Triadin-like isoform X4

Overview
NameTriadin-like isoform X4
Smed IDSMED30004318
Length (bp)4995
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Triadin-like isoform X4 (SMED30004318) t-SNE clustered cells

Violin plots show distribution of expression levels for Triadin-like isoform X4 (SMED30004318) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Triadin-like isoform X4 (SMED30004318) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Triadin-like isoform X4 (SMED30004318) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004318

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004318SMESG000025109.1 dd_Smed_v4_22537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004318SMESG000025109.1 dd_Smed_v4_22537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004318SMESG000025109.1 dd_Smed_v4_22537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004318SMESG000025109.1 dd_Smed_v4_22537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004318SMESG000025109.1 dd_Smed_v4_22537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30004318SMESG000025109.1 dd_Smed_v4_13778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004318SMESG000025109.1 dd_Smed_v4_13778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004318SMESG000025109.1 dd_Smed_v4_13778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004318SMESG000025109.1 dd_Smed_v4_13778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30004318SMESG000025109.1 dd_Smed_v4_13778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30004318SMESG000025109.1 dd_Smed_v4_13778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004318SMESG000025109.1 dd_Smed_v4_13778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004318SMESG000025109.1 dd_Smed_v4_13778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004318SMESG000025109.1 dd_Smed_v6_22537_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004318SMESG000025109.1 dd_Smed_v6_13778_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Triadin-like isoform X4 vs. TrEMBL
Match: V3YYL0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236810 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.368e-13
Identity = 74/222 (33.33%), Postives = 119/222 (53.60%), Query Frame = 1
Query: 4264 FRRIKSNIE-TLKSHIENRKQKP--KEHVPFIFNDLQPYGDTNMYEKFRHQKPKSASGAVT-RMTAMDLCEPWESYEMDKIILPPIRVXXXXXXXXXXXXXKRSARPDKSATKNNISHRSDLG-----YIEPIKEPSKSFIYSERKTLRYKNQSNPRPLPSSRIEDDYNKTKTDLYXXXXXXXXXXXXXXXXXXXXXXXFAYLQNSPGSRRALYEVIHNIDK 4902
            FR+  + IE  LK  + ++ QKP  K+H PFIFNDL+PY DT+  +++  + P+      + R TA+ L +PW++ EMDK +LP   V      +R     K+  + D+ A K      + L       +E     +K   YS+   LR + +       + +IE+DY KTK D YR+ L+++N    +  +    +  FAYLQN+PGS++A+ E + +IDK
Sbjct:   50 FRKELTRIEEGLKKEV-SKIQKPLQKKHTPFIFNDLKPYYDTSS-QRYLIETPEELQHCYSSRTTAIGLIDPWKNLEMDKSVLP---VLEPKAVNRGETQKKKEKKIDERAKKTKHEGSTRLPKYPVVTLETSDLATKKLYYSDVPMLREELKQKYSANATKKIEEDYEKTKQDFYRMDLDKLNEVHPVNREHMRSTY-FAYLQNTPGSKKAINECVKSIDK 265          
BLAST of Triadin-like isoform X4 vs. TrEMBL
Match: A0A1S3J3E8 (uncharacterized protein LOC106169858 OS=Lingula unguis OX=7574 GN=LOC106169858 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.497e-8
Identity = 66/229 (28.82%), Postives = 103/229 (44.98%), Query Frame = 1
Query: 4249 YNDLEFRRIKSNIETLKSHIENRKQKP---KEHVPFIFNDLQPYGDTNMYEKFRHQKPKS----ASGAVTRMTAMDLCEPWESYEMDKIILPPIRVXXXXXXXXXXXXXKRSARPDKSATKNNISHRSDLGYIEPIKEPSKS-----FIYSERKTLRYKNQSNPRPLPSSRIEDDYNKTKTDLYXXXXXXXXXXXXXXXXXXXXXXXFAYLQNSPGSRRALYEVIHNID 4899
            Y   E RR++ N++  K  I     KP   KEH PFIFN L PY  T+    +    P+     +    TR TA+ LC+PW +  MD+   P +               K+    DK   K   S R  L     ++  +K       +YS+  TLR + +         R+ ++YN+TK D +R+ L+++             +  FAYLQN+PG+++A+ E I  +D
Sbjct:   31 YFKEELRRLQKNLKEEKEKI-----KPPPIKEHSPFIFNTLGPYCGTSAA-SYLINGPEDTKLVSRSYATRATAIGLCDPWTALAMDQKPSPRVEPPEIKSLDELSASRKKE---DKDRPKKEGSTR--LPKFPAVEVDAKDMRDRKLLYSDVATLRQEIKDKYTTSAQKRVNEEYNRTKQDFFRMELDKMEEIHPNSRPIMRSAY-FAYLQNTPGAKKAVKECIKEMD 247          
BLAST of Triadin-like isoform X4 vs. TrEMBL
Match: A0A2T7PFQ4 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07688 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.445e-7
Identity = 53/197 (26.90%), Postives = 85/197 (43.15%), Query Frame = 1
Query: 4330 KEHVPFIFNDLQPYGDTNMYEKFRHQKPKSASGAVTRMTAMDLCEPWESYEMDKIILPPIRVXXXXXXXXXXXXXKRSARPDKSATKNNISHRSD--------LGYIEPIKEPSKSFIYSERKTLRYKNQSNPRPLPSSRIEDDYNKTKTDLYXXXXXXXXXXXXXXXXXXXXXXXFAYLQNSPGSRRALYEVIHNI 4896
            K++ PFIFN L PY DT+      + +     G  +R TA  LC+PW    MDK +LP I    + +            +  +   KN    + D        +  +E     ++   YS+   LR + ++        ++E DY +T+ D Y              S+  + S   AYLQN+PGSRRA+ E + ++
Sbjct:  108 KKNTPFIFNSLAPYYDTHTPRFLINLRDGHFMGHTSRRTAQGLCDPWVDLCMDKDVLPAISPQHTTIHEHKKSSKHHGHK--QHEHKNKQERKEDDERMPLFPIVTLETKDLATRQLYYSDVPMLRKELKTKYSSQAQQKVEADYKRTRQDFY-RLDLDKIDQVPPGSRQHMTSTYLAYLQNTPGSRRAVNECVRSL 301          
BLAST of Triadin-like isoform X4 vs. TrEMBL
Match: A0A210PQT0 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT23691 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 3.206e-6
Identity = 62/238 (26.05%), Postives = 109/238 (45.80%), Query Frame = 1
Query: 4261 EFRRIKSNIETLKSHIENRKQKPKEHVPFIFNDLQPYGDTNM--------YEKFRHQKPKSAS----------GAVTRMTAMDLCEPWESYEMDKIILPPIRVXXXXXXXXXXXXXKRSARPDKSATKNNISHRSDLGYIEPIKEPSKSFIYSE----RKTLRYKNQSNPRPLPSSRIEDDYNKTKTDLYXXXXXXXXXXXXXXXXXXXXXXXFAYLQNSPGSRRALYEVIHNIDKEQ 4908
            E RR++  +     +I  +K + KEHVPF++  L+PY +T +         E+ + Q+P S            G  TR TA+ LC+PW    MD+ ILP  ++         P+  K+     + A    +     + +    +  ++ F Y+E    R  L+ +  SN +     +++ DY +TK D Y              ++  +R   FAYLQN+PGSR+A+ + +  +D ++
Sbjct:  691 ELRRLRVRLGKDAENI--KKPQFKEHVPFVWTSLEPYYNTYVPNYLINLPDEELQPQRPVSRGRPSQGDDFHQGYTTRSTAIGLCDPWIDLRMDQSILP--KLEQPKQGKDKPKAQKKKKDASQKAGSTRLPKFPVVDFNAKKENATRKFPYNEVAKFRTELKGRFSSNAQ----KKVDMDYQRTKDDFY-RMDLHRLDEVHPLNRPHMRKTYFAYLQNTPGSRKAVKDCVKTLDTDE 919          
BLAST of Triadin-like isoform X4 vs. TrEMBL
Match: K1RVT4 (Halomucin OS=Crassostrea gigas OX=29159 GN=CGI_10016565 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 6.557e-6
Identity = 67/249 (26.91%), Postives = 114/249 (45.78%), Query Frame = 1
Query: 4258 LEFRRIKSNIETLKSHIENRKQKPKEHVPFIFNDLQPYGDTN----MYEKFRHQKPKSAS---------------GAVTRMTAMDLCEPWESYEMDKIILPPIRVXXXXXXXXXXXXXKRSARPDKSATKNNISHRSDLGYIE----PIKE-------PSKSFIYSERKTLRYKNQSNPRPLPSSRIEDDYNKTKTDLYXXXXXXXXXXXXXXXXXXXXXXXFAYLQNSPGSRRALYEVIHNIDKEQ*Q 4914
             E  R++ +++   S I   K K +EH PF++  L+PY +T     + +    ++P S +               G V+R TA+ LC+PW    MD+ +LP +   S           K  A+  ++A K         G       P+ E        +K F YSE    R +     +     ++  DY++TK D YR+ L+R++    I  +   ++  FAYLQN+PGS++A+ E + +++ EQ Q
Sbjct:  481 AELTRLQRSLKDESSKIS--KPKHREHYPFVWTSLEPYYNTYVARFLIDASETERPVSRARPISRGKLYAEDPQPGYVSRNTAIGLCDPWTDLRMDRELLPRLETPSK----------KSRAKGQQNAKKGKKEKPPKQGSTRLPKFPVVEFSSGKENATKCFPYSEVPKFRQEVMGRYKHDAPKKVNADYSRTKDDFYRMDLDRLDEVHPINRRHMRKAY-FAYLQNTPGSKKAIKECVKDLNGEQEQ 716          
BLAST of Triadin-like isoform X4 vs. Planmine SMEST
Match: SMESG000025109.1 (SMESG000025109.1)

HSP 1 Score: 2726.43 bits (7066), Expect = 0.000e+0
Identity = 1559/1585 (98.36%), Postives = 1562/1585 (98.55%), Query Frame = 1
Query:  154 MESGFSNNKETLRNTLPASPFTDGHTFNNLNLSNENEIKFNEEDEIKQKNTNIRDLNTEIVQQYSCNSAELFHADISIIPSTFEKHPSVTECYQLNXXXXXXXXXXXXQKVNYLDENIEMRKENQTVLSEIIKKSEDETIAEITNCAINNAATDQQPIETCDNIYEAMNENITTEISNIRSEAATYTNKCNNGSNRNIIQTSSLYEMLRQSTKTHLIAGASLIDDHKEDENFQMTSKEDSKKEVNVTISEVKKENYPXXXXXXXXXXXXXXXXXLNIKPHHTISVPQKRTSIDISVLATNPXXXXXXXXXXXXXXXPNNIYSKISKPPLVKYNSTFILTNSKSNSNLPVDKRHSAGEIMNRIKPQLSGTSKENLESEFIRFGSQEILNKTRYGRDNEPNATVDIIFIEKSQLAETNEFSEIIDLKSDQENNEDTYLNPEIINIDKDNLEIETGKTTEMESEISPSLDQSVELSELMKNETEFDKISDITEKEFSEISEMAPKQDLEEDVIIQANHIQEGTQKEEILHADQTEIIDKSDAIENDSELETLTTFEENDAKKVNTKSYQELENNDFKEANNDIKGSELIIQRCLEIEEHDDSNIDTNSHDKIEIENNDSNQQXXXXXXXXXXXXXXXXKLSSEIVNPKSEFEVYAEQKYVCVEDDSLFVGKQEINISLIVVKSLLSEMISKIFDTVSDSPHQSLHIINAIINELVDGIKINLEIDPFNKNDQVGDRFTAVSFIVDIIYEVIDKICCVKDLSHQEHDENQEINESQTSHTSLPNKLNLYEDENPIDTLQNETVAESKQPLQELDTSLPVELNLSPKIEGKKMRINQRPTKKEIKIEKDNSKKLSTAKETTGKFKPNFDRKRSTTKVLNKSQRRLSFDLENRRRKESISRKLSDMTLDKLNRDFSEVKSDTISDPENNEDLDLTTEKVPGEIFVKVNNNENEFSEDHIDESEKNVTIENKSTEATEDQTVVNNDVEALEQXXXXXXXXXXXXAAESDDIHIPNESQIQLSDETNKANPEEKELKKPVTKPSNDEDIITVIKRRLSLNQPPTVVNETDTKPRSISTTTKPRPLKRYASLVELSLKRTNKNLTKSNEECKNTDDIKEECQIEKNFSXXXXXXXXXXXXXXXXXXXXXXXXXXKSFDAPLDKGENFINQNEIKVTTVLKEECNENEMNEDRKSKMSSVHTVTIEVRDETSEMIGESDVLITEENKPWIIDNWDCNPNMNNDDXXXXXXXXXXXXXQKPLLPIIVNDIKFELRKKIKTTNYKPAPVENYFTKPADRRDSKPEKPDSKAKVEVKHENFKKNTKENPIEPLEKKTENSFTKLNRTKLKEPILVKAPQKKFNTDETQKIDKSVLYSKYNDLEFRRIKSNIETLKSHIENRKQKPKEHVPFIFNDLQPYGDTNMYEKFRHQKPKSASGAVTRMTAMDLCEPWESYEMDKIILPPIRVXXXXXXXXXXXXXKRSARPDKSATKNNISHRSDLGYIEPIKEPSKSFIYSERKTLRYKNQSNPRPLPSSRIEDDYNKTKTDLYXXXXXXXXXXXXXXXXXXXXXXXFAYLQNSPGSRRALYEVIHNIDKEQ 4908
            MESGFSNNKETLRNTLPASPFTDGHTFNNLNLSNENEIKFNEEDEIKQKNTNIRDLNTEIVQQYSCNSAELFHADISIIPSTFEKHPSVTECYQLNDIKEESDEDIESQKVNYLDENIEMRKENQTVL+EIIKKSEDETIAEITNCAINNAATDQQPIETCDNIYEAMNENITTEISNIRSEAATYTNKCNNGSNRNIIQTSSLYEMLRQSTKTHLIAGASLIDDHKEDENFQMTSKEDSKKEVNVTISEVKKENYPKVVKNKISSSRSKSFGSLNIKPHHTISVPQKRTSIDISVLATNPLLKSTSKTNIKKISLPNNIYSKISKPPLVKYNST ILTNSKSNSNLPVDKRHSAGEIMNRIKPQLSGTSKENLESEFIRFGSQEILNKTRYGRDNEPNATVDIIFIEKSQLAETNEFSE IDLKSDQENNEDTYLNPEIINIDKDNLEIETGKTTEMESEISPSLDQSVELSELMKNETEFDKISDITEKEFSEISEMAPKQDLEEDVIIQANHIQEGTQKEEILHADQTEIIDKSDAIENDSELETLTTFEENDAK +NTKSYQELENNDFKEANNDIKGSE IIQRCLEIEEHDDSNIDTNSHDKIEIENNDSNQQEAIEEDIVNDEIEVEEKLSSEIVNPKSEFEVYAEQKYVCVEDDSLFVGKQEINISLIVVKSLLSEMISKIFDTVSDSPHQSLHIINAIINELVDGIKINLEIDPFNKNDQVGDRFTAVSFIVDIIYEVIDKICCVKDLSHQEHDENQEINESQTSHTSLPNKLNLYEDENPIDTLQNETVAESKQPLQELDTSLPVELNLSPKIEGKKMRINQRPTKKEIKIEKDNSKKLSTAKETTGKFKPN DRKRSTTKVLNKSQRRLSFDLENRRRKESISRKLSDMTLDKLNRDFSEVKSDTISDPENNEDLDLTTE                FSEDHIDESEKNVTIENKSTEATEDQTVVNNDVEALEQPNEPENIINEPIAAESDDIHIPNESQIQLSDETNKANPEEKELKKPVTKPSNDEDIITVIKRRLSLNQPPTVVNETDTKPRSISTTTKPRPLKRYASLVELSLKR NKNLTKSNEECKNTDDIKEECQIEKNFSEETETKLNLEKEKEENDEIVNKEEIDKSFDAPLDKGENFINQNEIKVTTVLKEECNENEMNEDRKSKMSSVHTVTIEVRDETSEMIGESDVLITEENKPWIIDNWDCNPNMNNDDENKEETIKEFEEIQKPLLPIIVNDIKFELRKKIKTTNYKPAPVENYFTKPADRRDSKPEKPDSKAKVEVKHENFKKNTKENPIEPLEKKTENSFTKLNRTKLKEPILVKAPQKKFNTDETQKIDKSVLYSKYNDLEFRRIKSNIETLKSHIENRKQKPKEHVPFIFNDLQPYGDTNMYEKFRHQKPKSASGAVTRMTAMDLCEPWESYEMDKIILPPIRVSSSYLSSRSPQLSKRSARPDKSATKN ISHRSDLGYIEPIKEPSKSFIYSERKTLRYKNQSNPRPLPSSRIEDDYNKTKTDLYRLSLNRINS+KSIRSKSAIRSALFAYLQNSPGSRRALYEVIHNIDKEQ
Sbjct:    1 MESGFSNNKETLRNTLPASPFTDGHTFNNLNLSNENEIKFNEEDEIKQKNTNIRDLNTEIVQQYSCNSAELFHADISIIPSTFEKHPSVTECYQLNDIKEESDEDIESQKVNYLDENIEMRKENQTVLTEIIKKSEDETIAEITNCAINNAATDQQPIETCDNIYEAMNENITTEISNIRSEAATYTNKCNNGSNRNIIQTSSLYEMLRQSTKTHLIAGASLIDDHKEDENFQMTSKEDSKKEVNVTISEVKKENYPKVVKNKISSSRSKSFGSLNIKPHHTISVPQKRTSIDISVLATNPLLKSTSKTNIKKISLPNNIYSKISKPPLVKYNSTSILTNSKSNSNLPVDKRHSAGEIMNRIKPQLSGTSKENLESEFIRFGSQEILNKTRYGRDNEPNATVDIIFIEKSQLAETNEFSETIDLKSDQENNEDTYLNPEIINIDKDNLEIETGKTTEMESEISPSLDQSVELSELMKNETEFDKISDITEKEFSEISEMAPKQDLEEDVIIQANHIQEGTQKEEILHADQTEIIDKSDAIENDSELETLTTFEENDAKNMNTKSYQELENNDFKEANNDIKGSESIIQRCLEIEEHDDSNIDTNSHDKIEIENNDSNQQEAIEEDIVNDEIEVEEKLSSEIVNPKSEFEVYAEQKYVCVEDDSLFVGKQEINISLIVVKSLLSEMISKIFDTVSDSPHQSLHIINAIINELVDGIKINLEIDPFNKNDQVGDRFTAVSFIVDIIYEVIDKICCVKDLSHQEHDENQEINESQTSHTSLPNKLNLYEDENPIDTLQNETVAESKQPLQELDTSLPVELNLSPKIEGKKMRINQRPTKKEIKIEKDNSKKLSTAKETTGKFKPNSDRKRSTTKVLNKSQRRLSFDLENRRRKESISRKLSDMTLDKLNRDFSEVKSDTISDPENNEDLDLTTE----------------FSEDHIDESEKNVTIENKSTEATEDQTVVNNDVEALEQPNEPENIINEPIAAESDDIHIPNESQIQLSDETNKANPEEKELKKPVTKPSNDEDIITVIKRRLSLNQPPTVVNETDTKPRSISTTTKPRPLKRYASLVELSLKRRNKNLTKSNEECKNTDDIKEECQIEKNFSEETETKLNLEKEKEENDEIVNKEEIDKSFDAPLDKGENFINQNEIKVTTVLKEECNENEMNEDRKSKMSSVHTVTIEVRDETSEMIGESDVLITEENKPWIIDNWDCNPNMNNDDENKEETIKEFEEIQKPLLPIIVNDIKFELRKKIKTTNYKPAPVENYFTKPADRRDSKPEKPDSKAKVEVKHENFKKNTKENPIEPLEKKTENSFTKLNRTKLKEPILVKAPQKKFNTDETQKIDKSVLYSKYNDLEFRRIKSNIETLKSHIENRKQKPKEHVPFIFNDLQPYGDTNMYEKFRHQKPKSASGAVTRMTAMDLCEPWESYEMDKIILPPIRVSSSYLSSRSPQLSKRSARPDKSATKNKISHRSDLGYIEPIKEPSKSFIYSERKTLRYKNQSNPRPLPSSRIEDDYNKTKTDLYRLSLNRINSNKSIRSKSAIRSALFAYLQNSPGSRRALYEVIHNIDKEQ 1569          
BLAST of Triadin-like isoform X4 vs. Planmine SMEST
Match: SMESG000069834.1 (SMESG000069834.1)

HSP 1 Score: 61.6178 bits (148), Expect = 8.423e-10
Identity = 57/218 (26.15%), Postives = 105/218 (48.17%), Query Frame = 1
Query: 4273 IKSNIETLKSHIENRKQKPKEHVPFIFNDLQPYGDTNMYEKFRHQKPKSASGAVTRMTAMDLCEPW------ESYEMDKIILPPIRVXXXXXXXXXXXXXKRSARPDKSATKNNISHRSDLGYIEPIKEPS---KSFIYSERKTLRYKNQSNPRPLPSSRIEDDYNKTKTDLYXXXXXXXXXXXXXXXXXXXXXXXFAYLQNSPGSRRALYEVIHNID 4899
            +K  +E L   ++  + + KE +P ++NDL PY  T + E    +     +G + R TA+DLC+PW      +    DKIIL   R         + +  K   +   + +K   +H     Y+  +++P    K   + +   LR     N     + +I+ +Y +TK D YR+ L++++    +   +   +  +AYLQN+PGS++A+ E I N++
Sbjct:   31 VKEKLEHLTEKVKKNQYEKKEFIPDVYNDLHPY--TEISEFILKKNNDKENGFLLRNTAVDLCDPWVDLKYDQEIRTDKIILVTPR--------ENMENKKTPKQKSSNQSKEGSTHLPKY-YVSNLEDPDLAKKELYFIDVPMLRKTLHDNFSINSTEKIDFEYTRTKQDFYRMGLDKLDEIHPMNRDNLKSTY-YAYLQNNPGSKKAIRECIKNLE 236          
The following BLAST results are available for this feature:
BLAST of Triadin-like isoform X4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3YYL03.368e-1333.33Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3J3E87.497e-828.82uncharacterized protein LOC106169858 OS=Lingula un... [more]
A0A2T7PFQ41.445e-726.90Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A210PQT03.206e-626.05Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
K1RVT46.557e-626.91Halomucin OS=Crassostrea gigas OX=29159 GN=CGI_100... [more]
back to top
BLAST of Triadin-like isoform X4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triadin-like isoform X4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000025109.10.000e+098.36SMESG000025109.1[more]
SMESG000069834.18.423e-1026.15SMESG000069834.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004318 ID=SMED30004318|Name=Triadin-like isoform X4|organism=Schmidtea mediterranea sexual|type=transcript|length=4995bp
CTTAAAACACTGACAAATTTTGACAAAAGTTCAAAGGTTGTTGACCATAA
ATTTGATATTTACTGACAACAGAGTGTAAATATCACCGCTTGGATTGACA
TGGTAACGCTGCTTGGATATTATTTTTAGATTTTTATCACGAGAAATTTG
AATATGGAATCAGGATTTTCGAATAATAAAGAAACATTGAGGAATACCCT
TCCAGCCAGCCCCTTTACTGATGGACATACTTTTAACAACTTAAACCTTT
CGAATGAGAATGAAATAAAGTTCAATGAAGAAGACGAGATCAAACAGAAA
AATACAAATATAAGAGACTTAAATACCGAGATTGTGCAACAGTACAGTTG
CAACTCAGCAGAGTTATTTCATGCCGACATTTCAATAATTCCTTCTACAT
TTGAGAAACACCCTTCAGTTACAGAGTGTTACCAGTTGAATGACATAAAG
GAAGAAAGTGATGAAGACATAGAAAGTCAAAAAGTAAATTATTTAGATGA
AAACATAGAAATGAGAAAAGAAAATCAAACAGTTTTATCGGAAATCATAA
AGAAAAGTGAAGATGAAACCATTGCTGAGATAACTAATTGTGCAATTAAT
AATGCAGCAACCGATCAACAGCCGATTGAGACGTGTGACAATATATATGA
AGCAATGAATGAGAATATCACAACGGAAATATCTAATATCAGATCGGAAG
CAGCAACCTATACGAATAAATGCAATAATGGATCAAACAGAAATATCATA
CAGACATCATCATTGTATGAAATGTTACGACAGTCTACCAAAACACATTT
GATCGCAGGAGCATCCTTAATAGATGACCATAAGGAAGATGAAAACTTTC
AAATGACCTCAAAAGAAGACTCAAAGAAAGAAGTCAACGTTACTATTAGT
GAAGTAAAGAAAGAGAATTATCCAAAAGTCGTTAAAAATAAAATAAGTTC
ATCTCGTTCAAAGTCTTTTGGAAGTTTAAACATCAAACCTCACCATACAA
TTTCGGTGCCGCAAAAAAGAACAAGCATTGACATTAGTGTCTTGGCCACA
AATCCACTATTAAAGTCAACTTCCAAAACAAATATCAAGAAAATATCTCT
TCCTAACAATATTTATTCAAAAATTTCAAAGCCGCCGCTTGTGAAATATA
ATTCAACGTTCATTCTCACTAATAGCAAAAGCAATTCAAACCTTCCAGTG
GACAAGAGGCATTCCGCAGGAGAGATTATGAATCGCATAAAACCACAATT
GTCTGGCACGTCAAAGGAGAACCTTGAATCTGAATTCATTCGATTTGGAA
GCCAAGAAATACTCAATAAAACTCGATATGGAAGGGACAATGAACCTAAT
GCTACAGTTGACATAATATTTATAGAGAAATCCCAACTCGCAGAAACTAA
TGAGTTCTCGGAAATAATTGATCTGAAATCAGACCAGGAAAACAATGAGG
ACACTTATCTCAACCCTGAAATCATCAACATTGACAAAGATAACCTTGAA
ATAGAAACTGGAAAAACAACAGAAATGGAAAGTGAAATTTCTCCCTCTCT
TGATCAGTCAGTGGAGCTGAGTGAGCTTATGAAAAACGAAACAGAATTTG
ATAAAATAAGCGATATAACCGAAAAAGAGTTCAGCGAAATAAGTGAAATG
GCTCCTAAGCAGGACCTTGAAGAGGATGTAATTATACAAGCTAATCATAT
TCAAGAGGGGACACAAAAGGAGGAAATTCTCCACGCCGATCAAACTGAAA
TCATTGACAAATCCGATGCCATTGAAAATGATAGTGAACTTGAGACTTTG
ACCACTTTCGAAGAGAATGATGCAAAAAAAGTGAATACAAAATCTTATCA
AGAATTGGAGAATAATGACTTCAAAGAGGCAAACAATGATATAAAAGGTA
GCGAGTTAATAATCCAAAGATGTTTAGAAATTGAGGAACATGATGATTCA
AACATTGATACAAACAGCCACGACAAAATAGAAATAGAAAATAACGACTC
TAACCAGCAGGAGGCAATAGAAGAGGACATTGTAAATGATGAAATTGAAG
TTGAAGAGAAACTGTCTTCAGAAATCGTAAATCCTAAAAGCGAATTTGAG
GTTTATGCGGAACAGAAATACGTTTGCGTAGAAGATGACTCATTATTTGT
TGGAAAGCAAGAAATTAATATCTCGTTAATTGTTGTAAAGAGCCTTCTGT
CTGAAATGATAAGCAAAATATTTGATACCGTTTCTGACAGTCCTCATCAA
TCACTTCACATTATTAATGCCATCATCAATGAACTTGTAGATGGGATTAA
AATTAACCTTGAGATAGATCCTTTCAATAAAAATGATCAAGTAGGTGACC
GATTTACGGCCGTTTCATTTATTGTTGATATAATTTATGAAGTAATAGAT
AAGATATGCTGCGTAAAAGATTTATCACATCAGGAACACGATGAAAATCA
AGAAATAAACGAATCACAGACAAGTCACACATCCTTACCAAACAAGTTAA
ATCTTTATGAAGATGAAAATCCAATTGATACCCTTCAAAATGAAACCGTA
GCAGAATCAAAGCAGCCTTTGCAAGAATTGGATACGAGTTTACCGGTCGA
ATTAAATCTTAGCCCAAAAATTGAAGGTAAAAAAATGCGTATTAATCAAA
GACCAACGAAAAAAGAAATTAAAATAGAAAAAGATAACTCAAAAAAGCTT
TCAACAGCAAAAGAAACAACTGGAAAATTTAAACCAAATTTTGACAGAAA
ACGGTCCACAACGAAAGTTTTAAACAAATCACAAAGACGATTATCTTTTG
ATTTAGAAAATAGGCGCAGAAAGGAATCAATCAGCAGAAAGCTTTCGGAC
ATGACTCTAGATAAATTGAACAGAGACTTTTCAGAAGTGAAATCTGATAC
AATTTCTGATCCAGAAAACAACGAAGACCTTGATTTAACTACAGAAAAAG
TTCCTGGCGAAATATTTGTAAAAGTAAATAACAATGAAAATGAATTTTCA
GAAGACCACATTGACGAAAGTGAGAAAAATGTAACAATTGAAAACAAGTC
TACCGAAGCAACAGAAGATCAGACAGTGGTTAACAACGACGTAGAAGCTT
TGGAACAACCAAACGAACCAGAAAATATAATAAATGAACCTATTGCAGCT
GAGTCTGATGATATACATATTCCAAATGAAAGCCAAATTCAACTTTCAGA
TGAAACAAATAAAGCAAATCCTGAAGAAAAAGAACTCAAAAAACCAGTTA
CCAAACCATCAAATGATGAGGATATAATAACCGTCATTAAAAGGCGGTTA
AGTTTAAACCAACCTCCAACGGTTGTCAATGAGACGGATACAAAACCGAG
ATCAATATCAACAACAACCAAACCAAGACCACTCAAAAGATACGCTTCTT
TAGTTGAATTATCTCTTAAAAGAACAAATAAAAATTTAACAAAATCGAAT
GAAGAATGTAAAAATACTGATGACATCAAAGAAGAATGTCAAATTGAAAA
GAATTTTAGTGAAGAAACTGAAACAAAACTAAATCTTGAAAAGGAAAAAG
AAGAAAATGATGAAATTGTTAACAAAGAAGAGATTGATAAAAGTTTTGAT
GCTCCACTCGACAAAGGCGAAAACTTTATAAATCAAAATGAAATCAAAGT
CACGACTGTCTTGAAAGAGGAATGCAACGAAAATGAAATGAACGAGGATA
GAAAGTCCAAAATGTCTTCCGTTCACACTGTAACAATAGAAGTCAGAGAT
GAAACCAGTGAAATGATAGGAGAATCAGATGTGTTGATTACTGAGGAAAA
CAAACCTTGGATAATAGATAATTGGGACTGTAATCCAAACATGAACAACG
ATGATGAAAATAAAGAGGAAACTATAAAAGAGTTCGAAGAAATCCAAAAA
CCACTGCTACCAATTATAGTGAATGATATAAAATTTGAGCTCCGAAAAAA
GATAAAAACAACCAATTACAAACCAGCTCCGGTTGAAAACTATTTTACTA
AGCCAGCCGATCGTCGCGATAGCAAGCCAGAAAAGCCAGACAGTAAAGCG
AAAGTCGAAGTCAAACATGAGAATTTCAAGAAAAATACAAAAGAAAACCC
CATTGAACCCCTGGAAAAAAAGACAGAAAACTCATTCACGAAACTCAATC
GAACAAAACTTAAAGAGCCTATTTTAGTTAAAGCACCACAGAAGAAATTC
AATACGGACGAAACTCAGAAAATAGACAAAAGTGTTCTTTATTCCAAATA
CAACGACCTAGAGTTCCGACGAATCAAATCGAACATTGAAACTTTGAAGA
GTCACATCGAAAATCGCAAACAGAAACCAAAGGAGCACGTCCCATTCATA
TTCAATGACCTGCAGCCGTATGGAGACACAAATATGTACGAGAAATTCCG
GCATCAAAAACCTAAATCAGCTTCTGGAGCAGTAACACGGATGACTGCAA
TGGACCTTTGTGAGCCTTGGGAGAGCTATGAAATGGATAAAATAATTTTA
CCTCCAATTAGAGTATCTTCTTCTTATCTTTCCTCTAGATCTCCACAACT
CTCAAAAAGGTCTGCACGTCCTGACAAGTCAGCAACCAAGAATAATATTT
CTCATAGATCAGATCTTGGGTACATTGAGCCAATCAAAGAACCTAGTAAA
TCATTCATTTACAGCGAGAGAAAGACCTTGAGATATAAAAACCAATCCAA
TCCTAGACCATTACCTTCAAGTAGAATCGAAGATGACTACAATAAAACAA
AAACTGATTTGTACCGTCTTTCACTGAACCGGATCAATTCTAGTAAGTCC
ATTCGCAGTAAATCTGCCATTCGCAGTGCCTTATTTGCCTACCTACAGAA
CTCACCGGGATCTAGAAGAGCGCTTTATGAAGTTATTCACAACATTGACA
AGGAACAATGACAATAGACATTATATATCCCCCTGAATAGAGTATTAGAA
TTCCATCTGAGATTTTTATTTATTCCAATTGGAAAATCAGAAGAT
back to top

protein sequence of SMED30004318-orf-1

>SMED30004318-orf-1 ID=SMED30004318-orf-1|Name=SMED30004318-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1586bp
MESGFSNNKETLRNTLPASPFTDGHTFNNLNLSNENEIKFNEEDEIKQKN
TNIRDLNTEIVQQYSCNSAELFHADISIIPSTFEKHPSVTECYQLNDIKE
ESDEDIESQKVNYLDENIEMRKENQTVLSEIIKKSEDETIAEITNCAINN
AATDQQPIETCDNIYEAMNENITTEISNIRSEAATYTNKCNNGSNRNIIQ
TSSLYEMLRQSTKTHLIAGASLIDDHKEDENFQMTSKEDSKKEVNVTISE
VKKENYPKVVKNKISSSRSKSFGSLNIKPHHTISVPQKRTSIDISVLATN
PLLKSTSKTNIKKISLPNNIYSKISKPPLVKYNSTFILTNSKSNSNLPVD
KRHSAGEIMNRIKPQLSGTSKENLESEFIRFGSQEILNKTRYGRDNEPNA
TVDIIFIEKSQLAETNEFSEIIDLKSDQENNEDTYLNPEIINIDKDNLEI
ETGKTTEMESEISPSLDQSVELSELMKNETEFDKISDITEKEFSEISEMA
PKQDLEEDVIIQANHIQEGTQKEEILHADQTEIIDKSDAIENDSELETLT
TFEENDAKKVNTKSYQELENNDFKEANNDIKGSELIIQRCLEIEEHDDSN
IDTNSHDKIEIENNDSNQQEAIEEDIVNDEIEVEEKLSSEIVNPKSEFEV
YAEQKYVCVEDDSLFVGKQEINISLIVVKSLLSEMISKIFDTVSDSPHQS
LHIINAIINELVDGIKINLEIDPFNKNDQVGDRFTAVSFIVDIIYEVIDK
ICCVKDLSHQEHDENQEINESQTSHTSLPNKLNLYEDENPIDTLQNETVA
ESKQPLQELDTSLPVELNLSPKIEGKKMRINQRPTKKEIKIEKDNSKKLS
TAKETTGKFKPNFDRKRSTTKVLNKSQRRLSFDLENRRRKESISRKLSDM
TLDKLNRDFSEVKSDTISDPENNEDLDLTTEKVPGEIFVKVNNNENEFSE
DHIDESEKNVTIENKSTEATEDQTVVNNDVEALEQPNEPENIINEPIAAE
SDDIHIPNESQIQLSDETNKANPEEKELKKPVTKPSNDEDIITVIKRRLS
LNQPPTVVNETDTKPRSISTTTKPRPLKRYASLVELSLKRTNKNLTKSNE
ECKNTDDIKEECQIEKNFSEETETKLNLEKEKEENDEIVNKEEIDKSFDA
PLDKGENFINQNEIKVTTVLKEECNENEMNEDRKSKMSSVHTVTIEVRDE
TSEMIGESDVLITEENKPWIIDNWDCNPNMNNDDENKEETIKEFEEIQKP
LLPIIVNDIKFELRKKIKTTNYKPAPVENYFTKPADRRDSKPEKPDSKAK
VEVKHENFKKNTKENPIEPLEKKTENSFTKLNRTKLKEPILVKAPQKKFN
TDETQKIDKSVLYSKYNDLEFRRIKSNIETLKSHIENRKQKPKEHVPFIF
NDLQPYGDTNMYEKFRHQKPKSASGAVTRMTAMDLCEPWESYEMDKIILP
PIRVSSSYLSSRSPQLSKRSARPDKSATKNNISHRSDLGYIEPIKEPSKS
FIYSERKTLRYKNQSNPRPLPSSRIEDDYNKTKTDLYRLSLNRINSSKSI
RSKSAIRSALFAYLQNSPGSRRALYEVIHNIDKEQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013989Dev_and_cell_death_domain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 39..59
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1443..1468
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1452..1468
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 849..871
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1003..1019
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 849..874
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 994..1019
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1266..1287
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20