSGKSMEEIKKVLLLVLGCAVQCERKEEFIERIKQLDIET-------QAGIVAHIQEVTHNQENVFDLQWLDLPDVAPEELEALSRNMVFHLRRLIDE-RDECTELIVDLTQERDYLQTQQPPSPGK---FSSPDSTPSPTSSLSSEDKQHLAVELADTKARLRRVRQELEEKTEQLADTRHEVDQLVLELQKAKQDNIQLAADARSARAYRDELDSLREKANRVERLEMDLVRCKEKLHDVDFYKARMEELREDNIILIETKAMLEEQLTASRARSDKVHELEKENLQLKSKLHDLELDRDADKKQIEKLLEEYMVLEMAQKQSMKESA--HLGWELEQLSKNADLSDASRKSFVFELNECASSRILKLEKENQSLQSTIQGLR-DTSLALEESSLKYGELEKENQQLSKKIEKLQTQLEREKQSNQDLETLSEELIREKEQLQSGMEALKADRARQIKDLEQEKGHLHQAVWSLRERPQVNS---TKDVEKENRALHQAVTEAGSKLSQLELEKQQLHRD---LEEAKEKGEQAEALEKELHRLEKENEQLTKEVTSLKAATEKVEALEHQSQGLELENRSLRKSLDTL---------QNVSVQLEGLERDKQQLGQENLELRKMVEAMRFTSAKMAQIETENRQLEREKEELRRDVELLKTLSKKSERLELSYQSVSAENLQLQHSLESSTHKSQALQRELSQLEAERQALRRDLETLQLTHKQLEGAEEDRKALEQEVAQLEKDKKLLEKEARRLWQQVELKDAILDDSAAKLSAAEKESRALD------KELARCRDVGS----KLKELEKDNRDLTKQVTMHTRTLTTLREDLVLEKLKSQQLSSELDKLSQELEKVGLSKDLLLQEDDGHGDGKGKTESALKTTLAMKEEKIVFLEAQVEEKESLSRQLQIELQMIKKEHEQLRQTQEGGDKAQNALKRPPGKVTSHQEKEAWEPSHKEATMELLRVKDRAIELERSNAALQAERQLLKEQLQHLETQNVS----FSSQILTLQKQSAFLQEHTTTLQTQTAKLQVENSTLSSQNAALSAQYTVLQSQQAAKEAEHEGLQQQQEQLAAVYEALLQDHKHLGTLYECQSSEYEALIRQHSCLKTLHRNLELEHKELGERHGDLQQRKAE---LEELEKVLSTEREALEREQKTNAIATSENQRLRGELDRISFLHQQLKGEYEELHAHTKELKTSLNNSQLELSRWQVRFDELKEQHQSMDISLTKMDNHCELLSRLKGNLEEENHHLLSQIQLLSQQNQMLLEQNMESKEQYHEEQKQYIDKLNALRRHKEKLEEKIMDQYKFYDPAPKKKNHWI------GAKALVKLIKPKKEGSRERLKSTTDSPPWQLEPSDPASPSPSQALRSQTENPDNPPSGPNCVEERDTHNGPVGKGPGDLKPKRGSPRGGS-----VDRTDTSTDPAVKSWPSEPGSRTFSTSATTAALSSSTPIPKHLGRTKGCNSD 1539          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Mouse
Match: Ccdc88c (coiled-coil domain containing 88C [Source:MGI Symbol;Acc:MGI:1915589])

HSP 1 Score: 316.235 bits (809), Expect = 2.131e-86
Identity = 421/1592 (26.44%), Postives = 771/1592 (48.43%), Query Frame = 2
Query:  128 VDNELFSWLKLFWTXXXXXXXXXX-----XXGYFLNEVFKEIDPNSVTNEQLVK-CRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQ-----DIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE---------EFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKL--EYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXX-XDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRL-------HNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNL------QLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQ--RKTSQLMK----KISELESE----------------LVKT---------------KTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIE--FEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYE----------EELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLST-------EYEILKKETKSQKSINKSI---NAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSM-PSTKKTNLSILYDEPKGGRN--KFLKKAKEILRR-----NDSKS-----------SVEQEGKNKNENPSRMQRSRSC-----------GTILGSIESIKNSSIGDKSTDYQIDHTDTS------------EKEDFLTDNEESEMDCGAPTPK-LKSSRLSNSD 4471
            + + L +W+K F +       +L       DG FLN++  +IDP   +N+++ K   + V+  I+N  IL++NI+ YY  VLQQ  V+ LP+++ I  DP S K+  EI K + L+LG AVQCERKE FI+     DI T       Q G++ +I+++T + + V +   L+         E  +  MV  LR + ++  D   E    +  + D LQ Q      +     +        S  S+ DK  +A+ELA+ KA+LR+++ EL++K + ++D R +++    E  K K+  ++L  ++R  R  +DELDS RE   R+  +E D  + KEK++++++Y+ R EELRED  ++    + L +++  ++   ++   LE E  +   K  +LE    +   +I KL  EY ++ M +K ++  S+   L  EL++L ++   S  S      ++ E  ++++L+LE EN+SL   +  ++ D +  L +   +  ELE+EN +L       H ++ +LQ   ++E Q   ++E   + L REK+QL   +++++ + +R+I++L QE  +L + +  +RER + ++     ++EKEN  LH ++ E   KLS++E + Q++++    L+ + +K  Q         +L K+N +L KE+ +LK    ++E L+ +   LE+E    +  LD L         Q+ S+  E LE + ++L  EN   RK  + M+    K++++E+E                L+KT                 EN +    +  S +K ++L++EL   + E     R    L+L  + L   E +R+ L+ +  +LE++ K L+KE  R   Q + + + ++    K++  E +   L+      KE    +   +    +L + E+ NR+L +Q+    R  +TLRE+L+ E++ SQ L +++  LS ELE++G+ +      ++     + K  S ++ T+  KEE+I  L++++      +++L ++L+  + ++  L Q  E               ++    + +   +    T  LL +KD  I++ER NA L +E+Q L  Q + L+ +  +    +  Q+ +LQK+ + L      L+ Q + L+ +  TL + N  LS Q T ++    +   +   L + ++QL A   +L + +  L T       EYE L ++    K++++++   + +L   + +L Q K E   L+ L+++L +E+  L    +       EN  L  E + I     +++ E + L+ + K LK  LNN +   ++ + +   L+      +  + K++   E L+R    L EEN  LL Q++ +  QNQ L+ + +++++    E+    DKL+ L+RHKE+LEEKIM+Q+K   P+ KK N  I      G +   K +K  KE  R       DS             S  Q  +++ ENP       +C           G   G ++  + S  G       +D TDTS                F T    + +    P PK L  ++  NSD
Sbjct:   13 LQSPLVTWVKTFGSFGSGHQDNLTLYMDLVDGIFLNQIMLQIDPRP-SNQRINKHVNNDVNLRIQNLSILVRNIKTYYQEVLQQLIVMNLPNVLMIGKDPLSGKSMEEIKKVLLLVLGCAVQCERKEEFIERIKQLDIET-------QAGIVAHIQEVTHNQENVFDLQWLDLPDVAPEELEALSRNMVFHLRRLIDE-RDECTELIVDLTQERDYLQTQQPPSPGK---FSSPDSTPSPTSSLSSEDKQHLAVELADTKARLRRVRQELEEKTEQLADTRHEVDQLVLELQKAKQDNIQLAADARSARAYRDELDSLREKANRVERLEMDLVRCKEKLHDVDFYKARMEELREDNIILIETKAMLEEQLTASRARSDKVHELEKENLQLKSKLHDLELDRDADKKQIEKLLEEYMVLEMAQKQSMKESA--HLGWELEQLSKNADLSDASRKSFVFELNECASSRILKLEKENQSLQSTIQGLR-DTSLALEESSLKYGELEKENQQLSKKAGSLHLQIEKLQTQLEREKQSNQDLETLSEELIREKEQLQSGMEALKADRARQIKDLEQEKGHLHQAVWSLRERPQVNS---TKDVEKENRALHQAVTEAGSKLSQLELEKQQLHRD---LEEAKEKGEQAEALEKELHRLEKENEQLTKEVTSLKAATEKVEALEHQSQGLELENRSLRKSLDTL---------QNVSVQLEGLERDKQQLGQENLELRKMVEAMRFTSAKMAQIETENRQLEREKEELRRDVELLKTLSKKSERLELSYQSVSAENLQLQHSLESSTHKSQALQRELSQLEAERQALRRDLETLQLTHKQLEGAEEDRKALEQEVAQLEKDKKLLEKEARRLWQQVELKDAILDDSAAKLSAAEKESRALD------KELARCRDVGS----KLKELEKDNRDLTKQVTMHTRTLTTLREDLVLEKLKSQQLSSELDKLSQELEKVGLSKDLLLQEDDGHGDGKGKTESALKTTLAMKEEKIVFLEAQVEEKESLSRQLQIELQMIKKEHEQLRQTQEGGDKAQNALKRPPGKVTSHQEKEAWEPSHKEATMELLRVKDRAIELERSNAALQAERQLLKEQLQHLETQNVS----FSSQILTLQKQSAFLQEHTTTLQTQTAKLQVENSTLSSQNAALSAQYTVLQSQQAAKEAEHEGLQQQQEQLAAVYEALLQDHKHLGTLYECQSSEYEALIRQHSCLKTLHRNLELEHKELGERHGDLQQRKAE---LEELEKVLSTEREALEREQKTNAIATSENQRLRGELDRISFLHQQLKGEYEELHAHTKELKTSLNNSQLELSRWQVRFDELKEQHQSMDISLTKMDNHCELLSRLKGNLEEENHHLLSQIQLLSQQNQMLLEQNMESKEQYHEEQKQYIDKLNALRRHKEKLEEKIMDQYKFYDPAPKKKNHWI------GAKALVKLIKPKKEGSRERLKSTTDSPPWQLEPSDPASPSPSQALRSQTENPDNPPSGPNCVEERDTHNGPVGKGPGDLKPKRGSPRGGS-----VDRTDTSTDPAVKSWPSEPGSRTFSTSATTAALSSSTPIPKHLGRTKGCNSD 1546          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Mouse
Match: Ccdc88a (coiled coil domain containing 88A [Source:MGI Symbol;Acc:MGI:1925177])

HSP 1 Score: 113.235 bits (282), Expect = 9.049e-26
Identity = 119/391 (30.43%), Postives = 223/391 (57.03%), Query Frame = 2
Query: 2393 LSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAV---IXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSI 3529
            L ++E E + L+ ++ +LE++ KQL+KEN R + Q  A++    + +N +     KI  LE  K +K  F+++ +   E+  RL + E++N+EL+++   + +   TLRE+L++E++ +Q + N ++ L+ ELE+IG+       + ++ ++++K+LESK+ ST++ ++  KEE+I +L++RL  S   N++L  +L+  +  Y +L+Q+ +EE  V   I V              T+ LL +KD LI+VER NA L +EKQ L +Q + L+ + +  + + +    Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q +++E    S + +   L      L      L+ L+ + ++EYE L  +  + KS +K++
Sbjct:    2 LEQLEKENKSLEQETSQLEKDKKQLEKENKRLRQQ--AEIKDTTLEENNV-----KIGNLE--KENKTLFKEINV-YKESCVRLKELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDRYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRHELKTVKKNYEALKQRQDEERMVQSSIPVSGEDDKWGRESQEATRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENESIMKEREDLKSLYDALIKDHEKLELLHERQASEYESLISKHGTLKSAHKNL 382          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Mouse
Match: Ccdc88c (coiled-coil domain containing 88C [Source:MGI Symbol;Acc:MGI:1915589])

HSP 1 Score: 84.7297 bits (208), Expect = 4.284e-18
Identity = 52/122 (42.62%), Postives = 81/122 (66.39%), Query Frame = 2
Query:  206 GYFLNEVFKEIDPNSVTNEQLVK-CRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQI 565
            G FLN++  +IDP   +N+++ K   + V+  I+N  IL++NI+ YY  VLQQ  V+ LP+++ I  DP S K+  EI K + L+LG AVQCERKE FI+  I +L  E+ Q G++ +I+++
Sbjct:   44 GIFLNQIMLQIDPRP-SNQRINKHVNNDVNLRIQNLSILVRNIKTYYQEVLQQLIVMNLPNVLMIGKDPLSGKSMEEIKKVLLLVLGCAVQCERKEEFIER-IKQLDIET-QAGIVAHIQEL 162          
BLAST of Coiled-coil domain containing 88C vs. UniProt/SwissProt
Match: sp|Q5SNZ0|GRDN_MOUSE (Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2)

HSP 1 Score: 373.244 bits (957), Expect = 1.971e-103
Identity = 410/1436 (28.55%), Postives = 750/1436 (52.23%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEK-FVKMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC---IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ---------MVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXD-QVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRM----------NQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQ--QLQQSTS-ISNETLE------------ENMKELAMENQ---------RKTSQLM----KKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAV---IXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F P++  F+TS  + + K F  + A     L  ++ L              DG FLN+V  +I+P S +  Q V  +   D    I N  IL+K I+ YY   LQQ  ++ LP I+ I  +P S +   E+ K + L+LG AVQC++KE FI+ I  +  +   +  +  +I+++T + + V +   +E     Q         MV  LR + ++  D   E    +  + D +        +      + G+        + S + +++ELA+ KAK+R+L+ EL++K + + D + +LE  + E  +L++  M L +++R  RM +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E        +I +L  + M+++      +     L  EL+++  +   +         +V E T++KLL+LE+EN+SL + + +++    S       +I ++E+EN RL+ KV  L+    +E Q     +   + L +EK QL+  I++++EN+ R+I+ L QENE+L++T+  +R+RS+ S + RV ++EKEN  LH S+ E   KLSK+EF+ ++M           ++  +L++ L+        L K+N  L+K++ NLK+   +LE L+ + S LE E    K  LD+  +  +Q   L++  S +  E LE              M +L +EN+         RK  +LM    KK   LE       TEN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++ +LE++ KQL+KEN R + Q  A++    + +N +        +  L+K +K  F+++ +   E+  RL + E++N+EL+++   + +   TLRE+L++E++ +Q + N ++ L+ ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I +L++RL  S   N++L  +L+  +  Y +L+Q+ +EE  V   I V              T+ LL +KD LI+VER NA L +EKQ L +Q + L+ + +  + + +    Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q +++E    S + +   L      L      L+ L+ + ++EYE L  +  + KS +K++  +     D   Q  K+   L+ L++++++E+  +   ++    +  E   L  E ND L   Y ++  E + L  ++K LK  LNN K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALV-------------DGVFLNQVMLQINPKSES--QRVNKKVNNDASLRIHNLSILVKQIKFYYQETLQQLIMMPLPDILIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIEKI--QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMVSHLRRLIDE-RDEHSETIVELSEERDGVHFLPHASSSAQSPCGSPGMKR------TESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQIEVELKRLQQENMNLLSDARSARMYRDELDALREKAVRVDKLESELSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELAEAPQKSLGHEVNELTSSKLLKLEMENQSLTKTVEELRSTADSAAGSTS-KILKVEKENQRLNKKVEILENEIIQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETCGKLSKIEFEKRQMKKELELYKEKGERAEELENELN-------HLGKENELLQKKITNLKITCEKLETLEQENSELERENRKFKKTLDSFKNLTFQLESLEKENSQLDEENLELRRSVESLKCASMRMAQLQLENKELESEKEQLRKGLELMRASFKKTERLEVSYQGLDTENQRLQKALENSNKKIQQLESELQDLEMENQTLQKSLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKRLRQQ--AEIKDTTLEENNVK-------IGNLEKENKTLFKEINV-YKESCVRLKELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDSRYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRHELKTVKKNYEALKQRQDEERMVQSSIPVSGEDDKWGRESQEATRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENESIMKEREDLKSLYDALIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHKDLEDRYNQLLKQKGQLEDLEKMIKTEQEKMLLESKNHEVVASEYKKLCGE-NDRLNYTYSQLLKETEILQMDHKNLKSVLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITL 1398          
BLAST of Coiled-coil domain containing 88C vs. UniProt/SwissProt
Match: sp|Q3V6T2|GRDN_HUMAN (Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2)

HSP 1 Score: 355.91 bits (912), Expect = 6.836e-98
Identity = 399/1429 (27.92%), Postives = 749/1429 (52.41%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEK-FVKMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC---IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ-----MVKQLRCVTEQWEDSFIEDTKAILS---QNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXD-QVIEKTNAKLLRLEIENRSLLEKLSDIKFD-DTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKS--YQDNLQ-LSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETL---EEN----------------MKELAMENQRKTS---QLMKKISELESELVKTK----------TENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAV---IXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F P++  F+TS  + + K F  + A     L  ++ L              DG FLN+V  +I+P      Q V  +   D    + N  IL++ I+ YY   LQQ  ++ LP+++ I  +P S +   E+ K + L+LG AVQC++KE FI+ I  +  +   +  +  +I+++T + + V +   +E     Q     ++K +    ++  D   E ++ I+    + D L        +      + G+        + S + +++ELA+ KAK+R+L+ EL++K + + D + +LE  + E  +L++  M L +++R  RM +DELD+ RE  +R+  +E++  + KE+++++E+Y+ R EEL+ED  V+    + L D++E  +   ++   LE E  +   K  ++E        +I +L  + M+++      +     L  EL+++  +   S         +V E T+++LL+LE+EN+SL + + +++   D+ E N  K  I ++E+EN RL  KV  L+    +E Q     +   + L +EK QL+  I++++EN+ R+I+ L QENE+L++T+  +R+RS+ S + RV ++EKEN  LH S+ E + KLSK+EF+ +++ ++        +++   ++ L  L K+N  L+K++ NLK+   ++E L+ + S LE E  +L   +  +     Q  S+  E     EEN                M +L +EN+   S   QL K +  L++   KT+           EN++  + +  S  KI+ LE EL+  + E     +   +LK++ + L ++E E + L+ ++ +LE++ KQL+KEN R + Q  A++    + +N +        +  L+K +K   +++ +   E+  RL + E++N+EL+++   + +   TLRE+L++E++ +Q + N ++ L+ ELE+IG+        E   ++ ++K+LESK+ ST++ ++  KEE+I +L++RL  S   N++L  +L+  +  Y +L+Q+ +EE  V     +    +         T+ LL +KD LI+VER NA L +EKQ L +Q + L+ + +  + + +    Q  SLQ++++ L   N KL+++ STL SQ  +L   N  L  Q +++E    S + +   L      L      L+ L+ + ++EYE L  +  + KS +K++  +     D   Q  K+   L+ L+++L+ E+  +    +   ++  E   L  E ND L   Y ++  E + L  ++K LK  LNN K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ + ++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALV-------------DGVFLNQVMLQINPK--LESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI--QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKR------TESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASK--ILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEKGERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKMAQLQLENKELESEKEQLKKGLELLKASFKKTERLEVSYQGLDIENQRLQKTLENSNKKIQQLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKRLRQQ--AEIKDTTLEENNVK-------IGNLEKENKTLSKEIGI-YKESCVRLKELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDSRYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSSPPISGEDNKWERESQETTRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENESVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHRDLEDRYNQLLKQKGQLEDLEKMLKVEQEKMLLENKNHETVAAEYKKLCGE-NDRLNHTYSQLLKETEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITL 1398          
BLAST of Coiled-coil domain containing 88C vs. UniProt/SwissProt
Match: sp|Q9P219|DAPLE_HUMAN (Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3)

HSP 1 Score: 355.525 bits (911), Expect = 1.014e-97
Identity = 440/1609 (27.35%), Postives = 786/1609 (48.85%), Query Frame = 2
Query:  140 LFSWLKLFWTXXXXXXXXXXX-----XGYFLNEVFKEIDPNSVTNEQLVK-CRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQ-----DIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE---------EFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNS--DKT-MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXX-XDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRM----------NQKCNKLDSSLDKSYQDNLQLSKK------------------------NAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALV------SEYYQQLQQSTSISNETLEENMKELAMENQRKTSQLMKKISE----LESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEE--------ELAVIXXXXXXXXXXXXXPSF---TQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSL-------QKLNNQLSTEYEILKKETKSQKSINKSI---NAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSM-PSTKKTN--------LSILYDEPKGGRNKF---LKKAKEILRRNDSKS-SVEQEGKNKNENPSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQI----DHTDTSEKEDFLTDNEESEMDCGAPTPKLKSSRLSNSDTYSMISSISQQESFVSNSTKLI--PGSMSIYDRDEN--EKSQNKEIYNYLQ 4612
            L +W+K F         +L       DG FLN++  +IDP   TN+++ K   + V+  I+N  IL++NI+ YY  VLQQ  V+ LP+++ I  DP S K+  EI K + L+LG AVQCERKE FI+     DI T       Q G++ +I+++T + + V +   LE         E  +  MV  LR + +Q  D   E    +  + D LQ Q          +K+   D+     SS S  DK  +A+ELA+ KA+LR+++ EL+DK + + D R +++    E  K+K+  ++L  ++R  R  +DELDS RE   R+  +E +  + KEK++++++Y+ R EELRED  ++    + L +++   +   ++   LE E  +   K  +LE    +    I +L  + M ++      ++  + L  EL++L ++   S  S      ++ E  ++++L+LE EN+SL   +  ++ D +  L +   +  ELE+EN +L  K+ +LQ   ++E Q   ++E   + L REK+QL  D+++++ + +R+I++L QE ++L+  +  +RERS+ S++ R+ ++EKEN  LH ++ E N KLS++EF+ +++           ++  KL+  L +  ++N +L++K                        N  L K L  L+    +LE L+     L+ E L+L  LV      S    Q+++     N+ LE   +EL     RK   L+K + +    LE        EN +  + +  S +K ++LE EL   + E     R    L+LA   L   E +R+ L+ +  +LE++ K L+KE  R   Q + + + ++    K++ +E +   L+      KE    +  A     +L + E+ NR+L +Q+    R  +TLRE+L+ E++ SQ L +++  LS ELE++G+        +   ++ K+KILE +  S ++ T+  KEE+I  L++++      N++L  +L+  + +  +L Q   E        +        +   K    P     T  LL +KD  I++ER NA L +EKQ L  Q + L+ +       +  Q+ +LQK+ + L   N  L+ Q + L+ +  TL + +  L+ Q T ++ +  +   +  SL + ++QL A   +L         L+ + S EYE L ++    K++++++   + +L   + ++L+ K E   L+  +++L +E+  L    R       EN  L  E + +    ++++ E + L+ + K LK  LNN +   N+ + +   L+      +  + KL+   E L+R    L EEN  LL Q++ +  QNQ L+ + ++N++    E+    DKL+ L+RHKE+LEEKIM+Q+K   P  KK N        + ++  + +G R +    +      L  +D  S +  Q  +++ ENP     + + G+         N S+G    D +      H  + ++ D  TD                + R   S+  S   S S   +  SNST +   PG    Y+ D+N  E S   E+ N+ Q
Sbjct:   17 LVTWVKTFGPFGSGSQDNLTMYMDLVDGIFLNQIMLQIDPRP-TNQRINKHVNNDVNLRIQNLTILVRNIKTYYQEVLQQLIVMNLPNVLMIGRDPLSGKSMEEIKKVLLLVLGCAVQCERKEEFIERIKQLDIET-------QAGIVAHIQEVTHNQENVFDLQWLELPDVAPEELEALSRSMVLHLRRLIDQ-RDECTELIVDLTQERDYLQAQHPPSP-----IKSSSADSTPSPTSSLSSEDKQHLAVELADTKARLRRVRQELEDKTEQLVDTRHEVDQLVLELQKVKQENIQLAADARSARAYRDELDSLREKANRVERLELELTRCKEKLHDVDFYKARMEELREDNIILIETKAMLEEQLTAARARGDKVHELEKENLQLKSKLHDLELDRDTDKKRIEELLEENMVLEIAQKQSMNESAHLGWELEQLSKNADLSDASRKSFVFELNECASSRILKLEKENQSLQSTIQGLR-DASLVLEESGLKCGELEKENHQLSKKIEKLQTQLEREKQSNQDLETLSEELIREKEQLQSDMETLKADKARQIKDLEQEKDHLNRAMWSLRERSQVSSEARMKDVEKENKALHQTVTEANGKLSQLEFEKRQLHRDLEQAKEKGERAEKLERELQRLQEENGRLARKVTSLETATEKVEALEHESQGLQLENRTLRKSLDTLQNVSLQLEGLERDNKQLDAENLELRRLVETMRFTSTKLAQMERE----NQQLEREKEEL-----RKNVDLLKALGKKSERLELSYQSVSAENLRLQQSLESSSHKTQTLESELGELEAERQALRRDLEALRLANAQLEGAEKDRKALEQEVAQLEKDKKLLEKEAKRLWQQVELKDAVLDDSTAKLSAVEKESRALD------KELARCRDAAG----KLKELEKDNRDLTKQVTVHARTLTTLREDLVLEKLKSQQLSSELDKLSQELEKVGLNRELLLQEDDSGSDTKYKILEGRNESALKTTLAMKEEKIVLLEAQMEEKASLNRQLESELQMLKKECETLRQNQGEGQHLQNSFKHPAGKTAASHQGKEAWGPGHKEATMELLRVKDRAIELERNNAALQAEKQLLKEQLQHLETQNVT----FSSQILTLQKQSAFLQEHNTTLQTQTAKLQVENSTLSSQSAALTAQYTLLQNHHTAKETENESLQRQQEQLTAAYEALLQDHEHLGTLHERQSAEYEALIRQHSCLKTLHRNLELEHKELGERHGDMLKRKAE---LEEREKVLTTEREALQQEQRTNALAMGENQRLRGELDRVNFLHHQLKGEYEELHAHTKELKTSLNNAQLELNRWQARFDELKEQHQTMDISLTKLDNHCELLSRLKGNLEEENHHLLSQIQLLSQQNQMLLEQNMENKEQYHEEQKQYIDKLNALRRHKEKLEEKIMDQYKFYDPPPKKKNHWIGAKALVKLIKPKKEGSRERLKSTVDSPPWQLESSDPASPAASQPLRSQAENPD----TPALGSNCAEERDAHNGSVGKGPGDLKPKRGSPHRGSLDRTDASTD---------------LAMRSWPSELGSRTCSTSATTTAPSNSTPIARHPGRTKGYNSDDNLCEPSLEFEVPNHRQ 1565          
BLAST of Coiled-coil domain containing 88C vs. UniProt/SwissProt
Match: sp|Q6VGS5|DAPLE_MOUSE (Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 3.125e-87
Identity = 421/1585 (26.56%), Postives = 770/1585 (48.58%), Query Frame = 2
Query:  128 VDNELFSWLKLFWTXXXXXXXXXX-----XXGYFLNEVFKEIDPNSVTNEQLVK-CRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQ-----DIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE---------EFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKL--EYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXX-XDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNL------QLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQ--RKTSQLMK----KISELESE----------------LVKT---------------KTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIE--FEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYE----------EELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLST-------EYEILKKETKSQKSINKSI---NAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSM-PSTKKTNLSILYDEPKGGRN--KFLKKAKEILRR-----NDSKS-----------SVEQEGKNKNENPSRMQRSRSC-----------GTILGSIESIKNSSIGDKSTDYQIDHTDTS------------EKEDFLTDNEESEMDCGAPTPK-LKSSRLSNSD 4471
            + + L +W+K F +       +L       DG FLN++  +IDP   +N+++ K   + V+  I+N  IL++NI+ YY  VLQQ  V+ LP+++ I  DP S K+  EI K + L+LG AVQCERKE FI+     DI T       Q G++ +I+++T + + V +   L+         E  +  MV  LR + ++  D   E    +  + D LQ Q      +     +        S  S+ DK  +A+ELA+ KA+LR+++ EL++K + ++D R +++    E  K K+  ++L  ++R  R  +DELDS RE   R+  +E D  + KEK++++++Y+ R EELRED  ++    + L +++  ++   ++   LE E  +   K  +LE    +   +I KL  EY ++ M +K ++  S+   L  EL++L ++   S  S      ++ E  ++++L+LE EN+SL   +  ++ D +  L +   +  ELE+EN +L  K+ +LQ   ++E Q   ++E   + L REK+QL   +++++ + +R+I++L QE  +L + +  +RER + ++     ++EKEN  LH ++ E   KLS++E + Q++++    L+ + +K  Q         +L K+N +L KE+ +LK    ++E L+ +   LE+E    +  LD L         Q+ S+  E LE + ++L  EN   RK  + M+    K++++E+E                L+KT                 EN +    +  S +K ++L++EL   + E     R    L+L  + L   E +R+ L+ +  +LE++ K L+KE  R   Q + + + ++    K++  E +   L+      KE    +   +    +L + E+ NR+L +Q+    R  +TLRE+L+ E++ SQ L +++  LS ELE++G+ +      ++     + K  S ++ T+  KEE+I  L++++      +++L ++L+  + ++  L Q  E               ++    + +   +    T  LL +KD  I++ER NA L +E+Q L  Q + L+ +  +    +  Q+ +LQK+ + L      L+ Q + L+ +  TL + N  LS Q T ++    +   +   L + ++QL A   +L + +  L T       EYE L ++    K++++++   + +L   + +L Q K E   L+ L+++L +E+  L    +       EN  L  E + I     +++ E + L+ + K LK  LNN +   ++ + +   L+      +  + K++   E L+R    L EEN  LL Q++ +  QNQ L+ + +++++    E+    DKL+ L+RHKE+LEEKIM+Q+K   P+ KK N  I      G +   K +K  KE  R       DS             S  Q  +++ ENP       +C           G   G ++  + S  G       +D TDTS                F T    + +    P PK L  ++  NSD
Sbjct:   13 LQSPLVTWVKTFGSFGSGHQDNLTLYMDLVDGIFLNQIMLQIDPRP-SNQRINKHVNNDVNLRIQNLSILVRNIKTYYQEVLQQLIVMNLPNVLMIGKDPLSGKSMEEIKKVLLLVLGCAVQCERKEEFIERIKQLDIET-------QAGIVAHIQEVTHNQENVFDLQWLDLPDVAPEELEALSRNMVFHLRRLIDE-RDECTELIVDLTQERDYLQTQQPPSPGK---FSSPDSTPSPTSSLSSEDKQHLAVELADTKARLRRVRQELEEKTEQLADTRHEVDQLVLELQKAKQDNIQLAADARSARAYRDELDSLREKANRVERLEMDLVRCKEKLHDVDFYKARMEELREDNIILIETKAMLEEQLTASRARSDKVHELEKENLQLKSKLHDLELDRDADKKQIEKLLEEYMVLEMAQKQSMKESA--HLGWELEQLSKNADLSDASRKSFVFELNECASSRILKLEKENQSLQSTIQGLR-DTSLALEESSLKYGELEKENQQLSKKIEKLQTQLEREKQSNQDLETLSEELIREKEQLQSGMEALKADRARQIKDLEQEKGHLHQAVWSLRERPQVNS---TKDVEKENRALHQAVTEAGSKLSQLELEKQQLHRD---LEEAKEKGEQAEALEKELHRLEKENEQLTKEVTSLKAATEKVEALEHQSQGLELENRSLRKSLDTL---------QNVSVQLEGLERDKQQLGQENLELRKMVEAMRFTSAKMAQIETENRQLEREKEELRRDVELLKTLSKKSERLELSYQSVSAENLQLQHSLESSTHKSQALQRELSQLEAERQALRRDLETLQLTHKQLEGAEEDRKALEQEVAQLEKDKKLLEKEARRLWQQVELKDAILDDSAAKLSAAEKESRALD------KELARCRDVGS----KLKELEKDNRDLTKQVTMHTRTLTTLREDLVLEKLKSQQLSSELDKLSQELEKVGLSKDLLLQEDDGHGDGKGKTESALKTTLAMKEEKIVFLEAQVEEKESLSRQLQIELQMIKKEHEQLRQTQEGGDKAQNALKRPPGKVTSHQEKEAWEPSHKEATMELLRVKDRAIELERSNAALQAERQLLKEQLQHLETQNVS----FSSQILTLQKQSAFLQEHTTTLQTQTAKLQVENSTLSSQNAALSAQYTVLQSQQAAKEAEHEGLQQQQEQLAAVYEALLQDHKHLGTLYECQSSEYEALIRQHSCLKTLHRNLELEHKELGERHGDLQQRKAE---LEELEKVLSTEREALEREQKTNAIATSENQRLRGELDRISFLHQQLKGEYEELHAHTKELKTSLNNSQLELSRWQVRFDELKEQHQSMDISLTKMDNHCELLSRLKGNLEEENHHLLSQIQLLSQQNQMLLEQNMESKEQYHEEQKQYIDKLNALRRHKEKLEEKIMDQYKFYDPAPKKKNHWI------GAKALVKLIKPKKEGSRERLKSTTDSPPWQLEPSDPASPSPSQALRSQTENPDNPPSGPNCVEERDTHNGPVGKGPGDLKPKRGSPRGGS-----VDRTDTSTDPAVKSWPSEPGSRTFSTSATTAALSSSTPIPKHLGRTKGCNSD 1539          
BLAST of Coiled-coil domain containing 88C vs. UniProt/SwissProt
Match: sp|P85120|DAPLE_XENLA (Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 1.329e-84
Identity = 428/1529 (27.99%), Postives = 765/1529 (50.03%), Query Frame = 2
Query:  113 KMTATVDNELFSWLKLFWT-----XXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKC--RSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE----------EFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNG--IVSYSSNSDKT-MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDD-TSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFD---MQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQQLQQSTSISNETLEENMKELAMEN--------------------QRKTSQLMKKISELES--ELVKT---------------KTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXX---XXXXXXXXXXXPSFTQ-------------------HLLDLKDDLIKVERKNAQLDSEK-------QHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQL-------STEYEILKKETKSQKSINKSI---NAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY---KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPST--KKTNLSILYDEPKGGR--NKFLKKAKEILRRN-DSKSSVEQEGKNKNE---NPSRMQRSRSCGTILGSIESIKNSSIG 4333
            +M   +++ L +W+K F          +  Y  L DG FLN++  +IDP   +N+++ K     +   ++N  IL+++I+ YY  VLQQ  V+ LP+++ I  DP + K+  E+ K + L+LG AVQCERKE +I+  I +L  E+ Q G++ +I+++T + + V +   LE            S    +   R + E+  D   E    +  + D LQ Q          +K+   D    +VS+ S+ DK  +A+ELAE KAKLR+++ EL++K++++ D + ++E    E  K+K+   +L +E+R  R  +DE+DS +E   ++  +E +  + KEK++++++Y+ R +ELRED  ++    S L +++   +   ++   LE E  +   K  +LE    S    I +L  + M ++      ++  ++L  EL +L +S   S    S   ++ E T++K+L+LE EN+SL   + D++    T E   LK +  E E+EN +L  K+  L Q  ++E Q  +++E   + L +EK QL   +++++    R+I+EL QEN++L +T+  +R+RS+ S + RV ++E EN  LH ++ + + K++++E++   +Q+   +  +    LDK  ++  +L K+N  L K++ ++K+ + +++ L+ +  +LE E    K  LD L         Q+ +I  E LE   K+L  EN                    +R+ ++L K+  EL+   EL+K                  EN +  + ++    KI  LE+EL  ++ E     R   ++K+  + L  ME E +  + + ++LE++ K L KE+ R   Q + + + ++    K+ ++E +   LE      KE   L+  + +      D ER+N++L+QQ+  +KR  +TLRE+L+ E++ +Q + +++  LS ELE+IG+        E    E+K+K+LE+K+ ST++ T+  KE +I +L+              MK+EE     +SL Q+ + EL  I      +  + +     S+TQ                    LL  KD  I++ER NA L +EK       QHL S   +L  +M            +LQK+ + L   N  L+ Q + L+ +  T  +   +L +QI+  +  L +   +   L + K+ L     SL + + QL       S EYE +  +  S KS  KS+   +  L  +   L+++KKE   L+ L  +L+ E++ L    R+     EEN  L   K D+ +  +   +++ E  SL+++ K +K  LNN +   N+ + +   L+      +  + KL+   E L R    L EEN  LL Q++ +  QNQ L+ ++++ ++    E+    DKL  L+R KE+LEEKIM+Q+K    T  KK++ S       G +   K +K  KE  R +  S + V+ +  +  E   +PS M+  R         ES+ NSS+G
Sbjct:    8 QMDHFLESPLVTWVKTFGPCGNENESKLAMYMELVDGVFLNKIMVQIDPRP-SNQRVNKHVNNDVNRRVQNLTILVRHIKAYYQEVLQQLIVMNLPNVLLISKDPLTDKSMEELKKILLLMLGCAVQCERKEEYIER-IKQLDIET-QAGIVSHIQEVTHNQENVFDLQWLELSDMAPEELDSLSRNMALHLKRLIDER--DECKEVIVDLTQERDYLQFQNHPSP-----VKSSSPDTSANMVSHLSSEDKKHLAVELAESKAKLRRIRQELEEKSELLLDTKHEVERLNLELQKIKQENFQLASEARTARTYRDEIDSLKERASKVDRLENELARCKEKLHDVDFYKARMDELREDNMILIETKSMLEEQLAAARTRTDKLHELEKENLQLKSKIHDLELDRYSDKNRIEELLEENMVLEIAQKQSMNESAQLGWELDQLSKSTDLSDARKSFVFELNETTSSKILKLEKENQSLQNIIQDLREASLTLEEGNLKGQ--EWEKENQQLSKKIENLNQQIERERQSSLDLESLSEDLLKEKDQLSQALENIKSQKERQIKELEQENKHLIQTLEAVRQRSQVSTEARVKDIEMENRILHETIKDTSSKMNELEYEKKQLQKAFDQSKEQVEKLDKMEKEVHRLEKQNEILTKKVTSIKIVEEKMQGLEKENEVLEGENIVLKKSLDTL---------QNVTIKLEVLESENKQLDEENLELRRAVEAMRFSCAKSTQIERENNELQKEKEELQKNVELLKALGKKSERLEVSYQGLNDENWRLQQMLDTGNKKINDLEKELHDTEKENKDLQRTLEEMKICNKRLERMEEENKAKEQEMVQLEKDNKILQKESKRLWQQVELKDAILDDNTVKLADLEKENRALE------KEISKLRDLSTKTR----DLERENKDLLQQMTVDKRTLATLREDLVLEKLKTQQMSSELDKLSLELEKIGLNKESMLQDENSNAEKKYKLLENKIESTLKTTLAVKENKIVALE--------------MKIEE----TSSLNQQLQNELNSIKKDIIASKENLRGAAHNSYTQLSSKQDCNSQINGQRETTVELLKFKDRTIELERNNAALQAEKKLFREQLQHLESHNLNLSSQMG-----------TLQKQVTFLQEHNTALQTQTANLQVENATATSQVASLKSQISQFQNQLSARESENEILQQQKEHLRVTHESLLQDHEQLGSLYERQSAEYEGMISQHSSLKSQYKSLEQAHRSLEESYSTLIKHKKE---LEDLDAVLKKEQDVLQQERRKNFVAMEENQKL---KTDLERLNFLHGELQTEYSSLHKHTKEVKTSLNNAQMELNRWQARFDELKEQHQTMDISLTKLDNHCELLTRLKSNLEEENHHLLSQIQMLSQQNQMLLEQSMETKEQYHEEQKQYIDKLHDLRRQKEKLEEKIMDQYKFYDPTPKKKSHWS-------GAKAIAKLIKPKKEPSRESVKSPTDVQSKTMDNAEMAASPSSMRPLRL------QQESLDNSSLG 1457          
BLAST of Coiled-coil domain containing 88C vs. TrEMBL
Match: A0A210QVD6 (Girdin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00580 PE=4 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 2.690e-127
Identity = 424/1360 (31.18%), Postives = 751/1360 (55.22%), Query Frame = 2
Query:  206 GYFLNEVFKEIDPNSVTNEQLVKCRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVIN---CIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKT-MALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEEL--EQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQ---DNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQ---------STSISNETLEENMKEL--------AMENQ-----RKTSQLMK----------KISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPS--FTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLK---DKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKK 4123
            G FLN+V ++IDP   TN+ + +    VD  + NW+ILL+NIR Y++ VLQQ  V++LP++  IC  P +  + +E+ K I LILG AVQCERKE FI D I RL +  +QH ++ +IK++T+  + V++     HLE + T +M   L  V  + +D  +E T  ++ + D  Q+QIQ+                +   +S+ DK    +ELA+ KA++RKL+ EL+DK ++I+DL+DD E  +    KL+   ++L  ++R  R L+DELD  RE   ++ S E++  K+KEK+NELE+Y+ R +ELRED A++    + L +++++  K VE    LE E  +  ++ EE   E+       +I   E   +  ++K N+  S+  E E E  RL+     +    S+S+Q+ E TNAK+LRLE+EN+ LL+K+ + +     E   L     ELE+EN RL  KV +LQ+SN++  Q  +E+E+       E++QL   +++V+E+  R+++EL +EN++L+ T+  +R RSE++ND ++ +LE+EN ++H ++   N  LSK+EF+ +++ +  NK+ +S DK  +   D+  L K+N++L K +  L++   + EE++ + S  EVE  +L   V      LQ+         + ++ N+ L+ +++ L         +EN      R+  QL K          K  ++E +L+    EN++  + +  +  +++ LEQ+    + E     +    LK++ + L E+E    EL  +  +L ++   L KE +R K        S+ +  ++++++ TK   LE    + K+  D Q    +    + +SE++N+EL QQ    KR  + LRE+L+NE++ SQ +KN++  L+ +LER+GI        +   ++ ++K LE+ +   ++ ++  KEE+I +L+SRL  S +RN  L  ++ + + +  SL+Q+YEEE       ++ S  S +  +   T+ + ++KD LI+VER+NA   +E ++L SQ   L     K+ +  +K  +Q  +LQ + + L + N KL+++ STLKS+  TLR+    L + ++ +E      +++   L    +QL      LQ+ + QL++EYE L  E  S KS++KS+  +     D+L  + +  E + H+++  + EK+ L    + L  ++ E  +L +E + +L    ++          NK+LK E N       +LK +       +   E D+  L  K + L + N+ + E+NK LL+Q++S+L  N +L+++ L ++++   EE +  +K+S L+R KERLEEKIM+ +K    +KK
Sbjct:   33 GTFLNDVMQQIDPRP-TNQSVNRQVDDVDARLHNWDILLRNIRGYFVEVLQQLLVLKLPNVGLICRHPENDGSFQELKKAILLILGCAVQCERKEDFI-DGIKRL-DVDVQHAIVEHIKEVTDDTECVLSMEPTEHLETY-TEKMFNHLTRVLRERDD-LVEATSDLVQERDFYQSQIQETPQL-----------NVTPPTSSPDKHHTVVELADAKARIRKLRQELEDKQELITDLKDDQEENKIIVAKLRNENVELIQDARSARSLRDELDILREKFGKVKSYESEITKMKEKLNELEFYKSRVDELREDNAILIETKNMLQEQLDSCHKRVETVIALENELGRYRQQVEEQAKERDTDRQKIQILTEENANLQFEKKTNMNESTNIEKELESARLR----IAGMGGSLSNQLNETTNAKILRLELENQRLLQKVEEARESALIENTTL---TLELEKENQRLAKKVEKLQESNREMSQSQIELEQKLDQFSHEREQLSQTLETVKESADRQVRELERENDHLTNTVETVRARSEQTNDAKLKDLERENKRMHETVIAKNQLLSKLEFENRQVQKSYNKVKASTDKLSELETDSANLEKENSDLHKTIATLQLTCDKFEEIEQENSDFEVENRKLKKNVESLQSALQKMDHLEKEHINLTVDNQKLQRSLESLRNSSSKLVELENDKGMLNREIKQLQKSLEAQRSQQVKHEQMELDLLDLDNENQRLEKSLEMTTKRLQQLEQDNTEMEIENEKLQKSVETLKVSTKRLHELEKTNIELDGEVSRLAKDKSVLTKEKNRLK-------QSIELKDSELDDLTTKHSALERSNRNLKQQIDRQ---KDTAASVKESEKENKELQQQSNLTKRTLAALREDLVNEKVKSQQMKNEMDRLTHDLERVGINKEKLVKADNSQDDSRYKALENMMEDALKKSMEIKEEKIHALESRLEESKKRNIRLQDEMRQLKQECESLKQRYEEESHSRDRHDSASRFSQSGRANNPTKEMFEVKDHLIQVERQNATFMAENKNLKSQTNSLNAQIQKLESQNSKLQNQSLTLQDQFTSLQSHNAKLQVENSTLKSECSTLRSQMSTLQSHLSQLEGEHKHLLENQEELQISHEQLVQDHEQLQQYHEQLASEYEGLISEHGSLKSVHKSMKGENKELKDQLDAFLQGREDVSHVRDRAQREKDALRSEIQSLGGVQMEYEHLREEHSKLLSKHEQLCKNYSDTAGENKHLKTENNTFLTKNAELKTQCDEYREQLHSMEIDVNSLAHKYDTLYQMNQKMEEDNKNLLMQIQSLLNSNHELLSQILNSKEHFAEEEKSYLEKMSDLRRQKERLEEKIMDHYKRQEVSKK 1359          
BLAST of Coiled-coil domain containing 88C vs. TrEMBL
Match: A0A0L8FTV6 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22008084mg PE=4 SV=1)

HSP 1 Score: 433.721 bits (1114), Expect = 1.066e-122
Identity = 439/1456 (30.15%), Postives = 783/1456 (53.78%), Query Frame = 2
Query:  206 GYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDT----KAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKL--EYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFD---DTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSS---LDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQR--KTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIE--------------SKLKLAERNLS---------EMENEREELQTQSLKLE----------------------QNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIE------FEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEV-ALRDKLSKLQRHKERLEEKIMEQFK-SMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQID 4360
            G FL  V  +IDP +V ++       +   I+NW+ L+KNI+ YY+ VLQQ  ++RLP+I  +C +P    +  E+ K + L+LG AVQCERKEYFI+ I T   +  +Q  ++  IK++T+   TV+         TG         +EQ  D ++E +      ++ + D L   + + K + ++ ++    N   +  S     + +ELA+CKAK+R+L+ EL++K +++SD+ D+L+  +S+  K K    ++  E++  R  +DE+D  RE  +++ S E +  K KEK+NELE+ R R +EL+ED  ++    S L ++I N  K ++    LE +  K   + +EL   + +   ++  L  E  L+  ++K+   +   + LE EL    E         S+SDQ+ E +NAK+LRLE+EN+ L +K+ +++ +   ++S LN       E E+EN RL  KV  LQ   K + ++ +E+E+  +    EK++L + I++V+ENT R++ E+ +E E+L+ETI  +RER+EKSND RV ELEKEN  LH  ++E   ++SK++F+ Q++ +  +K+ ++   L++    N  L + N++L+  +  LK+   + E  ++  S LE+E  +L+  +    + LQ S S     +EE++  L +ENQ+  KT + +K  ++   EL     +NEK   ++N+   +I+ L++ +ES + E   Y ++E                L++  R L          E+ENE+ ++  +SLKL                       ++   L+KEN + K+  +A  +        ++E+ +K ++LE D    K+  D    ANE   R+ + E++N++L QQ+   K+  +TLRE+L+NE+I  Q L N+ + L  ELE+IG+         E++E +F+I E+ +   ++     KE++I SL+SRL  S  RN +L  +L   +    SL+Q+ EEE      ++  +S   N+ + T+ +L++KD +++VER NA L +E ++L  Q E +  +++  +N Y    +QL +L ++++  ++ + K+E++  TL++Q  +L+  N  L +Q+ N +     ++  +  L      L +   +LQKL++ L+TEYE L  E  S K+ +KS   ++    D+L    +    +  L+E+LE E+  L   ++ L +L+ + N++ + K D L + Y ++E E + L    K +K E N+ +    +L+   +     +S  + ++ KL  + EA+++ N+ + EEN +LL QMK+++ QNQ+L++E L N K+Q +E   A ++K ++L+R KERLEEKIME +K  + S KK +L              ++KA+ I+                    +R+ R++S  T L + ES  NSS+G  S     D
Sbjct:   37 GVFLTTVMNQIDPQTVYSKVNTNISDVNARIQNWDNLVKNIKAYYLEVLQQILIMRLPNIQLVCREPEKDASFEELKKALLLVLGCAVQCERKEYFIEKIKT--LDIKVQQAIVELIKEVTDDTQTVL--------PTGP--------SEQL-DVYLEKSLNHLNKLIIERDELAEAVSELKQEQEIYQSQIEGNTTWTTGSPEKHHLVVELADCKAKVRRLRQELEEKTELLSDVMDELDDNKSQLQKTKTEYNEIYQEAKTARAYRDEIDMLREKAVKVESYENEILKYKEKLNELEFCRSRIDELKEDNRILVETRSMLEEQISNTYKRMDAVKELERDLMKCKNQMQELTLELDTEKEKVRVLTEENALLEFEKKNR--LQQNTTLEKEL----EEAHTRTSGISLSDQLNETSNAKVLRLELENQLLQQKIEELRENSLLESSALN------LEQEKENKRLSKKVESLQGEMKSQSERCIELEQKTKEFADEKEKLLLMIETVKENTERQLNEVKREKEHLAETISSLRERNEKSNDSRVKELEKENKNLHDKVSETAARISKLDFEYQQLQRANDKMKANCERLNELEHSNTSLERINSDLKNAVSTLKLACDKYETTEEDNSRLEIENKKLNKTI----ESLQLSLSKQEMLIEEHIS-LTLENQKLQKTLESLKGATDKVLEL-----DNEK--DELNR---EIQQLKKTIESQRIERVKYEQMEMDVLDMDNENQKLQKTLEMTTRRLQQLEKDNNDLEVENEKLQISIESLKLSCKKLENKEEENKELDNEIIKLNKDKSALEKENKKLKHVLEATGAH-------LDEITSKHNILEKDYKALKKTLDKNKDANE---RIREFEKENKDLQQQLLVNKKTLATLREDLVNEKIQMQQLLNEREKLGQELEQIGLKREELMKNHESDESRFQIFENMMQDAIKKNTEIKEDKILSLESRLEESKNRNMKLQEELRSVKRDCESLKQRLEEEF-----QDGNTSSVVNISNPTRQILEIKDRVVEVERDNATLLAENKNLKRQLEIIDQQIAKKDNDYHKLQYQLSTLHEQNNTSHSQHAKIEVENKTLQTQCTSLQAQNSTLQSQLNNADLENERNLQRIEELQNKYDSLVSAHETLQKLHDDLTTEYESLISEHGSLKTTHKSSCGEMKDLQDQLSILLRGKNDITKLREMLEKEREQLKVESKSLSNLQMDYNHM-RNKYDNLHTAYERLEKEHQDLGVEYKRIKTEYNDLQLRYTELQGDAAESREQLSNTDLEMTKLATRCEAIDQMNQKMEEENNQLLYQMKTLINQNQELLSEAL-NSKDQHAETAKAYQEKFAELRRQKERLEEKIMEHYKMRLESPKKRSLGA----------TLVRKARGII--------------------TRVHRTKS-KTNLTNSESPDNSSVGSGSCGEAAD 1398          
BLAST of Coiled-coil domain containing 88C vs. TrEMBL
Match: A0A0L8FUM6 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22008084mg PE=4 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 4.058e-120
Identity = 439/1466 (29.95%), Postives = 783/1466 (53.41%), Query Frame = 2
Query:  206 GYFLNEVFKEI----------DPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDT----KAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKL--EYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFD---DTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSS---LDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQR--KTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIE--------------SKLKLAERNLS---------EMENEREELQTQSLKLE----------------------QNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIE------FEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEV-ALRDKLSKLQRHKERLEEKIMEQFK-SMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQID 4360
            G FL  V  +I          DP +V ++       +   I+NW+ L+KNI+ YY+ VLQQ  ++RLP+I  +C +P    +  E+ K + L+LG AVQCERKEYFI+ I T   +  +Q  ++  IK++T+   TV+         TG         +EQ  D ++E +      ++ + D L   + + K + ++ ++    N   +  S     + +ELA+CKAK+R+L+ EL++K +++SD+ D+L+  +S+  K K    ++  E++  R  +DE+D  RE  +++ S E +  K KEK+NELE+ R R +EL+ED  ++    S L ++I N  K ++    LE +  K   + +EL   + +   ++  L  E  L+  ++K+   +   + LE EL    E         S+SDQ+ E +NAK+LRLE+EN+ L +K+ +++ +   ++S LN       E E+EN RL  KV  LQ   K + ++ +E+E+  +    EK++L + I++V+ENT R++ E+ +E E+L+ETI  +RER+EKSND RV ELEKEN  LH  ++E   ++SK++F+ Q++ +  +K+ ++   L++    N  L + N++L+  +  LK+   + E  ++  S LE+E  +L+  +    + LQ S S     +EE++  L +ENQ+  KT + +K  ++   EL     +NEK   ++N+   +I+ L++ +ES + E   Y ++E                L++  R L          E+ENE+ ++  +SLKL                       ++   L+KEN + K+  +A  +        ++E+ +K ++LE D    K+  D    ANE   R+ + E++N++L QQ+   K+  +TLRE+L+NE+I  Q L N+ + L  ELE+IG+         E++E +F+I E+ +   ++     KE++I SL+SRL  S  RN +L  +L   +    SL+Q+ EEE      ++  +S   N+ + T+ +L++KD +++VER NA L +E ++L  Q E +  +++  +N Y    +QL +L ++++  ++ + K+E++  TL++Q  +L+  N  L +Q+ N +     ++  +  L      L +   +LQKL++ L+TEYE L  E  S K+ +KS   ++    D+L    +    +  L+E+LE E+  L   ++ L +L+ + N++ + K D L + Y ++E E + L    K +K E N+ +    +L+   +     +S  + ++ KL  + EA+++ N+ + EEN +LL QMK+++ QNQ+L++E L N K+Q +E   A ++K ++L+R KERLEEKIME +K  + S KK +L              ++KA+ I+                    +R+ R++S  T L + ES  NSS+G  S     D
Sbjct:   37 GVFLTTVMNQITQGFERFNSGDPQTVYSKVNTNISDVNARIQNWDNLVKNIKAYYLEVLQQILIMRLPNIQLVCREPEKDASFEELKKALLLVLGCAVQCERKEYFIEKIKT--LDIKVQQAIVELIKEVTDDTQTVL--------PTGP--------SEQL-DVYLEKSLNHLNKLIIERDELAEAVSELKQEQEIYQSQIEGNTTWTTGSPEKHHLVVELADCKAKVRRLRQELEEKTELLSDVMDELDDNKSQLQKTKTEYNEIYQEAKTARAYRDEIDMLREKAVKVESYENEILKYKEKLNELEFCRSRIDELKEDNRILVETRSMLEEQISNTYKRMDAVKELERDLMKCKNQMQELTLELDTEKEKVRVLTEENALLEFEKKNR--LQQNTTLEKEL----EEAHTRTSGISLSDQLNETSNAKVLRLELENQLLQQKIEELRENSLLESSALN------LEQEKENKRLSKKVESLQGEMKSQSERCIELEQKTKEFADEKEKLLLMIETVKENTERQLNEVKREKEHLAETISSLRERNEKSNDSRVKELEKENKNLHDKVSETAARISKLDFEYQQLQRANDKMKANCERLNELEHSNTSLERINSDLKNAVSTLKLACDKYETTEEDNSRLEIENKKLNKTI----ESLQLSLSKQEMLIEEHIS-LTLENQKLQKTLESLKGATDKVLEL-----DNEK--DELNR---EIQQLKKTIESQRIERVKYEQMEMDVLDMDNENQKLQKTLEMTTRRLQQLEKDNNDLEVENEKLQISIESLKLSCKKLENKEEENKELDNEIIKLNKDKSALEKENKKLKHVLEATGAH-------LDEITSKHNILEKDYKALKKTLDKNKDANE---RIREFEKENKDLQQQLLVNKKTLATLREDLVNEKIQMQQLLNEREKLGQELEQIGLKREELMKNHESDESRFQIFENMMQDAIKKNTEIKEDKILSLESRLEESKNRNMKLQEELRSVKRDCESLKQRLEEEF-----QDGNTSSVVNISNPTRQILEIKDRVVEVERDNATLLAENKNLKRQLEIIDQQIAKKDNDYHKLQYQLSTLHEQNNTSHSQHAKIEVENKTLQTQCTSLQAQNSTLQSQLNNADLENERNLQRIEELQNKYDSLVSAHETLQKLHDDLTTEYESLISEHGSLKTTHKSSCGEMKDLQDQLSILLRGKNDITKLREMLEKEREQLKVESKSLSNLQMDYNHM-RNKYDNLHTAYERLEKEHQDLGVEYKRIKTEYNDLQLRYTELQGDAAESREQLSNTDLEMTKLATRCEAIDQMNQKMEEENNQLLYQMKTLINQNQELLSEAL-NSKDQHAETAKAYQEKFAELRRQKERLEEKIMEHYKMRLESPKKRSLGA----------TLVRKARGII--------------------TRVHRTKS-KTNLTNSESPDNSSVGSGSCGEAAD 1408          
BLAST of Coiled-coil domain containing 88C vs. TrEMBL
Match: A0A2C9KRY7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106059254 PE=4 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 5.676e-111
Identity = 398/1346 (29.57%), Postives = 717/1346 (53.27%), Query Frame = 2
Query:  368 IRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYS--SNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEI-------TKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSS---LDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVE---------KLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQR------------KTSQLMKKISE-----------LESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVI-----XXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENK---YIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQ---LSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKS 4219
            +RLP++  I  +P    +  EI K + LILG AVQCE+KE FI  I+    + + Q  ++  IK+IT+ + TV+     E   +        C  E + D        ++ + D     + D   +     +      +++    S     +ALELAECKAKLR ++ EL+D+ + +SD +D+L+   +    LK     L  E+R  R L+DELD  +E  +++   E +  K KEK+NELE+Y+ R  EL+ED +++    + L D++ N++K +E    LE E  +  ++ E+L Q   S   +I        +LE++  S   +     S  S +++ +  L         + S+S+Q++E ++AK+LRLE+EN+ L  KL++++  +T+ +   +  + ELE+EN RL NKV +LQ +  +  ++ +EIE        E Q++   +++V+EN+ R++ EL +ENE L++T+  I+ER E ++D++V +LE+EN +LH ++   N +L+++EFD +++ +  ++L      L    Q+N    K+  EL +++  L+  + +LE ++ + S L VE          LQL A   E  +Q   S +I ++ L++ ++ L  E+ R            K  Q ++K  E           +E +L+    EN++  + +  +  +++ LE++    +TE    ++    ++L  + L + ENE ++L  +  KL ++   L+KEN + K   D + SS+     K N+++ +  L+      KK  E L+ T+N    ++ + E++N +L+Q++  ++R  +TLRE+L+NE+I SQ L NQ++ L+ ELERIG+       +E   +  ++K LE  +  T++ +   K+E+I SL+ RL  S  RN +L  +L   +++   L+Q+ EEEL         VK       + +P  T+ L  LKD L+++ERKNA+L ++  +L +   DLK+     EN+   +  Q  SLQ  +S L   N KL+++ +T++SQ+ +  +    L NQ++ +E +  +       L    Q L +   SLQ L+ QL+ EYE L  E  S K+I+KS+ ++   LS   D +LQ K   + +  L+E++E E+++L      + +L+   N L ++      +  K+  +   +  ++K +K E NN +    +L+ +++  +  ++  + +  KLE K++A+ + NE +  EN+ LL+Q+K +L QNQDL+T+TL ++ +   EE    +KL++L+R KERLEEKIME +K+  S KK  L  +           + KA+ I+ R   +S
Sbjct:    1 MRLPNVHLISREPLKDSSFAEIRKALLLILGCAVQCEQKEAFIDKIMAM--DITAQTEIVENIKEITDDNQTVLPTQRPETPKS--------C--ETYIDKMFHHLFRLIKERDDCAELVADLGQERDFYMSQAEGKPVINTPQLSPDKHHLALELAECKAKLRHVRQELEDRQEQLSDAKDELKEVLATCAHLKNENAALQQEARITRTLRDELDIVKEKAVKVDVYEKEILKYKEKLNELEFYKARTSELKEDNSILEETKAMLEDQLTNSRKRIETVVELEAELGRYRQQIEQLSQERESDKEKIEYLTEENARLEFEKKSSLSESVSLESELSAVKSRIGNL---------TGSMSEQILETSHAKVLRLELENQRLAAKLAEMR--ETAMIQSAEVSL-ELEKENKRLANKVEKLQANVYESSERMIEIEGQLTSSREETQRVMKVLETVKENSERQVNELERENERLTQTLHTIQERCELTSDVKVKDLERENKRLHETVAAKNSQLTQLEFDHRQLQRSSHQLQEGTQRLKDLEQENQFYEKQIGELHQKVATLEYCEEKLETIEQENSDLSVENRKLKKTVETLQLAAQRREQMEQEHISLTIEHQRLQKTLESLKSESDRALELEAEKDELNKELQQLRKCLEGQKTQKLRQEQMEFDLMDVNNENQRLQKGLEMTNRRLQQLEKDNVQMETENENLNKQLETMRLTAKKLEDKENEVQQLDLELQKLTKDKSALEKENKKLKQSSDLKDSSMEETMTKYNKLDQECKLM------KKSVEKLKETSN----KVKELEKENSQLLQELNTDRRTLATLREDLINEKINSQELNNQLEQLTGELERIGLNTDKMVMVEQSNDANRYKALEVMIEETLKKSNELKDEKIRSLEIRLDESKNRNLKLQDELRSTKSETEVLKQRIEEELETTNLDDDRVKQRLVKTESALP--TKELFQLKDRLVELERKNARLMADNDNLQANNSDLKEHCQKLENQLTSFQSQHASLQGYYSSLQEQNAKLQVEYTTVQSQISSTLSQQDVLKNQMSRLELDYENLSHKHEGLHNVHQSLVSDHESLQHLHQQLTAEYESLVSEHGSMKAIHKSLKSEYKVLSEQMDAMLQGK---DDVNKLREVMEKERDHLKKELMAVGNLQSNYNRLCEDHQQQAAAYDKLSRDYSDVLASHKQIKTEYNNLQLKATELQVELNEAKENLTVADMEFQKLENKMDAVYQINERIENENQALLMQIKQLLNQNQDLLTKTLSSKDHFVEEEKHYLEKLAELRRQKERLEEKIMEHYKNRISPKKRGLGAI----------LVNKARNIMSRGPKRS 1297          
BLAST of Coiled-coil domain containing 88C vs. TrEMBL
Match: A0A2C9KS63 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106059254 PE=4 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 8.050e-111
Identity = 398/1346 (29.57%), Postives = 717/1346 (53.27%), Query Frame = 2
Query:  368 IRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYS--SNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEI-------TKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSS---LDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVE---------KLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQR------------KTSQLMKKISE-----------LESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVI-----XXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENK---YIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQ---LSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKS 4219
            +RLP++  I  +P    +  EI K + LILG AVQCE+KE FI  I+    + + Q  ++  IK+IT+ + TV+     E   +        C  E + D        ++ + D     + D   +     +      +++    S     +ALELAECKAKLR ++ EL+D+ + +SD +D+L+   +    LK     L  E+R  R L+DELD  +E  +++   E +  K KEK+NELE+Y+ R  EL+ED +++    + L D++ N++K +E    LE E  +  ++ E+L Q   S   +I        +LE++  S   +     S  S +++ +  L         + S+S+Q++E ++AK+LRLE+EN+ L  KL++++  +T+ +   +  + ELE+EN RL NKV +LQ +  +  ++ +EIE        E Q++   +++V+EN+ R++ EL +ENE L++T+  I+ER E ++D++V +LE+EN +LH ++   N +L+++EFD +++ +  ++L      L    Q+N    K+  EL +++  L+  + +LE ++ + S L VE          LQL A   E  +Q   S +I ++ L++ ++ L  E+ R            K  Q ++K  E           +E +L+    EN++  + +  +  +++ LE++    +TE    ++    ++L  + L + ENE ++L  +  KL ++   L+KEN + K   D + SS+     K N+++ +  L+      KK  E L+ T+N    ++ + E++N +L+Q++  ++R  +TLRE+L+NE+I SQ L NQ++ L+ ELERIG+       +E   +  ++K LE  +  T++ +   K+E+I SL+ RL  S  RN +L  +L   +++   L+Q+ EEEL         VK       + +P  T+ L  LKD L+++ERKNA+L ++  +L +   DLK+     EN+   +  Q  SLQ  +S L   N KL+++ +T++SQ+ +  +    L NQ++ +E +  +       L    Q L +   SLQ L+ QL+ EYE L  E  S K+I+KS+ ++   LS   D +LQ K   + +  L+E++E E+++L      + +L+   N L ++      +  K+  +   +  ++K +K E NN +    +L+ +++  +  ++  + +  KLE K++A+ + NE +  EN+ LL+Q+K +L QNQDL+T+TL ++ +   EE    +KL++L+R KERLEEKIME +K+  S KK  L  +           + KA+ I+ R   +S
Sbjct:    1 MRLPNVHLISREPLKDSSFAEIRKALLLILGCAVQCEQKEAFIDKIMAM--DITAQTEIVENIKEITDDNQTVLPTQRPETPKS--------C--ETYIDKMFHHLFRLIKERDDCAELVADLGQERDFYMSQAEGKPVINTPQLSPDKHHLALELAECKAKLRHVRQELEDRQEQLSDAKDELKEVLATCAHLKNENAALQQEARITRTLRDELDIVKEKAVKVDVYEKEILKYKEKLNELEFYKARTSELKEDNSILEETKAMLEDQLTNSRKRIETVVELEAELGRYRQQIEQLSQERESDKEKIEYLTEENARLEFEKKSSLSESVSLESELSAVKSRIGNL---------TGSMSEQILETSHAKVLRLELENQRLAAKLAEMR--ETAMIQSAEVSL-ELEKENKRLANKVEKLQANVYESSERMIEIEGQLTSSREETQRVMKVLETVKENSERQVNELERENERLTQTLHTIQERCELTSDVKVKDLERENKRLHETVAAKNSQLTQLEFDHRQLQRSSHQLQEGTQRLKDLEQENQFYEKQIGELHQKVATLEYCEEKLETIEQENSDLSVENRKLKKTVETLQLAAQRREQMEQEHISLTIEHQRLQKTLESLKSESDRALELEAEKDELNKELQQLRKCLEGQKTQKLRQEQMEFDLMDVNNENQRLQKGLEMTNRRLQQLEKDNVQMETENENLNKQLETMRLTAKKLEDKENEVQQLDLELQKLTKDKSALEKENKKLKQSSDLKDSSMEETMTKYNKLDQECKLM------KKSVEKLKETSN----KVKELEKENSQLLQELNTDRRTLATLREDLINEKINSQELNNQLEQLTGELERIGLNTDKMVMVEQSNDANRYKALEVMIEETLKKSNELKDEKIRSLEIRLDESKNRNLKLQDELRSTKSETEVLKQRIEEELETTNLDDDRVKQRLVKTESALP--TKELFQLKDRLVELERKNARLMADNDNLQANNSDLKEHCQKLENQLTSFQSQHASLQGYYSSLQEQNAKLQVEYTTVQSQISSTLSQQDVLKNQMSRLELDYENLSHKHEGLHNVHQSLVSDHESLQHLHQQLTAEYESLVSEHGSMKAIHKSLKSEYKVLSEQMDAMLQGK---DDVNKLREVMEKERDHLKKELMAVGNLQSNYNRLCEDHQQQAAAYDKLSRDYSDVLASHKQIKTEYNNLQLKATELQVELNEAKENLTVADMEFQKLENKMDAVYQINERIENENQALLMQIKQLLNQNQDLLTKTLSSKDHFVEEEKHYLEKLAELRRQKERLEEKIMEHYKNRISPKKRGLGAI----------LVNKARNIMSRGPKRS 1297          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Cavefish
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 323.553 bits (828), Expect = 2.936e-89
Identity = 390/1429 (27.29%), Postives = 729/1429 (51.01%), Query Frame = 2
Query:  296 IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTG-----QMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRV---RCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVE--YRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXX--XXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQ---LSKKNAELEKELVNLKMFKSRLEELQDKFSILEVE--------------KLQLDALVSEYYQ------QLQQST------SISNETLEENMKELAMENQR--KTSQLMKKISE----LESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAV-------IXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYK-IEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYD--EPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRSRSCGTILGSI---ESIKNSSIGDKSTDYQIDHTDTS 4375
            I+N   L++ I+ YY   LQQ  ++ LP+++ +   P +        +   L   A +QCE KE +I+ I T   +   +  +  +I+++T + + V++   LE           + + L    +   D   E  + I+     L  +    +           ++      + S + +++ELA+ KAK+R+L+ EL++K++ + D R +LE  + E  ++++  ++L +++R  R  +DELD+ RE  +R+  +E++  + KE    + +  V     +EL+ED  ++    S L D++E ++   ++   LE E    KA   + E+E+ +     E    E   + M +K +  +     L  EL++L ++      +   S+  +V E T+++LL+LE+EN++LL+ + ++K        +   R+ + E+EN RL  K+ +L+   + + +     E     L +EK QL   +++++EN+ R+++ L QENE+L++T+  +R+RS+ S + RV ++EKEN  LH S+ E + KL+K EF+ +++ +         +KS +  ++   L ++N  L+K + +L +   +++ L+ + + LE E               LQL+AL  E  Q      +L+++T            LE   KEL  E  +  K+ +L+K  S+    LE       +EN++  + +  S  KI+ LE EL+  ++E     R   +LK++ + L ++E E + L+ +S +LE++ KQL+KEN R + Q + + S ++    +I+ +E +   L       KE   L+ + N    R+ D E++N+E+++Q   +K+   TLREEL++E++  Q + N ++ L+ ELE+IG+       + E+++ +FK+LESK+ ST++ ++  KEE+I SL++RL  S   N+EL  +L+  +  Y +L Q+ EEE  V       +    + S         T+ LL +KD LI+VER NA L +EKQ L +Q + L+ + S  + + +    Q  SLQ+ ++ L   N KL+++ STL SQ   +   N  L +Q  + E     +V +   L    + L      L  L+ + + EYE L  +    KS +KS+  Q     D   Q  K+   L+ L+++L++E+  +    +   +   E + L +E ND L + Y+ +  + + L  ++K LK +LNN K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ +T++++     E+    DKL++L+R KE+LEEKIM+Q+K             YD   P+   N    K K+++     K    +  ++    P+R + S   G + G+    +S  +SS+G  S D  + H  +S
Sbjct:   54 IQNLSTLIRRIKTYYQETLQQLVMMPLPNVLVLGRTPLT-------GRLCVLTFLACLQCEEKEEYIERIQT--LDFDTKAAIASHIQEVTHNQENVLDLQWLEGGEAPPEDLDSLSRNLAFHLKHLVDERDEQLETIVE----LTQERDCGQYSPPAPSAQSPNDSPSMRRTESRQHLSVELADAKAKIRRLRQELEEKSEQLMDCRQELENLEKELKRIQQENLQLLSDARSARAYRDELDALREKAIRVDKLESEVGRYKESFICIYHKSVIFGNMQELKEDNQILLETKSMLEDQLEGSRARSDKLHELEKENLQLKAKIHDMEMERDMDRKRIEELLEENLTLEMAQKQS--MDESLHLGWELEQLSKTTPELTEVPQKSLGHEVNELTSSRLLKLEMENQALLKTVEELK-----NCGEASTRLVKAEKENQRLCQKLDQLESEVRVDRESLRSAENLSSDLMKEKAQLQKTLETLRENSERQVKGLEQENEHLNQTVASLRQRSQVSAEARVKDVEKENRVLHDSIKETSSKLNKFEFERKQLRKDLEYYKEKGEKSEELEMEVHRLERENEGLQKRVASLSITCEKVDSLEKENTELESESRKLKKKIDALRNTALQLEALEKENAQLDEENLELRRTTESLRSAGAKAAQLELENKELESEKSQMQKSLELLKASSKKSERLEVSYQGLDSENQRLQKALENSSRKIQQLEGELQDVESENQSLQRTLEELKISSKRLEQLEQENKVLEQESSQLEKDKKQLEKENKRLRQQAEIRDSKLDDDNQRISHLEKENRAL------SKEVSTLKDSYN----RVKDLEKENKEMVKQATIDKKTLVTLREELVSEKLKGQQINNDLEKLTHELEKIGLNKEGLLHDEESSDARFKLLESKLESTLKSSLEIKEEKIASLEARLKESSNLNQELRQELKTVKKNYEALRQREEEERMVHSSPPRVVGDSQSVSKWEKESHEATRELLKVKDRLIEVERNNATLQAEKQALRTQLKQLETQSSNLQAQILALQRQTASLQENNTTLQTQNAKLQVENSTLNSQSAAIGAQNAQLQSQQCSAESERDGAVREREELRTTYELLLRDHEKLAALHERQAAEYEALIGKHGGLKSAHKSLEVQHRDLEDRYNQLLKQKTQLEELEKVLKAEQEKMLSENKSHQATAAEYHKL-KEDNDKLNTTYQQLLKDNEGLQADHKNLKSQLNNAKLEQTRLEAEFSKLKEQYQQLDITSTKLTNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQTMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYK------------FYDPSPPRRRGNWITLKMKKLI-----KPKSRERMRSLTITPTRSESSD--GFLAGTSAFQDSQDSSSMGSGSLDDPLSHKRSS 1432          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Cavefish
Match: ccdc88c (protein Daple [Source:NCBI gene;Acc:103041063])

HSP 1 Score: 324.324 bits (830), Expect = 5.954e-89
Identity = 379/1439 (26.34%), Postives = 727/1439 (50.52%), Query Frame = 2
Query:   62 IIRNFITSNYLKYEK-FVKMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC-IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE---------EFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVE--YRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQ---DNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVE----KLQLDALVSEYYQQLQQSTSISNETLEENMKELAMEN--QRKT------------------SQLMKKISELESELVKTKTENEKCFR-----------------QINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI-------IEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPS----------FTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIH---QLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQL-------STEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSM-PSTKK 4123
            ++ NF+ S  + + K F  +++ +D++L  +++L              DG FL+++   IDPN   +    +  + V+  I+N   ++++I+ YY   LQQ  ++ LP+++TI  DP S K+  E+ + + L+LG AVQCERKE  I+ I  +L +   Q  ++ +I+++T + + V++   LE         +  +  M   LR + ++  D   E    +  + D LQ+             +    + +   S    + +A+ELA+ KAKLR+ + EL++K + + D +++L+    E  KLK+   +L  E+R +R  +DE+D+ RE   R+  +E +  + KEK++++ +Y+ R EELRED   +    + L +++   +   ++   LE E  + ++   + E+++       E    E  L+ + +K ++  S  + L  EL++L ++   +    S   ++ E  +++LL+LE EN+SL   + +++    S L + +    ELE EN  L  K+ RLQ    +E Q   ++E   + L +EKQ+L+  +++VQ +  ++I EL +E E+L++ +  +R+R++  ++ RV E+E EN  LH +++E   KL+++E + ++  ++   L    ++  +   +  +L +   +L++EL +L++   R E L+ + + LE +    K Q DA          Q+ ++   TLE++ ++L  EN  QR+                   S+L ++  EL+  L + + + ++C R                  ++ S  KI+ LE  L  S+++     +   +++ A     E E +R  ++ +  + E+  KQL+KE HR + Q +A+ +++     +++ ME +   L       +E   L+  A     R+ + E+ N++L +Q+  +KR  +TLREEL+NE++  Q   N+++ LS ELE+IG+        E    + K+KILE+K+ ST++ T+  +EE+I SL+SRL  S   N++L   L   +    +L Q+ EEE A   +      +     S           T  LL LKD LI VE+ NA L +EK  L  Q + L  + S    + +    Q  +LQ++++ L+    KL+++ STL SQ       N +L +Q   ++  L ++  +  +  + K+++ A   S+   + +L       + EYE L  +  + KS  +++  +  +  ++ +   K+ ++++ L+  L+ E+ +L +  R+   + EEN  L ++ + +  +  ++  E   L    K LK  LN  +   N+ + +   L+      +  + KL+   E L R    L EEN  LL Q++ +  QNQ L+  T+++++    E+    DKL+ L+R KE+LEEKIM+Q+K   P+ KK
Sbjct:    8 LMSNFMESPLVVWVKTFGPLSSNLDDKLSMFMELV-------------DGVFLHKIMTHIDPNPTNHRVNKQVNNDVNLRIQNLSTVIRHIKNYYQENLQQLILMTLPNVLTIAKDPLSGKSMEEMKRLLLLLLGCAVQCERKEEIIEKI--KLLDIETQAAIVSHIQEVTHNQENVLDLQWLEVGELPAEELDPLSRNMAFHLRKLIDE-RDECSELVLELTQERDYLQSLQPPSPVN---FSSPERSSQLAVLSKEDRQHLAVELADTKAKLRRSRQELEEKTEHLIDTKNELDRLDVEMQKLKQENTQLLAEARSVRAYRDEVDALRERAGRVDRLETELARFKEKLHDVHFYKARVEELREDNMTLLETKAMLEEQLSTARGRSDKLHELEKENLHLRSKLHDMEIDRDSDKKRLEELLEENMLLEISQKQSMNES--AHLGWELEQLSKNNEVNEARKSFVFELNESASSRLLKLEKENQSLQSTIQELREASLS-LEEGQLHAMELERENQGLSKKIERLQTQLDQEKQTTQDMESLGEELLKEKQKLEKTLETVQADKDKQISELEKEKEHLNQAVSSLRKRAQVDSEARVREVETENRVLHQTISETGGKLARLEAEKRQATKELEGLRERGERCVELEREVARLERGREQLQRELASLRIASERTEALERENATLEQDNRRLKKQADAA---------QNANVRLATLEKDRRQLEEENLEQRRALDGLRPAAARLAQLQLEHSELERERQELQGTLEELRAQAKRCERLDLSCNSLSQENQRLQKSLDSSSAKIQDLEGRLRESESQSKEVQKELVEVRQAGSRAEEAEKQRRSMEQELGQAEKERKQLEKEAHRLRRQLEAKEAALEESSLRLSSMEKEGTAL------NRELARLREAAG----RVKELEKDNKDLHKQVTIDKRTLATLREELVNEKLRVQQQCNELEKLSHELEKIGLNREKLLQEEHSCEDNKYKILETKIESTLKKTLELREEKIQSLESRLEESSSLNQQLRTDLTTVKKTLEALRQRQEEEAAHSEISQKSVEQGRCGSSQEKWETEQREATAELLKLKDRLIDVEKNNAALQTEKHLLKEQLKQLDSQNSQLNAQTLALQKQAATLQEQNTALHKETAKLQVENSTLSSQ-------NASLLSQYGALQTQLQTAEAEAEAQQRQKEEVRAARDSVTHDHERLLAVHERQAAEYEQLISQHATLKSNQRALEQEHKALENKYVLLLKQKDAMEALEASLQKERESLGEEIRKNTLILEENRGLREDMDRLSHTHSQLRQEYDGLQHQTKELKTSLNESQLELNRWQARFDQLKEQHQGLDISMTKLDNHCELLTRLKGNLEEENHHLLSQIQMLSQQNQTLLERTMESKELYHEEQKQYIDKLNALRRQKEKLEEKIMDQYKFYDPTPKK 1398          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Cavefish
Match: ccdc88b (girdin-like [Source:NCBI gene;Acc:103039284])

HSP 1 Score: 103.219 bits (256), Expect = 1.991e-21
Identity = 91/326 (27.91%), Postives = 160/326 (49.08%), Query Frame = 2
Query:  206 GYFLNEVFKEIDPNS--------VTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVR-------CEELREDLAVI 1138
            G +LNEV + IDPN         V ++++++       ++N+ IL +++R YY   LQQ  ++ LP++  +  DP +     E+ + + L+LG AVQCE KE FIQ I +   E   Q  L   I+++T+    V+          G +        +    S     + +L+Q DA   +I +     +  K+  V +       N+ + ++++LA+ KAKLR+L+ EL+DK D I D + +++  + E  KL+     L  E R  R L+DELD  RE   R   ++ + +    ++  +E YR +       C  L+E+ A++
Sbjct:   60 GIYLNEVMRIIDPNPKVEQIYHNVHDDKILR-------VQNFSILNRHLRSYYQENLQQLVLMPLPNVAVLGRDPLTEGAVEELRRLLLLLLGCAVQCETKETFIQQIQSLNIE--TQAALALCIQEVTQDPSAVLP------LQYGDVCGLEGVDMQVLLGSLARQIQTLLAQRDAHLERIVELCEHRESGKSPTVPHS--GLWDNAPEGLSIQLADSKAKLRRLKQELEDKEDQILDYKQEMQTMEEELKKLQCENRALQGEVRVSRGLRDELDCLRERAARAEQLQTELKTCTHRLRSMELYRTQLKEQQQYCASLQENKALL 368          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Cavefish
Match: ccdc88b (girdin-like [Source:NCBI gene;Acc:103039284])

HSP 1 Score: 98.9821 bits (245), Expect = 4.133e-20
Identity = 90/326 (27.61%), Postives = 159/326 (48.77%), Query Frame = 2
Query:  206 GYFLNEVFKEIDPNS--------VTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVR-------CEELREDLAVI 1138
            G +LNEV + IDPN         V ++++++       ++N+ IL +++R YY   LQQ  ++ LP++  +  DP +     E+ + + L+LG AVQCE KE FIQ I +   E   Q  L   I+++T+    V+          G +        +    S     + +L+Q DA   +I +     +  K+  V +       N+ + ++++LA+ KAKLR+L+ EL+DK D I D + +++  + E  KL     +   E R  R L+DELD  RE   R   ++ + +    ++  +E YR +       C  L+E+ A++
Sbjct:   60 GIYLNEVMRIIDPNPKVEQIYHNVHDDKILR-------VQNFSILNRHLRSYYQENLQQLVLMPLPNVAVLGRDPLTEGAVEELRRLLLLLLGCAVQCETKETFIQQIQSLNIE--TQAALALCIQEVTQDPSAVLP------LQYGDVCGLEGVDMQVLLGSLARQIQTLLAQRDAHLERIVELCEHRESGKSPTVPHS--GLWDNAPEGLSIQLADSKAKLRRLKQELEDKEDQILDYKQEMQTMEEELKKL-----QCEGEVRVSRGLRDELDCLRERAARAEQLQTELKTCTHRLRSMELYRTQLKEQQQYCASLQENKALL 363          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Cavefish
Match: hook1 (hook microtubule tethering protein 1 [Source:NCBI gene;Acc:103034745])

HSP 1 Score: 62.003 bits (149), Expect = 6.705e-9
Identity = 46/148 (31.08%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  140 LFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVD-----CIKNWEILLKNIRVYYMLVL-QQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQI 565
            L  WL+ F T+    + + L+ G  + +   +IDP+  +   L + +  V       + N + +L+ I  YY  VL QQ     LP ++ +    HS     E+ + + LILG AV+C+RK+ +IQ I+T   EES+QH +M  I+++
Sbjct:   12 LIVWLQTFNTTAPCKTVNDLTTGAAMAQALHQIDPSWFSENWLARIKEDVGDNMRLKVNNLKKILQIIVDYYNEVLNQQISGFTLPDLVRVA--EHSDPV--ELGRLLQLILGCAVKCDRKQEYIQIIMTL--EESVQHVVMTAIQEL 153          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Sea Lamprey
Match: ccdc88aa (coiled-coil domain containing 88Aa [Source:ZFIN;Acc:ZDB-GENE-100701-2])

HSP 1 Score: 138.658 bits (348), Expect = 1.336e-33
Identity = 169/612 (27.61%), Postives = 307/612 (50.16%), Query Frame = 2
Query: 2372 LKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGI------IEFEANEE-KFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEE--------LAVIXXXXXXXXXXXXXPS----FTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIH---QLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKY-KIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSM---PSTKKTN 4129
            L+++ R L   E     L+ +  ++E+  KQL KE  R + Q + + +       +I E+E           D +         +E+  RL D+ER ++EL++++   K+  +TLRE+L+ E++  Q L N++  LS+ELE+IG+       +  +N++ K+KILES++ ST++ T+  +EE+I++L+SRL  S   N++L  +L+  +  Y +L+Q+ EEE        ++ +  +   +   +   S     T+ LL +KD LI++ER NA L +EKQ L +Q + L+ + +  + + +    Q  SLQ+ ++ L   N KL+++ S + SQ  +L   N +   Q   +E            L    + L      L  L+ + + +YE L  +    KS +++   Q     D      K+   L+ L+ +L +E++ LA  A +  S+  + + L  E ND L   Y  +  E + L  ++K +K +LN  +    +L+ + S L     + +    KL  + E L++    L EEN+ LL           D I   +++++   S ++   DKL++L+R KERLEEKIM+Q++     P  +K+N
Sbjct:   17 LRMSARRLEVAEQAARSLEAEVAQIEKERKQLKKEVWRLRQQAEVREAVAEEAAARIAELE----------VDGRSLSREVARLSESCARLRDAERDSKELLKEVTIGKKTLATLREDLVTEKLQGQQLSNELDKLSNELEKIGLNKERLLQDAHSNDDTKYKILESRIESTLKKTLELREEKISALESRLEESSNLNQQLRQELKTVKKNYEALKQREEEERKSGGGGGVSPLPGRRADALAVSQTQSESREATRELLRVKDRLIEIERNNATLQAEKQALKAQYKQLESQNNHLQTQILALQKQAVSLQEHNTALQTQNAKLQVENSAVSSQSASLMAQNASQQGQQAALEAEAEELARSREHLHATYEALSRDHERLVGLHERQAADYEALIGKHGHLKSAHRATELQHKELEDRYNTLLKQKVQLQELEGVLRAEQDKLAQDASKYESIASDYHRLRDE-NDRLNLTYSHLMKEHEGLQVDHKAIKSQLNGSRLEQARLEAEYSELREHCQQLDVTSAKLSNQCELLSQLKGNLEEENRHLL-----------DQIHRLMESKEQYHSVQMQYIDKLNELRRQKERLEEKIMDQYRFYSLSPPRRKSN 606          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006299.1 (pep scaffold:Pmarinus_7.0:GL477364:187806:194761:1 gene:ENSPMAG00000005694.1 transcript:ENSPMAT00000006299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 9.085e-28
Identity = 101/366 (27.60%), Postives = 182/366 (49.73%), Query Frame = 2
Query:  206 GYFLNEVFKEIDP---NSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHR--------EIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVI--NCIHLEEFS-------TGQMVKQLRCVTEQ---WEDSFIE-----DTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVE 1219
            G  LN+  + IDP   N V ++Q+    S+   ++N   L++ I+ YY         +  PS    C  P++ +  R        E+ K + L+LG AVQCE KE FI+ I T L + S Q  ++ +I+++T++ + V+      LEE         TG ++ QLR +  Q   + D+ +E     D+        AL          ++     G D  +   + +S + +A+ELA+ KAKLR+++ +L+++++ + D R + +   +E  +L+    +L  ++R +R  +DE D   E   R    EAD ++L+E++ +L +Y+ R EEL+ D AV+    + L  ++E  +   +R   LE E
Sbjct:   44 GVVLNDFMQLIDPRPTNHVAHQQVNGDVSLR--VQNLRFLVRRIQSYYQ--------VWTPSHDRQCAGPNARQARRSPSQQGIDEMRKILLLMLGCAVQCEHKEVFIEKI-TEL-DLSTQANIVSHIQEVTQNPENVLEMQWSELEELPRDELQAVTGTLLHQLRNLLRQRDKYADAIVELQQERDSAQTAQTAAALSQGRPGPGAGMRTPIGTGTDAAV---ALDSRQHLAVELADSKAKLRRVRQDLEERSEELLDCRAEAQQLSAELKRLQHESQQLATDARWVRAFRDERDGLLEKAGRAERFEADVERLRERLQDLPFYKARVEELQGDTAVLLETRAVLEQQLEAARARCDRTHELEKE 394          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009976.1 (pep scaffold:Pmarinus_7.0:GL477657:220019:240565:-1 gene:ENSPMAG00000009011.1 transcript:ENSPMAT00000009976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 4.508e-8
Identity = 94/384 (24.48%), Postives = 166/384 (43.23%), Query Frame = 2
Query:  206 GYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEI-------LLKNIRVYYMLVLQ-QAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITE----SHDTVINCIHLEEF------STGQM---------VKQLRC-VTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQ----QSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQS 1261
            G  L++V ++IDP       + + R   D   +W +       +L+ I+ YY  VL  Q     +P +  +      +  H E+ + + L+LG A+ CE K+  I++I+    EES+QH +M  I+++           ++   LE        ST  +         + Q RC V +Q   + +E+  A+L++N+AL  ++   +          VD G  S S          L   +A+L     EL ++N  +   +D+  +Q      E    +E  +++++     ++L+DE+D     ILR  S      ++ +    +E YR R EEL E           L++  E N+  + RA  LE E R+A     +LE S
Sbjct:   36 GVVLSDVLQKIDPGWFDAAWVTRVRK--DVGDSWRLKVSNLKKVLQGIQDYYSEVLGVQVSPACVPDVAAV----GEHADHVEMGRLLQLVLGCAINCENKQEHIENIMQL--EESVQHVVMAAIQELLSREGMGPSVSMSAADLEALENELKRSTDALQETEAEKAEITQ-RCHVLDQQASALLEERNALLAENEALVERLHMLEAGEDC-----VDGGPGSSSRRG-------LLHVQAQL----EELREENFRLEAAKDECRIQNEQLHRELLDAQEKNVEMSSLVEETQILKDEMD-----ILRHSS-----SRVAQLEGTVESYRRRLEELGE-----LRRQVRLLE--ERNEVSLTRALGLEDELRRANATRAQLEIS 377          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Nematostella
Match: EDO31530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXP7])

HSP 1 Score: 117.472 bits (293), Expect = 2.235e-26
Identity = 104/346 (30.06%), Postives = 177/346 (51.16%), Query Frame = 2
Query:  116 MTATVD---NELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDC-----IKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVK-QLRCVTEQWEDSF------IEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRC 1108
            MTA  D   N L +W+  F     I S    +DG FLNEV  EIDP   T   L +    V+      I+N + L+++++ YY   LQQ  ++R P ++TI +DP S  + +E+ K + L+LG AVQ E+KE FI+ I  +  +  +Q  L+  IK+ITE    V+       F   ++V+  L  + E  E+ F      +ED   +++    L  +      + Q +K+    +   S    + K  +  ++  K K+R L  E+++KN ++ +LRD+L   +    KL++   +L+ ++R ++  +DE+D  +    R+  +EAD  K K+K+ +LEY R R 
Sbjct:    1 MTAVGDFLANPLVTWVNTFKNGKFIESVSEFADGVFLNEVMVEIDPTYFT---LTRIHHNVEGDLNIRIQNLDALVRHLKAYYQEKLQQLILLRAPDVVTIAHDPKSDVSLQELIKILLLMLGCAVQSEKKEDFIEKI--KELDFEVQKNLVDCIKEITEKPSNVLT------FRVNELVESPLEHIVEYVENMFYQMGQIVEDRDDLVAMVTHLAFEKDALMQERQNMKSPRPFSPPPSVVQQNAKE-SPSISATKEKIRLLTEEIEEKNVVMQELRDELISNKKLVEKLRQENKQLSQDARWVKAYRDEMDMLKSKADRVEKLEADASKYKDKLRDLEYLRKRS 334          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Nematostella
Match: EDO33979 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQM2])

HSP 1 Score: 53.5286 bits (127), Expect = 5.363e-7
Identity = 49/160 (30.63%), Postives = 73/160 (45.62%), Query Frame = 2
Query:  122 ATVDNELFSWLKLF-WTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVD-----CIKNWEILLKNIRVYYMLVLQQAFV-IRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHD 580
             T+ N L  WL  F        S + L DG  L E   EI P+   +E   K R  +       + N + L++ I  YY  VL        +P I  I           E+ + + LILG AV CE K+ +IQ +I +L EE++QH +M  I+++  + D
Sbjct:    5 VTMCNSLLKWLNTFEGVKAPHSSAEELVDGVALCECLAEIAPDWFDDEWTSKIRKDIGDNRRLRLSNLKKLIRGIHDYYTEVLTMDIAGFPMPDINAIADSADV----SELARLLQLILGCAVNCEDKQEYIQ-VIMQL-EETVQHVVMTAIQELMTARD 158          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Medaka
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:101156523])

HSP 1 Score: 345.125 bits (884), Expect = 1.510e-95
Identity = 406/1444 (28.12%), Postives = 765/1444 (52.98%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEKFV-KMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSV---TNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE----------EFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVE--YRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXX-XXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSE-LNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFD----------MQRMNQKCNKLDSSLDKSYQDNLQLSKKNA----------ELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSI--SNETLEE---NMKELAMEN---QRKTSQLMKKISELESELVKTK----------TENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIG-----IIEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSF-------TQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTND---ELLQYKKEAESL-KHLK---EILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F P++  F+ +  + + + V ++ A+  N+L  +++L              DG +LNE+  EI+P +    TN+++    ++   I+N  IL++ I+ YY   LQQ  ++ LP+++ +  +P S +   E+ K + L+LG AVQCE+KE +I+ I T L  E+ +  +  +I+++T + + V++   LE            S        R V E+  D+ +E    +  + D +Q             ++ G    I    + S + +++ELA+ KAK+R+L+ EL++K++ + D R +LE  + E  +L++   +L +++R  R  +DELD+ RE  +R+  +E+D  + KE+++++E+++ R EEL+ED  ++    + L ++++  +   ++   LE E    K+   + E+E+ +     E    E  ++ M +K ++  S    L  EL++L ++     +   S+ ++V + T+++LL+LE +N++LL+ + +++   ++E ++KL    +++ +EN +L+ K+ RL+     + +     E     L +EK  L+  +++++EN+ R+++ L QEN++LS+T+  +R+RS+   + RV ++EKEN  LH S+ E   KL+K+EF+          M+   ++  +L+  + K  +DN  L KK A           LEKE   L+    RL++   K   L+    QL+AL  E  Q  Q++  +  S E+L        +L  EN   + + SQL + +  L++   KT+          TEN++  + +  S  KI+ LE EL+  +TE     R   +LK++ + L ++E E + L+ +S +LE++ K L+KEN R + Q + + S +    ++I+ +E +      ++   KE     +   ++  R+ + E++N+EL++    +K+   TLREEL++E++ +Q + N ++ L+ ELE+IG     +++ E+++++FK+LESK+ ST++ ++  KEE+I SL++RL  S   N++L  +L+  +  Y +L Q+ EEE  V S              +       T+ LL +KD LI+VER NA L +EK  L SQ + L+ + S  + + +    Q  SLQ+ ++ L   N KL+++ STL SQ   L   N  L +Q + +E     ++ D   L    + L      L  L+ + + EYE L  +    K+ +KS+  Q     D   +LLQ K + E L K+L+   + +  EK +    A Q   L+EEN  L+     +L+         ++L  ++K +K +LN+ K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ +T++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FAPMLEQFMLTPLVCWVRTVGQLKASESNKLSEYIELV-------------DGIYLNEIMLEINPKAAVQRTNKKVNNDPTLR--IQNLSILIRQIKSYYQESLQQLVMMPLPNVLVLGRNPLSEQGLDEMGKLLLLLLGCAVQCEKKEEYIERIQT-LDFET-KAAIASHIQEVTHNQENVMDLQWLENGNVPPEDLDNLSRNLAFHLKRLVDER--DTQLETIVELTQERDCVQLSPLASCTS----QSPGDSPSI--RRTESRQHLSVELADAKAKIRRLRQELEEKSEQLLDTRQELENVEVELKRLQQDNYQLLSDARSARAYRDELDALREKAIRVDKLESDLCRYKERLHDIEFFKARVEELKEDNQILLETKTMLEEQLDGCRTRSDKLHLLEKENLQLKSKIHDMEMERDLDRKRMEELLEENLVLEMAQKQSMDES--LHLGWELEQLSKTPELTEVPQKSLGEEVKDLTSSRLLKLEKDNQALLKTVEELRGAGSAETISKL----AKVNQENQKLNQKLERLESELMADRESLRSAETLSMDLMKEKALLEKTLETLRENSERQLKGLEQENKHLSQTMSSLRQRSQVGAEARVKDVEKENRVLHESICETTAKLNKIEFERKQLRKDLEMMKDKGERAEELEIQIQKLERDNESLLKKVASLGITCEKVSSLEKENTELEAEGRRLKK---KLDALKNVAFQLEALEKENSQLEQENLELRRSAESLRSAGAKAAQLEAENRELESEKSQLKRNLELLKASSKKTERLEVSYQGLDTENQRLQKALENSSKKIQQLEAELQDVETENQTLQRNLEELKISSKRLEQLEQENKNLEQESSQLEKDKKLLEKENKRLRQQAEIRDSKLEDCNHRISSLEKE------NRTMGKEM----IFFKDSCTRVKELEKENKELVKLTNIDKKTLMTLREELVSEKLRTQQINNDLEKLTHELEKIGLTKDRLLDDESSDDRFKLLESKLESTLKSSLEIKEEKIASLEARLQESSNLNQQLRQELKTVKKNYEALRQREEEERMVHSSPPKGGKDPQTDNKWAKESHEATRELLKVKDRLIEVERNNATLQAEKVALRSQLKQLETQSSNLQAQIVALQRQTASLQENNTILQTQNAKLQVENSTLSSQGAALMAQNAQLQSQQSGVEGERDGALKDKEELRATYELLLRDHEKLAALHERQAAEYEALIGKHGGLKTSHKSLEQQHRDLEDKYKQLLQRKGDLEELEKNLRGQQDKMALEKESHEATADQYKMLKEENERLNSSYRQLLKDN-------ENLQLDHKSIKSQLNSAKLEQTKLEAEFSKLKEQYQQLDITSTKLTNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQTMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITL 1398          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Medaka
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:101156523])

HSP 1 Score: 343.584 bits (880), Expect = 4.995e-95
Identity = 406/1444 (28.12%), Postives = 768/1444 (53.19%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEKFV-KMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSV---TNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ-----MVKQL-----RCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVE--YRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXX-XXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSE-LNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFD----------MQRMNQKCNKLDSSLDKSYQDNLQLSKKNA----------ELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSI--SNETLEE---NMKELAMEN---QRKTSQLMKKISELESELVKTK----------TENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIG-----IIEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSF-------TQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTND---ELLQYKKEAESL-KHLK---EILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F P++  F+ +  + + + V ++ A+  N+L  +++L              DG +LNE+  EI+P +    TN+++    ++   I+N  IL++ I+ YY   LQQ  ++ LP+++ +  +P S +   E+ K + L+LG AVQCE+KE +I+ I T L  E+ +  +  +I+++T + + V++   LE  +        + + L     R V E+  D+ +E    +  + D +Q             ++ G    I    + S + +++ELA+ KAK+R+L+ EL++K++ + D R +LE  + E  +L++   +L +++R  R  +DELD+ RE  +R+  +E+D  + KE+++++E+++ R EEL+ED  ++    + L ++++  +   ++   LE E    K+   + E+E+ +     E    E  ++ M +K ++  S    L  EL++L ++     +   S+ ++V + T+++LL+LE +N++LL+ + +++   ++E ++KL    +++ +EN +L+ K+ RL+     + +     E     L +EK  L+  +++++EN+ R+++ L QEN++LS+T+  +R+RS+   + RV ++EKEN  LH S+ E   KL+K+EF+          M+   ++  +L+  + K  +DN  L KK A           LEKE   L+    RL++   K   L+    QL+AL  E  Q  Q++  +  S E+L        +L  EN   + + SQL + +  L++   KT+          TEN++  + +  S  KI+ LE EL+  +TE     R   +LK++ + L ++E E + L+ +S +LE++ K L+KEN R + Q + + S +    ++I+ +E +      ++   KE     +   ++  R+ + E++N+EL++    +K+   TLREEL++E++ +Q + N ++ L+ ELE+IG     +++ E+++++FK+LESK+ ST++ ++  KEE+I SL++RL  S   N++L  +L+  +  Y +L Q+ EEE  V S              +       T+ LL +KD LI+VER NA L +EK  L SQ + L+ + S  + + +    Q  SLQ+ ++ L   N KL+++ STL SQ   L   N  L +Q + +E     ++ D   L    + L      L  L+ + + EYE L  +    K+ +KS+  Q     D   +LLQ K + E L K+L+   + +  EK +    A Q   L+EEN  L+     +L+         ++L  ++K +K +LN+ K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ +T++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FAPMLEQFMLTPLVCWVRTVGQLKASESNKLSEYIELV-------------DGIYLNEIMLEINPKAAVQRTNKKVNNDPTLR--IQNLSILIRQIKSYYQESLQQLVMMPLPNVLVLGRNPLSEQGLDEMGKLLLLLLGCAVQCEKKEEYIERIQT-LDFET-KAAIASHIQEVTHNQENVMDLQWLENGNVPPEDLDNLSRNLAFHLKRLVDER--DTQLETIVELTQERDCVQLSPLASCTS----QSPGDSPSI--RRTESRQHLSVELADAKAKIRRLRQELEEKSEQLLDTRQELENVEVELKRLQQDNYQLLSDARSARAYRDELDALREKAIRVDKLESDLCRYKERLHDIEFFKARVEELKEDNQILLETKTMLEEQLDGCRTRSDKLHLLEKENLQLKSKIHDMEMERDLDRKRMEELLEENLVLEMAQKQSMDES--LHLGWELEQLSKTPELTEVPQKSLGEEVKDLTSSRLLKLEKDNQALLKTVEELRGAGSAETISKL----AKVNQENQKLNQKLERLESELMADRESLRSAETLSMDLMKEKALLEKTLETLRENSERQLKGLEQENKHLSQTMSSLRQRSQVGAEARVKDVEKENRVLHESICETTAKLNKIEFERKQLRKDLEMMKDKGERAEELEIQIQKLERDNESLLKKVASLGITCEKVSSLEKENTELEAEGRRLKK---KLDALKNVAFQLEALEKENSQLEQENLELRRSAESLRSAGAKAAQLEAENRELESEKSQLKRNLELLKASSKKTERLEVSYQGLDTENQRLQKALENSSKKIQQLEAELQDVETENQTLQRNLEELKISSKRLEQLEQENKNLEQESSQLEKDKKLLEKENKRLRQQAEIRDSKLEDCNHRISSLEKE------NRTMGKEM----IFFKDSCTRVKELEKENKELVKLTNIDKKTLMTLREELVSEKLRTQQINNDLEKLTHELEKIGLTKDRLLDDESSDDRFKLLESKLESTLKSSLEIKEEKIASLEARLQESSNLNQQLRQELKTVKKNYEALRQREEEERMVHSSPPKGGKDPQTDNKWAKESHEATRELLKVKDRLIEVERNNATLQAEKVALRSQLKQLETQSSNLQAQIVALQRQTASLQENNTILQTQNAKLQVENSTLSSQGAALMAQNAQLQSQQSGVEGERDGALKDKEELRATYELLLRDHEKLAALHERQAAEYEALIGKHGGLKTSHKSLEQQHRDLEDKYKQLLQRKGDLEELEKNLRGQQDKMALEKESHEATADQYKMLKEENERLNSSYRQLLKDN-------ENLQLDHKSIKSQLNSAKLEQTKLEAEFSKLKEQYQQLDITSTKLTNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQTMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITL 1398          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Medaka
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:101156523])

HSP 1 Score: 343.199 bits (879), Expect = 5.733e-95
Identity = 404/1444 (27.98%), Postives = 764/1444 (52.91%), Query Frame = 2
Query:   53 FLPIIRNFITSNYLKYEKFV-KMTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSV---TNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLE----------EFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRK--NEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXX-XXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSE-LNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFD----------MQRMNQKCNKLDSSLDKSYQDNLQLSKKNA----------ELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSI--SNETLEE---NMKELAMEN---QRKTSQLMKKISELESELVKTK----------TENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIG-----IIEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSF-------TQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTND---ELLQYKKEAE----SLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            F P++  F+ +  + + + V ++ A+  N+L  +++L              DG +LNE+  EI+P +    TN+++    ++   I+N  IL++ I+ YY   LQQ  ++ LP+++ +  +P S +   E+ K + L+LG AVQCE+KE +I+ I T L  E+ +  +  +I+++T + + V++   LE            S        R V E+  D+ +E    +  + D +Q             ++ G    I    + S + +++ELA+ KAK+R+L+ EL++K++ + D R +LE  + E  +L++   +L +++R  R  +DELD+ RE  +R+  +E+D  + KE+++++E+++ R EEL+ED  ++    + L ++++  +   ++   LE E  +   K  + E+E+ +     E    E  ++ M +K ++  S    L  EL++L ++     +   S+ ++V + T+++LL+LE +N++LL+ + +++   ++E ++KL    +++ +EN +L+ K+ RL+     + +     E     L +EK  L+  +++++EN+ R+++ L QEN++LS+T+  +R+RS+   + RV ++EKEN  LH S+ E   KL+K+EF+          M+   ++  +L+  + K  +DN  L KK A           LEKE   L+    RL++   K   L+    QL+AL  E  Q  Q++  +  S E+L        +L  EN   + + SQL + +  L++   KT+          TEN++  + +  S  KI+ LE EL+  +TE     R   +LK++ + L ++E E + L+ +S +LE++ K L+KEN R + Q + + S +    ++I+ +E +      ++   KE     +   ++  R+ + E++N+EL++    +K+   TLREEL++E++ +Q + N ++ L+ ELE+IG     +++ E+++++FK+LESK+ ST++ ++  KEE+I SL++RL  S   N++L  +L+  +  Y +L Q+ EEE  V S              +       T+ LL +KD LI+VER NA L +EK  L SQ + L+ + S  + + +    Q  SLQ+ ++ L   N KL+++ STL SQ   L   N  L +Q + +E     ++ D   L    + L      L  L+ + + EYE L  +    K+ +KS+  Q     D   +LLQ K + E    +L+  ++ +  EK +    A Q   L+EEN  L+     +L+         ++L  ++K +K +LN+ K    +L+ + S L+    + +    KL  + E L++    L EEN+ LL Q+++++LQN+ L+ +T++++     E+    DKL++L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:    6 FAPMLEQFMLTPLVCWVRTVGQLKASESNKLSEYIELV-------------DGIYLNEIMLEINPKAAVQRTNKKVNNDPTLR--IQNLSILIRQIKSYYQESLQQLVMMPLPNVLVLGRNPLSEQGLDEMGKLLLLLLGCAVQCEKKEEYIERIQT-LDFET-KAAIASHIQEVTHNQENVMDLQWLENGNVPPEDLDNLSRNLAFHLKRLVDER--DTQLETIVELTQERDCVQLSPLASCTS----QSPGDSPSI--RRTESRQHLSVELADAKAKIRRLRQELEEKSEQLLDTRQELENVEVELKRLQQDNYQLLSDARSARAYRDELDALREKAIRVDKLESDLCRYKERLHDIEFFKARVEELKEDNQILLETKTMLEEQLDGCRTRSDKLHLLEKENLQLKSKIHDMEMERDLDRKRMEELLEENLVLEMAQKQSMDES--LHLGWELEQLSKTPELTEVPQKSLGEEVKDLTSSRLLKLEKDNQALLKTVEELRGAGSAETISKL----AKVNQENQKLNQKLERLESELMADRESLRSAETLSMDLMKEKALLEKTLETLRENSERQLKGLEQENKHLSQTMSSLRQRSQVGAEARVKDVEKENRVLHESICETTAKLNKIEFERKQLRKDLEMMKDKGERAEELEIQIQKLERDNESLLKKVASLGITCEKVSSLEKENTELEAEGRRLKK---KLDALKNVAFQLEALEKENSQLEQENLELRRSAESLRSAGAKAAQLEAENRELESEKSQLKRNLELLKASSKKTERLEVSYQGLDTENQRLQKALENSSKKIQQLEAELQDVETENQTLQRNLEELKISSKRLEQLEQENKNLEQESSQLEKDKKLLEKENKRLRQQAEIRDSKLEDCNHRISSLEKE------NRTMGKEM----IFFKDSCTRVKELEKENKELVKLTNIDKKTLMTLREELVSEKLRTQQINNDLEKLTHELEKIGLTKDRLLDDESSDDRFKLLESKLESTLKSSLEIKEEKIASLEARLQESSNLNQQLRQELKTVKKNYEALRQREEEERMVHSSPPKGGKDPQTDNKWAKESHEATRELLKVKDRLIEVERNNATLQAEKVALRSQLKQLETQSSNLQAQIVALQRQTASLQENNTILQTQNAKLQVENSTLSSQGAALMAQNAQLQSQQSGVEGERDGALKDKEELRATYELLLRDHEKLAALHERQAAEYEALIGKHGGLKTSHKSLEQQHRDLEDKYKQLLQRKGDLEELEKNLRGQQDKMALEKESHEATADQYKMLKEENERLNSSYRQLLKDN-------ENLQLDHKSIKSQLNSAKLEQTKLEAEFSKLKEQYQQLDITSTKLTNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQTMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITL 1398          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Medaka
Match: ccdc88c (protein Daple-like [Source:NCBI gene;Acc:101164937])

HSP 1 Score: 159.073 bits (401), Expect = 2.202e-38
Identity = 190/720 (26.39%), Postives = 376/720 (52.22%), Query Frame = 2
Query:  206 GYFLNEVFKEIDPNSVTNEQLVKC--RSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFS----------TGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYS---SNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXX--DQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNK---LDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSIL--EVEKLQLDALVSEYYQQLQQSTSISNETL--EENMK-ELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKS 2290
            G FL+++   IDP S TN++L K     +   + N  +L ++I+ YY   LQQ  V+ LP+I+ I  DP S K+  E+ + + L+LG AVQCERK+  I  I  +L +   Q  ++ +I+++T +   V++   LE+ +          +  M   L+ + E+  D   E    +  + D L +Q      +    + +    G        +   + +++ELA+ KAKLR+ + +L++K + + D + + E    E  +LK+    L  E+R +R  +DE+DS RE   R+  +EA+  + KEK++++ +Y+ R EELRED   +      L +++ ++++  ++  TLE +      K  +LE    S    + +L  + M ++      ++  + L  EL++L ++   S   +  S   ++ E  ++++L+LE ENR L   +  +K ++   L + +  + +L+ E   L+NKV RLQ    +E     ++E   + L +EKQ L+ ++ +++    ++I EL  E ++LSE +  ++ER++ +++ RV E+E EN  LH S+ + + +L+ +E  ++ ++++  +   L    +++ ++  +L +    L +E+ +L+      E L+ + + L  EV +L+ +A  ++   Q QQS  ++  +L  +EN++   ++EN R +S L+  + E   EL K  TE ++  R   K+
Sbjct:   48 GVFLHKILTHIDP-SPTNQRLTKNVNNDMSLRLHNLTVLTRHIKTYYQETLQQLIVMPLPNILCIAKDPLSAKSMEELRRLLLLLLGCAVQCERKQEMIDKI--KLLDIQTQAAIVSHIQEVTHNQMNVLDLSWLEDGAELGPEELQPLSRTMAASLQQLIEE-RDKAAEIIVDLTQERDYLSSQQPQDGRRGSAERGLHAGGGGSGGPELITEEKQHLSVELADAKAKLRRYRQDLEEKTEQLMDSKHEAERLDQELQRLKQENQLLAGEARSMRAYRDEVDSLRERAARVDRLEAELSRCKEKLHDVHFYKSRVEELREDNMTLLETKVLLEEQLASSRERCDKLHTLEKDNLLLQAKINDLEMERDSERRRLEELLEENMLLEIGQKQSMNESAHLGWELEQLSKNHDHSDTETRKSLVQELNECVSSRMLKLEKENRELQASIERLK-EENHVLQEQQLHMQKLDREKQSLNNKVERLQGLLDQERLTNQDMESLGEELLKEKQSLEREMHALRVEKDQQILELESEKQHLSEAVASLQERAQSNSEARVREVETENRLLHQSITDTSSRLNSLETQLKVVSEESERLRELAGRCEEAEREVSRLERSREALNREVESLRACSEHSEALEKQVTSLEQEVHRLKREAEAAQEELQ-QQSKQLAGNSLLSKENLELRCSLENLRSSSSLLPTLQE---ELKKAHTETQEAQRAAEKA 758          
BLAST of Coiled-coil domain containing 88C vs. Ensembl Medaka
Match: ccdc88aa (girdin [Source:NCBI gene;Acc:101155829])

HSP 1 Score: 125.561 bits (314), Expect = 3.382e-28
Identity = 167/611 (27.33%), Postives = 318/611 (52.05%), Query Frame = 2
Query: 2372 LKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYD---AQLSSVNMYQNKI-NEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEE--------KFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXX---XXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYI---HQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFK---SMPSTKKTNLSIL 4141
            L+++ R L ++E+E++ L+ ++  LE+N + L+KEN R + Q +   A L + N+  + +  EM   +          KE E L+ TA    +R+ + E  NR+L +Q   +++  +TLR+EL+NE++ +Q    +++  + ELE + ++  E+ E+        + K+LE  + S+++ ++   ++Q+  L++RL  +   N++L  +L+  +   ++L+Q  EE  +  S   +  + S         T+ LL +KD LIKVER NA L++E+Q +  Q + L+ +    + + +    Q  SLQ+ ++ L   N  L++++STL SQ   L   N  L  Q +  E      V + + L    +QL      L  L+ + + EYE L  + K  K+ ++++  +  +  D      ++   L+ L+  L+ E+  +     Q  S   E + L  EK+ + Q   ++  + ++L  ++K LK ++N  K     L+   S L+  + + +   +KL  + E L++  E L EEN+ LL Q+K+++LQN+ L+ + ++++     EE    DKL+ L+R KE+LEEKIM+Q+K     P  ++ N   L
Sbjct:  380 LQISVRRLEQLESEKQSLEQETASLEKNKRHLEKENRRLRQQVEILEANLDNSNVCMSSLEREMRGVV----------KEVEGLRETA----ERVKNLEVDNRQLAKQAAIDQKTLATLRQELVNEKMSTQQRDAELRRRTHELE-MRVLNQESAEQPEAHTSDGRVKMLE--LESSLKKSLQDTDDQM--LEARLREASSFNQQLCHELKTVKLSCDALQQTQEEWSSSSSEAESCKAVSKWLQESQEATKELLRVKDHLIKVERNNATLEAEQQAVQVQLKQLEGQSHIQQVQILALQRQAASLQENNTALQTHNASLQVEMSTLNSQSAALTAQNAQLQQQQSRTESERDGVVRERDELRSSHEQLLRDHERLVVLHERQAMEYEALMGKHKCLKNTHRTLELEHRTLQDRCNSLLQQRTKLEDLERALKEEQMRIGLEKEQHQSTAAECSRLRDEKDWLNQVYCQLVKDNEALTADHKQLKTQMNEIKLEKTWLEADFSKLKTELQQLDITSMKLSNQCELLSQLKENLDEENRHLLSQIKTLMLQNRTLLEQNMESKDLFHVEERQYIDKLNDLRRQKEKLEEKIMDQYKLYEPSPPRRRGNWITL 971          
BLAST of Coiled-coil domain containing 88C vs. Planmine SMEST
Match: SMESG000066575.1 (SMESG000066575.1)

HSP 1 Score: 3395.52 bits (8803), Expect = 0.000e+0
Identity = 1799/1823 (98.68%), Postives = 1809/1823 (99.23%), Query Frame = 2
Query:  116 MTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNEESEMDCGAPTPKLKSSRLSNSDTYSMISSISQQESFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQEVNVKTLRNHSRPQTSLDLPINGRRPGVHXXXXXXXXXXXXXXXXLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTXXXXXXXXHVDISPNNNLMNFKPRPQTSLGSANXXXXXXXXXXXXQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV 5584
            MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ+VK+LRCVTEQWEDSFIEDTKAILSQNDALQNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQ+SNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTS+SNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAE+NLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKR VDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFK+LESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELI+KLEEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQ R+NQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKK         PKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNEN SRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNE SEMDCGAPTPKLKSSRLSNSDTYSMISSISQQ+SFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQE+NVKTLRNHSRPQTSLDLPINGRRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSAN PSSSRRPPPVSQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV
Sbjct:    1 MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQLVKRLRCVTEQWEDSFIEDTKAILSQNDALQNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQKSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSMSNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAEKNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRQVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFKLLESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIIKLEEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQTRQNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKK---------PKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENSSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNEGSEMDCGAPTPKLKSSRLSNSDTYSMISSISQQDSFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQEINVKTLRNHSRPQTSLDLPINGRRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSANAPSSSRRPPPVSQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV 1814          
BLAST of Coiled-coil domain containing 88C vs. Planmine SMEST
Match: SMESG000066575.1 (SMESG000066575.1)

HSP 1 Score: 3394.36 bits (8800), Expect = 0.000e+0
Identity = 1799/1823 (98.68%), Postives = 1809/1823 (99.23%), Query Frame = 2
Query:  116 MTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNEESEMDCGAPTPKLKSSRLSNSDTYSMISSISQQESFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQEVNVKTLRNHSRPQTSLDLPINGRRPGVHXXXXXXXXXXXXXXXXLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTXXXXXXXXHVDISPNNNLMNFKPRPQTSLGSANXXXXXXXXXXXXQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV 5584
            MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ+VK+LRCVTEQWEDSFIEDTKAILSQNDALQNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQ+SNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTS+SNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAE+NLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKR VDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFK+LESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELI+KLEEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQ R+NQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKK         PKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNEN SRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNE SEMDCGAPTPKLKSSRLSNSDTYSMISSISQQ+SFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQE+NVKTLRNHSRPQTSLDLPINGRRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSAN PSSSRRPPPVSQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV
Sbjct:    1 MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQLVKRLRCVTEQWEDSFIEDTKAILSQNDALQNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQKSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSMSNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAEKNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRQVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFKLLESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIIKLEEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQTRQNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKK---------PKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENSSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNEGSEMDCGAPTPKLKSSRLSNSDTYSMISSISQQDSFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQEINVKTLRNHSRPQTSLDLPINGRRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSANAPSSSRRPPPVSQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV 1814          
BLAST of Coiled-coil domain containing 88C vs. Planmine SMEST
Match: SMESG000066575.1 (SMESG000066575.1)

HSP 1 Score: 3378.96 bits (8760), Expect = 0.000e+0
Identity = 1793/1823 (98.35%), Postives = 1803/1823 (98.90%), Query Frame = 2
Query:  116 MTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNEESEMDCGAPTPKLKSSRLSNSDTYSMISSISQQESFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQEVNVKTLRNHSRPQTSLDLPINGRRPGVHXXXXXXXXXXXXXXXXLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTXXXXXXXXHVDISPNNNLMNFKPRPQTSLGSANXXXXXXXXXXXXQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV 5584
            MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ+VK+LRCVTEQWEDSFIEDTKAILSQNDALQNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQ+SNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTS+SNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAE+NLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKR VDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFK+LESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELI+KLEEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQ R+NQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNEN SRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTS                GAPTPKLKSSRLSNSDTYSMISSISQQ+SFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQE+NVKTLRNHSRPQTSLDLPINGRRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSAN PSSSRRPPPVSQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV
Sbjct:    1 MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQLVKRLRCVTEQWEDSFIEDTKAILSQNDALQNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQKSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSMSNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAEKNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRQVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFKLLESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIIKLEEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQTRQNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENSSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTS----------------GAPTPKLKSSRLSNSDTYSMISSISQQDSFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQEINVKTLRNHSRPQTSLDLPINGRRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSANAPSSSRRPPPVSQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV 1807          
BLAST of Coiled-coil domain containing 88C vs. Planmine SMEST
Match: SMESG000066575.1 (SMESG000066575.1)

HSP 1 Score: 3370.48 bits (8738), Expect = 0.000e+0
Identity = 1791/1823 (98.24%), Postives = 1801/1823 (98.79%), Query Frame = 2
Query:  116 MTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNEESEMDCGAPTPKLKSSRLSNSDTYSMISSISQQESFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQEVNVKTLRNHSRPQTSLDLPINGRRPGVHXXXXXXXXXXXXXXXXLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTXXXXXXXXHVDISPNNNLMNFKPRPQTSLGSANXXXXXXXXXXXXQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV 5584
            MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ+VK+LRCVTEQWEDSFIEDTKAILSQNDALQNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQ+SNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTS+SNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAE+NLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKR VDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFK+LESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELI+KLEEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQ R+NQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNEN SRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNE SEMDCGAPTPKLKSSRLSNSDTYSMISSISQQ+SFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQE+NVKTLRNHSRPQTSLDLPINGRRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSAN PSSSRRPPPVSQRTES                 PIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV
Sbjct:    1 MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQLVKRLRCVTEQWEDSFIEDTKAILSQNDALQNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQKSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSMSNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAEKNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRQVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFKLLESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIIKLEEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQTRQNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENSSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNEGSEMDCGAPTPKLKSSRLSNSDTYSMISSISQQDSFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQEINVKTLRNHSRPQTSLDLPINGRRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSANAPSSSRRPPPVSQRTES-----------------PIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV 1806          
BLAST of Coiled-coil domain containing 88C vs. Planmine SMEST
Match: SMESG000066575.1 (SMESG000066575.1)

HSP 1 Score: 3342.36 bits (8665), Expect = 0.000e+0
Identity = 1778/1823 (97.53%), Postives = 1788/1823 (98.08%), Query Frame = 2
Query:  116 MTATVDNELFSWLKLFWTXXXXXXXXXXXXGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDALXXXXXXXXXXXXVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQEXXXXXXXXXXXXDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKLEEQEAKYNSLEQKYEEELAVIXXXXXXXXXXXXXPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRSRSCGTILGSIESIKNSSIGDKSTDYQIDHTDTSEKEDFLTDNEESEMDCGAPTPKLKSSRLSNSDTYSMISSISQQESFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQEVNVKTLRNHSRPQTSLDLPINGRRPGVHXXXXXXXXXXXXXXXXLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTXXXXXXXXHVDISPNNNLMNFKPRPQTSLGSANXXXXXXXXXXXXQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV 5584
            MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQ+VK+LRCVTEQWEDSFIEDTKAILSQNDALQNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQ+SNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTS+SNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAE+NLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKR VDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFK+LESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELI+KLEEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQ R+NQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGK                               DKSTDYQIDHTDTSEKEDFLTDNE SEMDCGAPTPKLKSSRLSNSDTYSMISSISQQ+SFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQE+NVKTLRNHSRPQTSLDLPINGRRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSAN PSSSRRPPPVSQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV
Sbjct:    1 MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQLVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSYKTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQITESHDTVINCIHLEEFSTGQLVKRLRCVTEQWEDSFIEDTKAILSQNDALQNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQNELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQRELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVDKIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSMQEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLEIENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQKSNKKEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSETIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQKCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSILEVEKLQLDALVSEYYQQLQQSTSMSNETLEENMKELAMENQRKTSQLMKKISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIESKLKLAEKNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLSSVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRQVDSERKNRELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEFEANEEKFKLLESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIIKLEEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIKVERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNTNMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFKQQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELLQYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQSKYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDIVKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQTRQNQFSEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGRNKFLKKAKEILRRNDSKSSVEQEGK------------------------------SDKSTDYQIDHTDTSEKEDFLTDNEGSEMDCGAPTPKLKSSRLSNSDTYSMISSISQQDSFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQELNDKKIKEDKSQTLNKAPDIQKPVMRQEINVKTLRNHSRPQTSLDLPINGRRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETSIVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSENSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGRPQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSANAPSSSRRPPPVSQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSGSNASDKSEKNKIPQKLYFAYGNV 1793          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain containing 88C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCDC88A7.118e-10028.05coiled-coil domain containing 88A [Source:HGNC Sym... [more]
CCDC88A1.134e-9928.10coiled-coil domain containing 88A [Source:HGNC Sym... [more]
CCDC88A9.270e-9927.87coiled-coil domain containing 88A [Source:HGNC Sym... [more]
CCDC88A1.423e-9827.92coiled-coil domain containing 88A [Source:HGNC Sym... [more]
CCDC88A1.423e-9827.92coiled-coil domain containing 88A [Source:HGNC Sym... [more]
back to top
BLAST of Coiled-coil domain containing 88C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
grdn-17.745e-1125.52Girdin homolog [Source:UniProtKB/Swiss-Prot;Acc:F... [more]
grdn-11.194e-1025.52Girdin homolog [Source:UniProtKB/Swiss-Prot;Acc:F... [more]
grdn-18.989e-1027.30Girdin homolog [Source:UniProtKB/Swiss-Prot;Acc:F... [more]
back to top
BLAST of Coiled-coil domain containing 88C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Girdin2.594e-2425.88gene:FBgn0283724 transcript:FBtr0332097[more]
Girdin3.497e-2425.53gene:FBgn0283724 transcript:FBtr0332099[more]
Girdin1.360e-2325.88gene:FBgn0283724 transcript:FBtr0073035[more]
Girdin1.993e-2325.88gene:FBgn0283724 transcript:FBtr0073036[more]
Girdin2.063e-2325.88gene:FBgn0283724 transcript:FBtr0332098[more]
back to top
BLAST of Coiled-coil domain containing 88C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc88c4.364e-8826.53coiled-coil domain containing 88C [Source:ZFIN;Acc... [more]
ccdc88c2.854e-8526.24coiled-coil domain containing 88C [Source:ZFIN;Acc... [more]
ccdc88aa1.155e-2828.27coiled-coil domain containing 88Aa [Source:ZFIN;Ac... [more]
ccdc88b1.023e-2328.31coiled-coil domain containing 88B [Source:ZFIN;Acc... [more]
hook11.936e-623.12hook microtubule-tethering protein 1 [Source:NCBI ... [more]
back to top
BLAST of Coiled-coil domain containing 88C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCDC88A5.089e-9927.89coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A3.634e-9728.60coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A3.667e-9728.53coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A5.696e-9728.60coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A9.209e-9728.60coiled-coil domain containing 88A [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain containing 88C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ccdc88a2.546e-10428.55coiled coil domain containing 88A [Source:MGI Symb... [more]
Ccdc88c4.467e-8826.56coiled-coil domain containing 88C [Source:MGI Symb... [more]
Ccdc88c2.131e-8626.44coiled-coil domain containing 88C [Source:MGI Symb... [more]
Ccdc88a9.049e-2630.43coiled coil domain containing 88A [Source:MGI Symb... [more]
Ccdc88c4.284e-1842.62coiled-coil domain containing 88C [Source:MGI Symb... [more]
back to top
BLAST of Coiled-coil domain containing 88C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SNZ0|GRDN_MOUSE1.971e-10328.55Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV... [more]
sp|Q3V6T2|GRDN_HUMAN6.836e-9827.92Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=... [more]
sp|Q9P219|DAPLE_HUMAN1.014e-9727.35Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C P... [more]
sp|Q6VGS5|DAPLE_MOUSE3.125e-8726.56Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c ... [more]
sp|P85120|DAPLE_XENLA1.329e-8427.99Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c... [more]
back to top
BLAST of Coiled-coil domain containing 88C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QVD62.690e-12731.18Girdin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_... [more]
A0A0L8FTV61.066e-12230.15Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8FUM64.058e-12029.95Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A2C9KRY75.676e-11129.57Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KS638.050e-11129.57Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Coiled-coil domain containing 88C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCDC88A2.936e-8927.29coiled-coil domain containing 88A [Source:HGNC Sym... [more]
ccdc88c5.954e-8926.34protein Daple [Source:NCBI gene;Acc:103041063][more]
ccdc88b1.991e-2127.91girdin-like [Source:NCBI gene;Acc:103039284][more]
ccdc88b4.133e-2027.61girdin-like [Source:NCBI gene;Acc:103039284][more]
hook16.705e-931.08hook microtubule tethering protein 1 [Source:NCBI ... [more]
back to top
BLAST of Coiled-coil domain containing 88C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ccdc88aa1.336e-3327.61coiled-coil domain containing 88Aa [Source:ZFIN;Ac... [more]
ENSPMAT00000006299.19.085e-2827.60pep scaffold:Pmarinus_7.0:GL477364:187806:194761:1... [more]
ENSPMAT00000009976.14.508e-824.48pep scaffold:Pmarinus_7.0:GL477657:220019:240565:-... [more]
back to top
BLAST of Coiled-coil domain containing 88C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 88C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO315302.235e-2630.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339795.363e-730.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain containing 88C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCDC88A1.510e-9528.12coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A4.995e-9528.12coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A5.733e-9527.98coiled-coil domain containing 88A [Source:NCBI gen... [more]
ccdc88c2.202e-3826.39protein Daple-like [Source:NCBI gene;Acc:101164937... [more]
ccdc88aa3.382e-2827.33girdin [Source:NCBI gene;Acc:101155829][more]
back to top
BLAST of Coiled-coil domain containing 88C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066575.10.000e+098.68SMESG000066575.1[more]
SMESG000066575.10.000e+098.68SMESG000066575.1[more]
SMESG000066575.10.000e+098.35SMESG000066575.1[more]
SMESG000066575.10.000e+098.24SMESG000066575.1[more]
SMESG000066575.10.000e+097.53SMESG000066575.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004319 ID=SMED30004319|Name=Coiled-coil domain containing 88C|organism=Schmidtea mediterranea sexual|type=transcript|length=5746bp
ATATCAGGGCGCATACATTTGAATATAATTTATTTTGTAATTTTAATATT
ATTTTTTGCCGATCATTAGAAATTTTATCACTTCTAACTATTTAAAATAT
GAGAAATTTGTGAAAATGACTGCAACTGTAGATAATGAATTATTTTCGTG
GTTGAAATTATTTTGGACCAGCGACGATATTCTTTCATATGATCTTTTAT
CAGATGGATATTTTTTAAATGAAGTATTTAAAGAAATTGATCCAAACTCA
GTCACAAATGAACAATTAGTAAAATGTAGAAGCATCGTTGATTGTATCAA
AAATTGGGAGATATTGTTAAAAAATATCCGTGTGTACTATATGTTAGTAT
TACAACAAGCTTTCGTCATTCGACTTCCAAGCATAATAACAATATGTTAT
GATCCGCATTCGTACAAAACCCACAGAGAAATCGATAAAACTATTTTTCT
AATTCTCGGAGCTGCTGTACAGTGCGAAAGGAAAGAATATTTTATTCAAG
ACATCATCACAAGACTTCCTGAAGAATCAATTCAACATGGCTTAATGGGG
TACATTAAACAGATTACCGAAAGTCATGACACCGTCATCAATTGTATTCA
TTTAGAAGAATTCTCAACTGGCCAAATGGTGAAACAATTGAGATGTGTTA
CTGAACAATGGGAAGACAGTTTTATTGAAGATACTAAAGCAATTTTGAGT
CAAAATGACGCTCTTCAAAATCAAATCCAAGACCAAAAGAATCAGATACA
AGTACTCAAAAACGTCGGAGTAGACAACGGAATTGTCTCTTATTCATCTA
ATTCAGATAAAACAATGGCATTAGAATTAGCTGAATGCAAAGCAAAATTA
AGAAAACTCCAAAATGAATTGGATGATAAAAATGACATTATTTCTGATCT
TCGAGATGATTTAGAAATGCAACAAAGTGAGAATACAAAATTGAAAGAAA
GTCAAATGAAGCTTACAAATGAATCAAGACGTCTTAGAATGTTACAAGAT
GAGCTGGATAGTCAAAGAGAATTGATATTAAGAATGCCTTCCATTGAAGC
GGACAATCAAAAACTGAAAGAAAAAGTAAATGAATTGGAATATTACAGAG
TCAGATGTGAAGAGTTAAGAGAAGATTTAGCCGTGATTGCGAATGAAAAT
TCCAATTTAGTTGATAAAATAGAAAATAACAAAAAAGTCGTGGAAAGAGC
GGCTACGTTAGAAGTCGAATATAGGAAAGCAACAAGAAAAAATGAGGAAT
TGGAACAGTCTATTTCCAGTCATTTGGCTGAAATAACAAAACTTGAATAC
AAATTGATGTCGATGCAGGAAAAGGACAATGTTTACATATCTAGCAAATC
GGAATTAGAAAACGAATTGAAACGTTTACAAGAAAGTAAGAGCGATAGCC
TTCAATCTTCCTCCATATCGGATCAAGTCATTGAAAAGACTAATGCAAAA
TTACTAAGATTGGAAATTGAAAATCGTTCTCTATTAGAAAAGTTGTCTGA
CATCAAGTTTGATGATACTTCGGAACTGAATAAGTTAAAGGAGAGAATTT
CAGAACTTGAAGAAGAGAATGATCGTTTGCATAATAAGGTTTCAAGACTT
CAACAGTCGAATAAAAAAGAGATTCAACAGTATATGGAAATCGAAGAAAG
CAAACAGTTGCTTTTCAGAGAAAAACAACAATTAGACATGGACATTAAAT
CAGTCCAAGAAAACACCAGCAGAAGGATTCAAGAGTTGGTACAAGAAAAC
GAAAATCTATCAGAAACAATAATGATAATTCGAGAGCGTTCAGAAAAATC
AAATGATTTACGAGTGAGTGAGCTGGAGAAAGAGAATTCCAAATTGCACT
TGTCAATGAATGAATTAAATCATAAATTATCTAAAATGGAATTTGATATG
CAGAGAATGAATCAAAAATGTAATAAATTAGATTCTTCATTGGACAAGTC
TTATCAAGATAATTTACAACTGTCAAAGAAAAACGCAGAACTGGAAAAGG
AGCTCGTCAACTTGAAAATGTTTAAGTCGAGACTTGAAGAACTGCAAGAT
AAGTTTTCAATACTCGAAGTCGAAAAATTACAACTGGATGCCTTAGTGTC
TGAGTATTATCAACAGCTCCAACAAAGCACTTCAATATCAAATGAAACGT
TGGAAGAGAATATGAAGGAACTGGCCATGGAAAATCAACGAAAAACCTCT
CAACTGATGAAGAAAATCAGTGAACTGGAATCAGAACTTGTCAAAACGAA
AACTGAAAATGAAAAATGTTTTCGCCAGATAAATAAGTCAGAAAATAAAA
TCAAATCTCTTGAACAAGAATTGGAAAGTTCTAAAACTGAATTAGCCGGT
TATAGCAGAATCGAAAGTAAATTAAAACTGGCCGAAAGAAATCTTAGTGA
AATGGAAAACGAACGCGAAGAGCTTCAAACGCAGAGTTTGAAATTAGAAC
AAAATATTAAACAATTGGATAAAGAAAATCACCGCTTTAAGAACCAATAC
GATGCTCAGTTGAGCTCAGTAAATATGTATCAAAATAAAATTAATGAAAT
GGAAACGAAAATCCATTTGTTAGAACTGGATAAATTTGATAAAAAAGAAT
TCGAAGACTTACAGTTGACTGCCAATGAAAACGAGAAGCGTCTGGTTGAT
TCAGAGAGAAAGAATAGAGAACTGATTCAACAAATCAAAGAAGAGAAACG
TCAATGTTCTACTCTTAGAGAAGAATTGTTAAACGAGAGAATCGTTTCAC
AAAATCTTAAAAATCAAATTCAAAATCTTTCTGATGAATTGGAAAGAATT
GGAATAATAGAATTTGAAGCAAATGAAGAGAAATTCAAGATACTCGAATC
GAAAGTTAATTCCACAGTTGAAGATACAGTGCATAAGAAGGAGGAACAAA
TTACAAGTTTGCAATCTAGGTTGGGTTCATCAATTGAGCGGAATAAGGAA
TTGATAATGAAATTAGAGGAACAGGAAGCAAAGTATAACAGCCTCGAACA
AAAGTACGAAGAAGAATTGGCAGTAATATCAGTTAAGAATAATAGATCAT
CTAAGTCAAATAATGTGCCTTCTTTTACTCAACATTTACTTGACTTAAAA
GATGATCTTATTAAAGTAGAAAGAAAGAATGCACAATTGGATTCAGAAAA
ACAACATTTAAATTCTCAATGTGAAGATTTAAAGGATAAAATGTCTGCAG
CTGAAAATAAGTACATTCATCAATTAGACAGCCTCCAGAAAAAGCACAGT
GAATTGAATAATACAAATATGAAATTGGAAATACAAATATCAACCCTAAA
AAGCCAATTGGATACATTGCGAACGGCAAATGTTAATCTCTCAAATCAGA
TAACAAATATAGAAAAAAATCTTTTATCATCTGTTGATGATGTTAACTCC
TTGACAAAATTCAAACAACAATTGGAAGCACAATGCAGCAGTTTACAGAA
ACTCAATAATCAGTTGTCAACAGAATATGAGATTCTTAAAAAAGAGACAA
AATCACAGAAATCAATTAATAAATCAATTAATGCACAATTAAGTTCAACG
AATGATGAATTATTACAATACAAAAAAGAAGCAGAAAGTCTCAAACATTT
AAAGGAGATATTAGAAAGTGAAAAAAATAATTTAGCGGATGGTGCTCGAC
AGTTGATCAGTTTACGAGAAGAGAATAATAATTTATCACAAGAGAAAAAT
GATATTTTGCAAAGCAAGTATAAAATTGAAGCCGAATTGAAATCATTAAA
TCAAAATAACAAATATTTAAAATGTGAGTTAAACAACGAAAAAGAAATAA
CAAATCAGTTGAAAGAAAAGATTTCCAATTTAGAAGCGGTCATTTCAAAA
TATGAAAAAGACATAGTGAAACTGGAAGCCAAAATTGAAGCTTTAAACAG
ACAAAATGAGTATTTAATTGAAGAAAATAAGAAATTGCTTATCCAAATGA
AATCCATGCTATTGCAAAATCAAGACCTCATTACAGAAACTCTTCAAAAT
CGAAAGAATCAGTTTTCTGAGGAAGTAGCCTTACGTGATAAACTTAGCAA
ATTACAACGACATAAAGAAAGATTAGAAGAAAAGATTATGGAACAATTTA
AGTCTATGCCGTCAACAAAAAAAACAAATTTGAGTATTTTATATGATGAG
CCCAAAGGAGGACGAAATAAATTTTTGAAAAAAGCTAAAGAAATACTGAG
ACGCAATGATTCAAAATCATCAGTCGAACAGGAAGGAAAAAATAAAAATG
AGAATCCGTCACGTATGCAACGGAGTCGTAGTTGTGGAACGATACTCGGA
AGTATTGAGTCAATTAAAAATAGCTCAATTGGTGATAAATCAACTGATTA
CCAGATCGACCATACCGATACGAGTGAGAAAGAAGATTTCTTGACGGATA
ATGAAGAATCGGAAATGGATTGTGGAGCCCCGACTCCTAAATTAAAGTCG
TCACGTTTGAGTAATTCTGATACGTATTCAATGATTAGCTCAATTTCACA
GCAAGAATCATTTGTGTCAAACAGTACGAAACTTATTCCTGGTTCAATGT
CGATTTATGATAGAGATGAAAACGAAAAATCTCAAAATAAAGAAATATAC
AATTATTTGCAAGAATTAAATGATAAAAAGATAAAAGAAGATAAATCTCA
GACATTGAATAAAGCTCCTGATATTCAAAAGCCTGTTATGAGACAAGAAG
TTAATGTAAAGACTTTAAGAAACCATTCAAGACCTCAAACTTCCTTGGAT
CTTCCTATTAATGGAAGACGGCCAGGAGTTCATGGTGCATCTGTCAGTGT
TTACGGGTCCTCTAACGGAAATGTTGATTCATTAATATTTGGAAACATTA
CCTCAAAGAATACATCTAACCAATTTTGTCATGATAACTCATCAGTCAGC
AGCAATGAAACCAGTATTGTCGTAGCCCCAGTGAAAAAGTCGTTTCTTTC
AACTCAACCCATTGTACCTCAAAGGAAACAGAGTTTACCAGTTACCGATA
GATTTGAGGAAGAATTAACTCATCCTGAAATTGCTCACGATATAATGTTT
AACAGAAGTAGCGAAAATTCAAAAAGAACAACTAATCCAGTCATAATATC
CCGTCCTCAGTCTACAACGCCTGGTTCGGCAAGTAGTAAAACAATTTTGC
AAAGAATGACCAGAAATCAGAGTAAGGTTTTAGCAGCAACTGGCGAATCA
AAATCTCGTGGAAGGCCTCAAACTCCAACTGGGGAAATAAGGAGATTATC
TGTCACCAATCCAAATAATAATAATTATAATCATGTCGATATTTCACCAA
ACAACAATTTAATGAATTTCAAGCCTCGTCCACAAACAAGTCTGGGATCA
GCTAATGTGCCTTCATCTTCTCGGAGACCTCCGCCTGTTTCACAAAGAAC
TGAAAGTAACAAAATGAGTCGAAACTCATCTGACATTGATGATTTTGTGG
ATAAAGGTCCGATTCCTCCAATGCGTAAAGAAAGTGATAAACTCAAGTCC
AACTATGATAGCGGTTCCAATGCTAGTGATAAATCAGAAAAAAACAAAAT
CCCTCAAAAATTATATTTTGCATATGGAAATGTGTAAGAGAAAAGAACAA
TCACATTTTGTTGAGTATTTGTATTTCGTTAATAATAATAATTTTGTACA
AATCTACAACGCTCGTTTGATTAAGGTGTCTGTTACGATGTTTTGCATAT
CAATCTTTGAATATTTGTATTTCTTTCTTTCGAATAAAAATTTGGC
back to top

protein sequence of SMED30004319-orf-1

>SMED30004319-orf-1 ID=SMED30004319-orf-1|Name=SMED30004319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
MILWIKVRFLQCVKKVINSSPTMIAVPMLVINQKKTKSLKNYILHMEMCK
RKEQSHFVEYLYFVNNNNFVQIYNARLIKVSVTMFCISIFEYLYFFLSNK
NL
back to top

protein sequence of SMED30004319-orf-2

>SMED30004319-orf-2 ID=SMED30004319-orf-2|Name=SMED30004319-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1824bp
MTATVDNELFSWLKLFWTSDDILSYDLLSDGYFLNEVFKEIDPNSVTNEQ
LVKCRSIVDCIKNWEILLKNIRVYYMLVLQQAFVIRLPSIITICYDPHSY
KTHREIDKTIFLILGAAVQCERKEYFIQDIITRLPEESIQHGLMGYIKQI
TESHDTVINCIHLEEFSTGQMVKQLRCVTEQWEDSFIEDTKAILSQNDAL
QNQIQDQKNQIQVLKNVGVDNGIVSYSSNSDKTMALELAECKAKLRKLQN
ELDDKNDIISDLRDDLEMQQSENTKLKESQMKLTNESRRLRMLQDELDSQ
RELILRMPSIEADNQKLKEKVNELEYYRVRCEELREDLAVIANENSNLVD
KIENNKKVVERAATLEVEYRKATRKNEELEQSISSHLAEITKLEYKLMSM
QEKDNVYISSKSELENELKRLQESKSDSLQSSSISDQVIEKTNAKLLRLE
IENRSLLEKLSDIKFDDTSELNKLKERISELEEENDRLHNKVSRLQQSNK
KEIQQYMEIEESKQLLFREKQQLDMDIKSVQENTSRRIQELVQENENLSE
TIMIIRERSEKSNDLRVSELEKENSKLHLSMNELNHKLSKMEFDMQRMNQ
KCNKLDSSLDKSYQDNLQLSKKNAELEKELVNLKMFKSRLEELQDKFSIL
EVEKLQLDALVSEYYQQLQQSTSISNETLEENMKELAMENQRKTSQLMKK
ISELESELVKTKTENEKCFRQINKSENKIKSLEQELESSKTELAGYSRIE
SKLKLAERNLSEMENEREELQTQSLKLEQNIKQLDKENHRFKNQYDAQLS
SVNMYQNKINEMETKIHLLELDKFDKKEFEDLQLTANENEKRLVDSERKN
RELIQQIKEEKRQCSTLREELLNERIVSQNLKNQIQNLSDELERIGIIEF
EANEEKFKILESKVNSTVEDTVHKKEEQITSLQSRLGSSIERNKELIMKL
EEQEAKYNSLEQKYEEELAVISVKNNRSSKSNNVPSFTQHLLDLKDDLIK
VERKNAQLDSEKQHLNSQCEDLKDKMSAAENKYIHQLDSLQKKHSELNNT
NMKLEIQISTLKSQLDTLRTANVNLSNQITNIEKNLLSSVDDVNSLTKFK
QQLEAQCSSLQKLNNQLSTEYEILKKETKSQKSINKSINAQLSSTNDELL
QYKKEAESLKHLKEILESEKNNLADGARQLISLREENNNLSQEKNDILQS
KYKIEAELKSLNQNNKYLKCELNNEKEITNQLKEKISNLEAVISKYEKDI
VKLEAKIEALNRQNEYLIEENKKLLIQMKSMLLQNQDLITETLQNRKNQF
SEEVALRDKLSKLQRHKERLEEKIMEQFKSMPSTKKTNLSILYDEPKGGR
NKFLKKAKEILRRNDSKSSVEQEGKNKNENPSRMQRSRSCGTILGSIESI
KNSSIGDKSTDYQIDHTDTSEKEDFLTDNEESEMDCGAPTPKLKSSRLSN
SDTYSMISSISQQESFVSNSTKLIPGSMSIYDRDENEKSQNKEIYNYLQE
LNDKKIKEDKSQTLNKAPDIQKPVMRQEVNVKTLRNHSRPQTSLDLPING
RRPGVHGASVSVYGSSNGNVDSLIFGNITSKNTSNQFCHDNSSVSSNETS
IVVAPVKKSFLSTQPIVPQRKQSLPVTDRFEEELTHPEIAHDIMFNRSSE
NSKRTTNPVIISRPQSTTPGSASSKTILQRMTRNQSKVLAATGESKSRGR
PQTPTGEIRRLSVTNPNNNNYNHVDISPNNNLMNFKPRPQTSLGSANVPS
SSRRPPPVSQRTESNKMSRNSSDIDDFVDKGPIPPMRKESDKLKSNYDSG
SNASDKSEKNKIPQKLYFAYGNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0001965G-protein alpha-subunit binding
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005109frizzled binding
GO:0030165PDZ domain binding
GO:0042802identical protein binding
GO:0043621protein self-association
GO:0003779actin binding
GO:0005515protein binding
GO:0008017microtubule binding
GO:0035091phosphatidylinositol binding
GO:0042803protein homodimerization activity
GO:0043422protein kinase B binding
GO:0051959dynein light intermediate chain binding
Vocabulary: biological process
TermDefinition
GO:0003383apical constriction
GO:0007264small GTPase mediated signal transduction
GO:0016055Wnt signaling pathway
GO:0031098stress-activated protein kinase signaling cascade
GO:0031648protein destabilization
GO:0035567non-canonical Wnt signaling pathway
GO:0090090negative regulation of canonical Wnt signaling pathway
GO:0001932regulation of protein phosphorylation
GO:0006260DNA replication
GO:0006275regulation of DNA replication
GO:0007399nervous system development
GO:0010975regulation of neuron projection development
GO:0016477cell migration
GO:0030030cell projection organization
GO:0030032lamellipodium assembly
GO:0030705cytoskeleton-dependent intracellular transport
GO:0031122cytoplasmic microtubule organization
GO:0031929TOR signaling
GO:0032148activation of protein kinase B activity
GO:0032956regulation of actin cytoskeleton organization
GO:0042127regulation of cell proliferation
GO:0045724positive regulation of cilium assembly
GO:0061024membrane organization
GO:1903566positive regulation of protein localization to cilium
Vocabulary: cellular component
TermDefinition
GO:0030054cell junction
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005794Golgi apparatus
GO:0005813centrosome
GO:0005814centriole
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0016020membrane
GO:0030027lamellipodium
GO:0031252cell leading edge
GO:0031410cytoplasmic vesicle
GO:0036064ciliary basal body
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR027717Girdin
IPR008636Hook-like_fam
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 411..431
NoneNo IPR availableCOILSCoilCoilcoord: 1135..1200
NoneNo IPR availableCOILSCoilCoilcoord: 991..1085
NoneNo IPR availableCOILSCoilCoilcoord: 231..303
NoneNo IPR availableCOILSCoilCoilcoord: 464..505
NoneNo IPR availableCOILSCoilCoilcoord: 531..558
NoneNo IPR availableCOILSCoilCoilcoord: 439..459
NoneNo IPR availableCOILSCoilCoilcoord: 676..794
NoneNo IPR availableCOILSCoilCoilcoord: 567..601
NoneNo IPR availableCOILSCoilCoilcoord: 843..898
NoneNo IPR availableCOILSCoilCoilcoord: 1303..1330
NoneNo IPR availableCOILSCoilCoilcoord: 1208..1277
NoneNo IPR availableCOILSCoilCoilcoord: 1096..1127
NoneNo IPR availableCOILSCoilCoilcoord: 317..351
NoneNo IPR availableCOILSCoilCoilcoord: 190..217
NoneNo IPR availableCOILSCoilCoilcoord: 355..396
NoneNo IPR availableCOILSCoilCoilcoord: 943..970
NoneNo IPR availableCOILSCoilCoilcoord: 802..822
NoneNo IPR availableCOILSCoilCoilcoord: 609..660
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1768..1795
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1360..1389
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1689..1722
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1741..1767
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1427..1447
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1741..1815
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1360..1382
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1647..1677
NoneNo IPR availablePANTHERPTHR18947HOOK PROTEINScoord: 20..1428
NoneNo IPR availableSUPERFAMILYSSF116907Hook domaincoord: 6..158
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 1..152
e-value: 6.8E-28
score: 99.2
IPR008636Hook-like protein familyPFAMPF05622HOOKcoord: 8..617
e-value: 2.1E-19
score: 69.2
IPR027717GirdinPANTHERPTHR18947:SF30GIRDINcoord: 20..1428