Bestrophin homolog

Overview
NameBestrophin homolog
Smed IDSMED30004315
Length (bp)2003
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bestrophin homolog (SMED30004315) t-SNE clustered cells

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30004315) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bestrophin homolog (SMED30004315) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30004315) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004315

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004315SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004315SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004315SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004315SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004315SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004315SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004315SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30004315SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004315SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST1 (bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703])

HSP 1 Score: 250.366 bits (638), Expect = 8.017e-74
Identity = 141/377 (37.40%), Postives = 218/377 (57.82%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQ 1437
            MT++Y+  +++ +    F +LL  W+GS+YKL+Y + + ++  YY+I  IYR AL T  Q+  FE++  +CD+    IPISF+LGF+VT V+ RW+  Y  +P+ +R+  L  G + G D++  L +R+TL+RY NL  +L +R VS  +  RF                    +    +Q+ F   +T AE +  E ++  +           FWVP  W + L  KA++ G I DP  L S++++++ LR Q   L  +  I IPLVYTQV+ +AVYS+FL  L   QF++P     GHE+DL VP+FT  QF F++GWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  +V       P  ++P   W K +
Sbjct:    1 MTITYTSQVANAR-LGSFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRLAL-TEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQGRL-LRRTLIRYANLGNVLILRSVSTAVYKRFP-------------------SAQHLVQAGF---MTPAEHKQLEKLSLPHNM---------FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPR-MEPDMYWNKPE 342          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 243.432 bits (620), Expect = 5.465e-72
Identity = 138/356 (38.76%), Postives = 210/356 (58.99%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F +LL  W+GS+YKL++++L+ ++G Y  ++  YRF L T  QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V RG+   L  +  I +PLVYTQV+ IA+YSYFL  L   QF+DP      H++DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVL-TEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 243.432 bits (620), Expect = 5.465e-72
Identity = 138/356 (38.76%), Postives = 210/356 (58.99%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F +LL  W+GS+YKL++++L+ ++G Y  ++  YRF L T  QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V RG+   L  +  I +PLVYTQV+ IA+YSYFL  L   QF+DP      H++DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVL-TEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 243.432 bits (620), Expect = 5.465e-72
Identity = 138/356 (38.76%), Postives = 210/356 (58.99%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F +LL  W+GS+YKL++++L+ ++G Y  ++  YRF L T  QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V RG+   L  +  I +PLVYTQV+ IA+YSYFL  L   QF+DP      H++DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVL-TEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 239.195 bits (609), Expect = 9.447e-72
Identity = 130/356 (36.52%), Postives = 208/356 (58.43%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  +++   F  F +LL +W+GS+YKL+Y++ + +  +Y  I+L+YR  L T  QKR FE++  +CD     IP++F+LGF+VT V+ RW+  ++ +P+ +R+ FL    ++G D+   L +R+TLMRY+NL+ +L  R VS  +  RF                      D  +++ F   +T  E + F ++ + +          ++WVP  W   L  KA   G I D   L S++++++  R     L  +  + IPLVYTQV+ +AVY++F   L   QF+DP     GH++DLY+PIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+  +D NL V+  +V
Sbjct:    1 MTVTYSSKVANAT-FFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLL-TGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRL-LRRTLMRYVNLTSLLIFRSVSTAVYKRFP-------------------TMDHVVEAGF---MTTDERKLFNHLKSPHL---------KYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-23 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:A5JYR2])

HSP 1 Score: 197.593 bits (501), Expect = 1.734e-56
Identity = 124/352 (35.23%), Postives = 185/352 (52.56%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVT 1362
            MT+SYS+          F+KLL RWKGSL+K ++K L+ ++ +YY+IN  YRF + T  Q+  F + V   D     IP++FLLGF+V  ++ RW+     I + + + +    LI G D E  + IR+T+ RY  L+ +L  R +S ++  R+                      D  + S    ++T  E+  F++I        K      +WVP+ W   ++ + F  G ++    L  ++  L+  R     L I+  I IPLVYTQV  I+VY YFL  L   Q+  P        VD+YVPIFTI QFLF++GWLKV   +M PFG DDEDF+ + IL+ NL+V+
Sbjct:    1 MTISYSDT---------FLKLLFRWKGSLWKAIWKHLLIFLTMYYIINAYYRFGM-TKEQQNEFIKYVMLVDGWTKEIPLTFLLGFYVAMIVRRWWDCCQLISWPDHLLYNVSALIRGQDPETRI-IRKTIARYTILTSVLAWRSISLRVLARYP-------------------TDDHLVDS---GLMTKEEMVMFKSILVHVDPHQK------WWVPLNWIQTMMVRCFEKGTLTHTNELRVLLDALEKYRNGFFQLFIYDWIAIPLVYTQVSTISVYGYFLFALIGRQY--PSKNENEEIVDVYVPIFTILQFLFYVGWLKVGEDLMFPFGADDEDFEFNYILERNLEVS 311          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-3 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17206])

HSP 1 Score: 201.83 bits (512), Expect = 3.230e-56
Identity = 123/368 (33.42%), Postives = 199/368 (54.08%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLING-GDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITG---HEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYP 1398
            MTV+YS D++    F ++ KLL RWKGS++K V+ +L+ ++ +Y V+++IYR  L T  Q+ +FE++  F D   N IPI+F+LGF+V+ V  RW+Q++  I +++         I G  ++ KC  +R+  +RY  L+  +  R V+  +  RF            F H                 ++T+ E+  FE+I + +          ++W P+ W   ++  A   G IS       ++  +   R  + +L +F  + +PLVYTQV+ +AV SYFL  LF  Q++ PES         +DLYVPI ++ QF+FF+GW+KVA  ++NP G+DD+DF+ + ILD NL V    V    + YP
Sbjct:    1 MTVTYSLDVASSSFFCLY-KLLFRWKGSIWKSVWAELVVWLCLYAVLSVIYR-CLLTMKQRATFEDLCIFFDTYSNFIPITFMLGFYVSAVFTRWWQIFDNIGWIDTPCLWITQYIKGETERAKC--VRRNCIRYSILTQAMVYRDVAASVRKRFPT----------FNHLVTA------------GLMTEKEMAEFESIPSPH---------AKYWQPMHWLFSMITLARDEGMISSDIIYVDLMEKMRQFRVNILSLTLFDWVPVPLVYTQVVHLAVRSYFLIALFGRQYLHPESNRLNDFKQTIDLYVPIMSLLQFIFFIGWMKVAEVLLNPLGEDDDDFECNWILDRNLQVGLMVVDTAYNRYP 333          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-5 (Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:P34319])

HSP 1 Score: 196.052 bits (497), Expect = 1.651e-55
Identity = 110/365 (30.14%), Postives = 189/365 (51.78%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPE 1401
            ++ +Y+ D++  +  MI ++++ +W+GSL++ VYK+L+ ++  Y ++++IYRFAL T +QK  FE   ++CD     +P++F+LGFF   +I RW +LY  +  ++ +A      + G D ++  +IR+ ++RY  +S  L  R +   +  RF   +          H    FN    I+S ++K                            +WV   W+  LL  A     I      N+I  ++   R  + T+ ++  + IPL+Y Q++ +AV++YF   +F  QF          EVDLY+P  TI +F+F+MGWLKVAM ++NPFG+D +DF  + ++D NL +   SV       PE
Sbjct:   44 LSYNYNYDLATSKSLMI-VRMIFKWRGSLWQAVYKELIVWICAYSLVSVIYRFAL-TRSQKDIFERFGEYCDARMGYLPLNFVLGFFCNIIIRRWLKLYTSLGNIDNIALFVSAYVRGTD-DRARQIRRNIIRYCVISQCLVFRDIHVGVRRRFPTLEAVAQAGIMLPHELEKFN---SIKSRYQK----------------------------YWVSFNWALELLNVAKTEKSIDGDNARNAIAQEISKFRSALTTVSMYDWVPIPLMYPQLVNMAVHTYFFLCIFTRQFFISADAHNKTEVDLYIPFMTIIEFIFYMGWLKVAMELLNPFGEDADDFDCNLLIDRNLAIGLTSVDDAYDQLPE 374          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-8 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O62095])

HSP 1 Score: 196.052 bits (497), Expect = 7.057e-55
Identity = 128/388 (32.99%), Postives = 198/388 (51.03%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCD-NMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHL-----DPPAMWYKTQKNCDE 1452
            MTVSY+ D+S    F  F KLL RW+GS++K ++ +L+ ++  YY++ + YR AL T  QK    + +   D N+   +P++F+L FFVT ++ RW  ++  I ++   A     L+ G + +  L  ++T++RYL L+ +L  R +S ++  RF                    N D  I++ F   + D E      I   +  +T       +W+P+ WSS +LQK F  G I      NS+  ++   R  M TL  +  + IP+ Y QV+  AV  YF   LF  Q +D E   T   +D Y PI T+FQF FFMGW+KVA  ++NP G+DD+DF+ + ++D N+      V +  S  PE L     DP    Y  +K  D 
Sbjct:    1 MTVSYNLDVS-SVSFFNFFKLLFRWRGSVWKSIWSELVLWLLGYYLVMVTYRVALTT-EQKAGVRKYIDHLDQNLDKCVPLTFMLAFFVTIIVDRWKNMFANIGFIENTAIAIATLVKGTEGDVLLA-KRTIIRYLVLTQVLVFRDISLKVRRRFP-------------------NHDAIIKAGF---LQDHE----SIILGGDNGRTN------YWMPVNWSSAILQKLFEDGNIPAAPLFNSVWQEVKTFRSNMATLCNYDWVPIPIAYPQVVFFAVRVYFFTCLFTRQHLDMEDTKT---IDYYFPILTVFQFTFFMGWMKVAEALLNPLGEDDDDFECNYLIDRNIATGMAIVNSKYSDVPEMLADKFNDPSYAPYYPEKVIDS 350          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-8 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O62095])

HSP 1 Score: 196.052 bits (497), Expect = 7.057e-55
Identity = 128/388 (32.99%), Postives = 198/388 (51.03%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCD-NMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHL-----DPPAMWYKTQKNCDE 1452
            MTVSY+ D+S    F  F KLL RW+GS++K ++ +L+ ++  YY++ + YR AL T  QK    + +   D N+   +P++F+L FFVT ++ RW  ++  I ++   A     L+ G + +  L  ++T++RYL L+ +L  R +S ++  RF                    N D  I++ F   + D E      I   +  +T       +W+P+ WSS +LQK F  G I      NS+  ++   R  M TL  +  + IP+ Y QV+  AV  YF   LF  Q +D E   T   +D Y PI T+FQF FFMGW+KVA  ++NP G+DD+DF+ + ++D N+      V +  S  PE L     DP    Y  +K  D 
Sbjct:    1 MTVSYNLDVS-SVSFFNFFKLLFRWRGSVWKSIWSELVLWLLGYYLVMVTYRVALTT-EQKAGVRKYIDHLDQNLDKCVPLTFMLAFFVTIIVDRWKNMFANIGFIENTAIAIATLVKGTEGDVLLA-KRTIIRYLVLTQVLVFRDISLKVRRRFP-------------------NHDAIIKAGF---LQDHE----SIILGGDNGRTN------YWMPVNWSSAILQKLFEDGNIPAAPLFNSVWQEVKTFRSNMATLCNYDWVPIPIAYPQVVFFAVRVYFFTCLFTRQHLDMEDTKT---IDYYFPILTVFQFTFFMGWMKVAEALLNPLGEDDDDFECNYLIDRNIATGMAIVNSKYSDVPEMLADKFNDPSYAPYYPEKVIDS 350          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0082183)

HSP 1 Score: 255.373 bits (651), Expect = 8.509e-75
Identity = 139/372 (37.37%), Postives = 218/372 (58.60%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGH-----EVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHL 1407
            MT++Y+ +++  +GF  F+KLL RW+GS+YKLV+ DL+ ++ IYY IN++YRF L  PAQK +FE IV++CD+ +  IP+SF+LGF+V+ V+ RW+  Y  IP+ + +A      ++G D E+   +R+T+MRY+ L   + +  VS ++  RF                 +N   +  + +   K I +   +AF               P + W+PI W++ ++ +A   G I D   + +II +L+  RGQ   L  +  I +PLVYTQV+ +AVYSYFL      Q+ D   K+ G+     +VDLY P+FT  QF F+MGWLKVA  ++NPFG+DD+DF+ + ++D NL V++  V      +PE L
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLN-PAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQD-ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPG---------------LNNLVEAGLLNDNEKTIIETMNKAFPR-------------PSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0337020)

HSP 1 Score: 255.373 bits (651), Expect = 1.157e-74
Identity = 139/372 (37.37%), Postives = 218/372 (58.60%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGH-----EVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHL 1407
            MT++Y+ +++  +GF  F+KLL RW+GS+YKLV+ DL+ ++ IYY IN++YRF L  PAQK +FE IV++CD+ +  IP+SF+LGF+V+ V+ RW+  Y  IP+ + +A      ++G D E+   +R+T+MRY+ L   + +  VS ++  RF                 +N   +  + +   K I +   +AF               P + W+PI W++ ++ +A   G I D   + +II +L+  RGQ   L  +  I +PLVYTQV+ +AVYSYFL      Q+ D   K+ G+     +VDLY P+FT  QF F+MGWLKVA  ++NPFG+DD+DF+ + ++D NL V++  V      +PE L
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLN-PAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQD-ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPG---------------LNNLVEAGLLNDNEKTIIETMNKAFPR-------------PSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0114590)

HSP 1 Score: 254.988 bits (650), Expect = 2.464e-74
Identity = 139/372 (37.37%), Postives = 218/372 (58.60%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGH-----EVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHL 1407
            MT++Y+ +++  +GF  F+KLL RW+GS+YKLV+ DL+ ++ IYY IN++YRF L  PAQK +FE IV++CD+ +  IP+SF+LGF+V+ V+ RW+  Y  IP+ + +A      ++G D E+   +R+T+MRY+ L   + +  VS ++  RF                 +N   +  + +   K I +   +AF               P + W+PI W++ ++ +A   G I D   + +II +L+  RGQ   L  +  I +PLVYTQV+ +AVYSYFL      Q+ D   K+ G+     +VDLY P+FT  QF F+MGWLKVA  ++NPFG+DD+DF+ + ++D NL V++  V      +PE L
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLN-PAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQD-ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPG---------------LNNLVEAGLLNDNEKTIIETMNKAFPR-------------PSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0306023)

HSP 1 Score: 254.988 bits (650), Expect = 3.548e-74
Identity = 139/372 (37.37%), Postives = 218/372 (58.60%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGH-----EVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHL 1407
            MT++Y+ +++  +GF  F+KLL RW+GS+YKLV+ DL+ ++ IYY IN++YRF L  PAQK +FE IV++CD+ +  IP+SF+LGF+V+ V+ RW+  Y  IP+ + +A      ++G D E+   +R+T+MRY+ L   + +  VS ++  RF                 +N   +  + +   K I +   +AF               P + W+PI W++ ++ +A   G I D   + +II +L+  RGQ   L  +  I +PLVYTQV+ +AVYSYFL      Q+ D   K+ G+     +VDLY P+FT  QF F+MGWLKVA  ++NPFG+DD+DF+ + ++D NL V++  V      +PE L
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLN-PAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQD-ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPG---------------LNNLVEAGLLNDNEKTIIETMNKAFPR-------------PSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best3 (gene:FBgn0036492 transcript:FBtr0075618)

HSP 1 Score: 229.18 bits (583), Expect = 7.722e-67
Identity = 127/367 (34.60%), Postives = 208/367 (56.68%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFP--PEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPE 1401
            MTVSY+ +++    F  F KLL RW+ S+YK+++ DL+ ++  +Y + +IYR+AL+    K  FE+IV +C +  N IP+SF+LGF+V  +I RW+  Y+ +P+ + +A     L+ G D+   L +R+T+MRY+ L+  + +  +S  I  RF                            T+ ++I   EV       A        KFP  P++W+PI W++ ++ +A   G I D  +L S+I +L+  R   + L  +  I +PLVYTQV+ +AVYSYF+  +F  Q++D + K   + V  Y P+F+  +F FFMGWLKVA  ++ PFGDDD+DF+ + ++D NL V++  V    + +P+
Sbjct:    1 MTVSYTAEVATCSHFGCFWKLLMRWRASIYKIIWVDLLAFLSCFYFMAVIYRYALRD-VDKPVFEDIVMYCHSYSNLIPLSFVLGFYVGIIIERWWNQYITVPWPDPLAVYVSALVRGQDEHGRL-MRRTIMRYVCLALTMVLSMISPVIKRRF---------------------------PTYDQLI---EVGLLNANEANIMKAMDVKFPKHPKYWMPIVWAASIVTRARKEGRIWDDFSLKSMIDELNKFRAGCNMLIHYDTISVPLVYTQVVTLAVYSYFVASIFGHQWIDRDIKHYNNIVSYYFPLFSTLEFFFFMGWLKVAETLICPFGDDDDDFELNWLIDRNLQVSYLIVDEMHNDHPQ 335          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 251.136 bits (640), Expect = 1.368e-73
Identity = 135/356 (37.92%), Postives = 211/356 (59.27%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  ++D +    F +LL RWKGS+YKL+Y++L+ +  +Y +I++ YR  L T  Q+R FE++  +CD     IP+SF+LGF+VT V++RW+  +  +P+ +R++ L  G + G D+   L IR++LMRY NLS IL  R VS  +  RF                         +Q+    ++T  E+R  + + + +          +FWVP  W   L  +A   G I++   + +I+++L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP     GH +D Y+P+FT+ QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  SV
Sbjct:    1 MTVTYSRRVADAR-LGTFYRLLLRWKGSIYKLLYRELLIFTVMYCIISITYRCVL-TEEQRRMFEKLSLYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLSALVSGHVRGADEGARL-IRRSLMRYANLSGILIYRSVSTAVYKRFPTMSHL-------------------VQA---GLMTAEELRQLQELPSPHN---------KFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV 322          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 239.965 bits (611), Expect = 1.167e-71
Identity = 137/358 (38.27%), Postives = 209/358 (58.38%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLG--FFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F KLL  WKGS+YK++YK+ + +  +Y  I++ YRF L    QKR FE++  +CDN  + IP+SF+LG  F+VT V+ RW+  Y  IP  +R+  +  G + G D E+   +R+TLMRY +LS +L +R VS  +  RF                      D  +++ F   +T  E + FE++ +  Y+K        +W+P  W + L   A   G I D  T   ++ +L+  RG+   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP     GH++DLYVPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FCGFSKLLLAWKGSIYKVLYKEFLAFFAMYTAISITYRFFL-VDGQKRYFEKLSIYCDNYASLIPMSFVLGMRFYVTLVVNRWWSQYTSIPLPDRVMCVLSGGVQGSD-ERGRLLRRTLMRYSSLSALLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFESLHSP-YNK--------YWIPCVWFTNLAAAARCEGRIKDDNTYKLLLEELNNFRGKCSMLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPGQGYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAV 324          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 212.231 bits (539), Expect = 3.129e-62
Identity = 121/356 (33.99%), Postives = 202/356 (56.74%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTVSY+  +++ + F  F KLL RWKGS+YKL+Y++ + +  +Y  I+++YR  L    Q+  F  + + C+     IP+SF+LGF+VT    RW+  Y   P  + +  +  G ++G D E+   +R+TLMRY NLS +L +R +S ++  RF                      +  +++ F   +T  E+R   ++ + +++K        +W+P+ W + L  +A   G + D   L  ++ +L+  R +   L  +  I IPLVYTQV+ +AVYS+F   L   QFV P S  +   +DLY+PIFT+ +F F+ GWLKV   ++NPFG+DD+DF+T++++D N+ V+  +V
Sbjct:    1 MTVSYTLKVANAK-FGGFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNN-NQQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGTD-ERGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTL-------------------EDIVEAGF---MTTDELRKLNHLYS-DFNK--------YWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPAS--SEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAV 320          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 211.075 bits (536), Expect = 3.660e-62
Identity = 120/351 (34.19%), Postives = 199/351 (56.70%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDV 1359
            MTVSY+  +++ + F  F KLL RWKGS+YKL+Y++ + +  +Y  I+++YR  L    Q+  F  + + C+     IP+SF+LGF+VT    RW+  Y   P  + +  +  G ++G D E+   +R+TLMRY NLS +L +R +S ++  RF                      +  +++ F   +T  E+R   ++ + +++K        +W+P+ W + L  +A   G + D   L  ++ +L+  R +   L  +  I IPLVYTQV+ +AVYS+F   L   QFV P S  +   +DLY+PIFT+ +F F+ GWLKV   ++NPFG+DD+DF+T++++D N+ V
Sbjct:    1 MTVSYTLKVANAK-FGGFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNNN-QQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGTD-ERGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTL-------------------EDIVEAGF---MTTDELRKLNHLYS-DFNK--------YWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPAS--SEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQV 315          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 141.354 bits (355), Expect = 8.947e-37
Identity = 68/170 (40.00%), Postives = 106/170 (62.35%), Query Frame = 1
Query:  865 IITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            ++T  E+R  + + + +          +FWVP  W   L  +A   G I++   + +I+++L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP     GH +D Y+P+FT+ QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  SV
Sbjct:    2 LMTAEELRQLQELPSPHN---------KFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV 162          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 247.284 bits (630), Expect = 5.842e-75
Identity = 135/356 (37.92%), Postives = 210/356 (58.99%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  ++D +    F +LL RW+GS+YKL+Y++ + ++  Y++I++ YRF L    Q+  FE++  +CDN    IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NL+ +L +R VS  + +RF             +H          + + F   +T  E   F+ + + +          +FWVP  W + L   A   G I D   L  I+ +L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP+    GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG DD+DF+T+ ++D NL V+  +V
Sbjct:    1 MTVTYSNRVADAR-LGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNE-QQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTD-ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPT----------LQHV---------VNAGF---MTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 246.128 bits (627), Expect = 1.405e-74
Identity = 135/356 (37.92%), Postives = 210/356 (58.99%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  ++D +    F +LL RW+GS+YKL+Y++ + ++  Y++I++ YRF L    Q+  FE++  +CDN    IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NL+ +L +R VS  + +RF             +H          + + F   +T  E   F+ + + +          +FWVP  W + L   A   G I D   L  I+ +L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP+    GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG DD+DF+T+ ++D NL V+  +V
Sbjct:    1 MTVTYSNRVADAR-LGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNE-QQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTD-ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPT----------LQHV---------VNAGF---MTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 246.899 bits (629), Expect = 1.977e-74
Identity = 135/356 (37.92%), Postives = 210/356 (58.99%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  ++D +    F +LL RW+GS+YKL+Y++ + ++  Y++I++ YRF L    Q+  FE++  +CDN    IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NL+ +L +R VS  + +RF             +H          + + F   +T  E   F+ + + +          +FWVP  W + L   A   G I D   L  I+ +L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP+    GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG DD+DF+T+ ++D NL V+  +V
Sbjct:    1 MTVTYSNRVADAR-LGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNE-QQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTD-ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPT----------LQHV---------VNAGF---MTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 247.284 bits (630), Expect = 3.353e-74
Identity = 135/356 (37.92%), Postives = 210/356 (58.99%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  ++D +    F +LL RW+GS+YKL+Y++ + ++  Y++I++ YRF L    Q+  FE++  +CDN    IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NL+ +L +R VS  + +RF             +H          + + F   +T  E   F+ + + +          +FWVP  W + L   A   G I D   L  I+ +L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP+    GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG DD+DF+T+ ++D NL V+  +V
Sbjct:    1 MTVTYSNRVADAR-LGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNE-QQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTD-ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPT----------LQHV---------VNAGF---MTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 248.44 bits (633), Expect = 5.162e-73
Identity = 135/356 (37.92%), Postives = 210/356 (58.99%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  ++D +    F +LL RW+GS+YKL+Y++ + ++  Y++I++ YRF L    Q+  FE++  +CDN    IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NL+ +L +R VS  + +RF             +H          + + F   +T  E   F+ + + +          +FWVP  W + L   A   G I D   L  I+ +L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP+    GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG DD+DF+T+ ++D NL V+  +V
Sbjct:    1 MTVTYSNRVADAR-LGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNE-QQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTD-ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPT----------LQHV---------VNAGF---MTPTERSKFDGLVSSHN---------KFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 240.35 bits (612), Expect = 4.390e-71
Identity = 138/356 (38.76%), Postives = 208/356 (58.43%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F +LL  W+GS+YKL++++L+ ++G+Y  ++  YRF L    QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V R +   L  +  I IPLVYTQV+ IAVYSYFL  L   QF+DP      H +DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAE-EQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 240.35 bits (612), Expect = 4.390e-71
Identity = 138/356 (38.76%), Postives = 208/356 (58.43%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F +LL  W+GS+YKL++++L+ ++G+Y  ++  YRF L    QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V R +   L  +  I IPLVYTQV+ IAVYSYFL  L   QF+DP      H +DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAE-EQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 240.35 bits (612), Expect = 4.390e-71
Identity = 138/356 (38.76%), Postives = 208/356 (58.43%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F +LL  W+GS+YKL++++L+ ++G+Y  ++  YRF L    QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V R +   L  +  I IPLVYTQV+ IAVYSYFL  L   QF+DP      H +DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAE-EQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best3 (bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298])

HSP 1 Score: 242.276 bits (617), Expect = 3.310e-70
Identity = 131/356 (36.80%), Postives = 209/356 (58.71%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  +++   F  F +LL +W+GS+YKL+Y++ + +  +Y  I+L+YR  L T AQKR FE++  +CD     IP++F+LGF+VT V+ RW+  ++ +P+ +R+  L    ++G D+   L +R+TLMRY+NL+ +L  R VS  +  RF                      D  +++ F   +T  E + F+++ + +          ++WVP  W   L  KA   G I D   L S++++++  R     L  +  + IPLVYTQV+ +AVY++F   L   QF+DP     GH++DLYVPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+  +D NL V+  +V
Sbjct:    1 MTVTYSSKVANAT-FFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLL-TGAQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQHGRL-LRRTLMRYVNLTSLLIFRSVSTAVYKRFPTM-------------------DHVVEAGF---MTADERKLFDHLKSPHL---------KYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 233.417 bits (594), Expect = 2.140e-69
Identity = 131/356 (36.80%), Postives = 203/356 (57.02%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MT++Y+  +++ +    F  LL  W+GS+YKL+Y + + ++ +YY I  +YR  L +  Q+  FE++  +CD+    IPISF+LGF+VT V++RW+  Y  +P+ +R+       + G D+E  L +R+TL+RY  L  +L +R +S  +  RF              H  +               +T  E +  + +   + +         FWVP  W + L  KA++ G I D   L S+++++  LR Q   L  +  I IPLVYTQV+ +AVYS+FL  L   QF++P     GHE+DL VP+FTI QFLF+MGWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  SV
Sbjct:    1 MTITYTNKVANAR-LGSFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSS-DQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGKDEEGRL-LRRTLIRYAILGQVLILRSISTSVYKRFPTL-----------HHLV-----------LAGFMTHGEHKQLQKLGLPHNT---------FWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSV 322          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|O76090|BEST1_HUMAN (Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 3.850e-73
Identity = 141/377 (37.40%), Postives = 218/377 (57.82%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQ 1437
            MT++Y+  +++ +    F +LL  W+GS+YKL+Y + + ++  YY+I  IYR AL T  Q+  FE++  +CD+    IPISF+LGF+VT V+ RW+  Y  +P+ +R+  L  G + G D++  L +R+TL+RY NL  +L +R VS  +  RF                    +    +Q+ F   +T AE +  E ++  +           FWVP  W + L  KA++ G I DP  L S++++++ LR Q   L  +  I IPLVYTQV+ +AVYS+FL  L   QF++P     GHE+DL VP+FT  QF F++GWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  +V       P  ++P   W K +
Sbjct:    1 MTITYTSQVANAR-LGSFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRLAL-TEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQGRL-LRRTLIRYANLGNVLILRSVSTAVYKRFP-------------------SAQHLVQAGF---MTPAEHKQLEKLSLPHNM---------FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPR-MEPDMYWNKPE 342          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6UY87|BEST1_MACFA (Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BEST1 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 2.384e-72
Identity = 140/379 (36.94%), Postives = 218/379 (57.52%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKN 1443
            MT++Y+  +++ +    F +LL  W+GS+YKL+Y +   ++  YY+I  IYR AL T  Q+  FE++  +CD+    IPISF+LGF+VT V+ RW+  Y  +P+ +R+  L  G + G D++  L +R+TL+RY NL  +L +R VS  +  RF                    +    +Q+ F   +T AE +  E ++  +           FWVP  W + L  KA++ G I DP  L S++++++ LR Q   L  +  I IPLVYTQV+ +AVYS+FL  L   QF++P     GHE+DL VP+FT  QF F++GWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  +V       P  ++P   W + + +
Sbjct:    1 MTITYTSQVANAR-LGSFSRLLLCWRGSIYKLLYGEFFIFLLCYYIIRFIYRLAL-TEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQGRL-LRRTLIRYANLGNVLILRSVSTAVYKRFP-------------------SAQHLVQAGF---MTPAEHKQLEKLSLPHNM---------FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPR-MEPDMYWNEPEPH 344          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8NFU1|BEST2_HUMAN (Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 2.624e-71
Identity = 138/356 (38.76%), Postives = 210/356 (58.99%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F +LL  W+GS+YKL++++L+ ++G Y  ++  YRF L T  QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V RG+   L  +  I +PLVYTQV+ IA+YSYFL  L   QF+DP      H++DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVL-TEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8BGM5|BEST2_MOUSE (Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 4.065e-70
Identity = 138/356 (38.76%), Postives = 208/356 (58.43%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F +LL  W+GS+YKL++++L+ ++G+Y  ++  YRF L    QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V R +   L  +  I IPLVYTQV+ IAVYSYFL  L   QF+DP      H +DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAE-EQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6H1V1|BEST3_MOUSE (Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.315e-69
Identity = 131/356 (36.80%), Postives = 209/356 (58.71%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  +++   F  F +LL +W+GS+YKL+Y++ + +  +Y  I+L+YR  L T AQKR FE++  +CD     IP++F+LGF+VT V+ RW+  ++ +P+ +R+  L    ++G D+   L +R+TLMRY+NL+ +L  R VS  +  RF                      D  +++ F   +T  E + F+++ + +          ++WVP  W   L  KA   G I D   L S++++++  R     L  +  + IPLVYTQV+ +AVY++F   L   QF+DP     GH++DLYVPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+  +D NL V+  +V
Sbjct:    1 MTVTYSSKVANAT-FFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLL-TGAQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQHGRL-LRRTLMRYVNLTSLLIFRSVSTAVYKRFPTM-------------------DHVVEAGF---MTADERKLFDHLKSPHL---------KYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FNT5 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025133g2 PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 1.537e-123
Identity = 206/440 (46.82%), Postives = 282/440 (64.09%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDK--EKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXX-XXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPE---------------------SKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSS-MYPEHLDPPAM-WYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEIT 1548
            MTV+YSE IS  QG  +FIK+L  WKGSLYKLVY DL+ Y+ IYYV N+ YR  L  P  +++FE +V+FC  M  NIP+SF+LGFFV GVI RW+++Y+ IP+LNR+AF   GLI G     E   +IR +LMRY+NL+WIL M  +S++I  RF + +E    E    R    N NR  K+Q  FRK++T+ E+ AF    A+   K + K+ P++W+P+ W++ L +KA +HG+  DPR++  I+ +++ +R  MHTL I++ +MIPLVYTQV+IIAVYSYFL QLF+ QFV+P+                     S  TG  +D+Y PIFT+ QFLF MGWLKVAMCVMNPFGDDDEDF TS ILD NL++T R V   S+  YPE L  P+M W K     + D + +++   + +         EK +  L++T
Sbjct:    1 MTVAYSETISSSQGG-VFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYR-VLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYFPIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEWLKKSAGSEGDNMLEYLDAAEMEFSVVPPPPPEKFLEPLQMT 437          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A1I8HMQ9 (Bestrophin homolog OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.400e-123
Identity = 206/442 (46.61%), Postives = 283/442 (64.03%), Query Frame = 1
Query:  301 STMTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDK--EKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXX-XXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPE---------------------SKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSS-MYPEHLDPPAM-WYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEIT 1548
            + MTV+YSE IS  QG  +FIK+L  WKGSLYKLVY DL+ Y+ IYYV N+ YR  L  P  +++FE +V+FC  M  NIP+SF+LGFFV GVI RW+++Y+ IP+LNR+AF   GLI G     E   +IR +LMRY+NL+WIL M  +S++I  RF + +E    E    R    N NR  K+Q  FRK++T+ E+ AF    A+   K + K+ P++W+P+ W++ L +KA +HG+  DPR++  I+ +++ +R  MHTL I++ +MIPLVYTQV+IIAVYSYFL QLF+ QFV+P+                     S  TG  +D+Y PIFT+ QFLF MGWLKVAMCVMNPFGDDDEDF TS ILD NL++T R V   S+  YPE L  P+M W K     + D + +++   + +         EK +  L++T
Sbjct:   13 AEMTVAYSETISSSQGG-VFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYR-VLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYFPIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEWLKKSAGSEGDNMLEYLDAAEMEFSVVPPPPPEKFLEPLQMT 451          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267GQY7 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016709g1 PE=3 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 7.353e-119
Identity = 204/469 (43.50%), Postives = 284/469 (60.55%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDK--EKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFI------------------------------NFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPE---------------------SKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSS-MYPEHLDPPAM-WYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEIT 1548
            MTV+YSE IS  QG  +FIK+L  WKGSLYKLVY DL+ Y+ IYYV N+ YR  L  P  +++FE +V+FC  M  NIP+SF+LGFFV GVI RW+++Y+ IP+LNR+AF   GLI G     E   +IR +LMRY+NL+WIL M  +S++I  RF + +E   +    +  ++                              N NR  K+Q  FRK++T+ E+ AF    A+   K + K+ P++W+P+ W++ L +KA +HG+  DPR++  I+ +++ +R  MHTL I++ +MIPLVYTQV+IIAVYSYFL QLF+ QFV+P+                     S  TG  +D+Y PIFT+ QFLF MGWLKVAMCVMNPFGDDDEDF TS ILD NL++T R V   S+  YPE L  P+M W K     + D + +++   + +         EK +  L++T
Sbjct:    1 MTVAYSETISSSQGG-VFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYR-VLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAQQGGQSKLRYLFGRLIGMNQLSAELRATKADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYFPIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEWLKKSAGSEGDNMLEYLDAAEMEFSVVPPPPPEKFLEPLQMT 466          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FLK3 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016709g2 PE=3 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 1.272e-118
Identity = 204/469 (43.50%), Postives = 284/469 (60.55%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDK--EKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFI------------------------------NFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPE---------------------SKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSS-MYPEHLDPPAM-WYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEIT 1548
            MTV+YSE IS  QG  +FIK+L  WKGSLYKLVY DL+ Y+ IYYV N+ YR  L  P  +++FE +V+FC  M  NIP+SF+LGFFV GVI RW+++Y+ IP+LNR+AF   GLI G     E   +IR +LMRY+NL+WIL M  +S++I  RF + +E   +    +  ++                              N NR  K+Q  FRK++T+ E+ AF    A+   K + K+ P++W+P+ W++ L +KA +HG+  DPR++  I+ +++ +R  MHTL I++ +MIPLVYTQV+IIAVYSYFL QLF+ QFV+P+                     S  TG  +D+Y PIFT+ QFLF MGWLKVAMCVMNPFGDDDEDF TS ILD NL++T R V   S+  YPE L  P+M W K     + D + +++   + +         EK +  L++T
Sbjct:    1 MTVAYSETISSSQGG-VFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYR-VLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAQQGGQSKLRYLFGRLIGMNQLSAELRATKADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYFPIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEWLKKSAGSEGDNMLEYLDAAEMEFGVVPPPPPEKFLEPLQMT 466          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FEW0 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017118g1 PE=3 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 1.750e-116
Identity = 197/493 (39.96%), Postives = 294/493 (59.63%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDK--EKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFK---------------------------------------XXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPE------SKIT---------------GHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAM-WYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITP--NKCLNFLKCISCG 1590
            MTVSYSE IS  QG  +FIK+L  W+GSLYKLVY DL  Y+ IYY  N+ YR +L +P  ++SFE +VK C+ M  +IP+SF+LGFFV GVI RW+Q+YL IP+LNR++FLS G++ G  +  E+  ++R ++MRYLN+ WIL M  +S+++  +F                                        H +  +  +   R+   + NR  +++  F K++T+ E++AFE   ++  SK    + P++W+P+QW+  L +KA VHGF  DPR++  ++ +++ +RG M TL I++ +MIPLVYTQV+IIAVYSYFL QLF+ QFV+P+       ++T               G  +D+Y P+FT+FQFLF MGWLKVAMCVMNPFGDDDEDF T ++LD NL+++ R   A  S +PE L   +M W +     + D L D++   +S+  +  + + E+ +  +   P   + L    C+ CG
Sbjct:    1 MTVSYSETISSSQG-GVFIKILLLWRGSLYKLVYTDLFFYLVIYYAFNISYR-SLMSPQTRQSFELVVKLCNEMDKSIPLSFILGFFVAGVIGRWWQMYLNIPWLNRISFLSYGILTGTRENFEQARRLRLSMMRYLNIGWILLMHSISEKVMHQFSDVKPPDETEEGNSAGEGLLTRIRYVMDRLAGTNQMAAQLHANSKSRSQKGIRYLLESINRCTRVRLHFPKLVTETEIQAFERAESEYISKYWRPYVPDYWLPLQWAVLLCKKAMVHGFC-DPRSMVKLMEEIEDVRGMMQTLVIYNEVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKWTAEALGRLTNTSVLPISTGSEHHHGEVIDMYFPVFTVFQFLFLMGWLKVAMCVMNPFGDDDEDFHTLEMLDYNLEISSRCSEAPPSQFPEGLSEASMEWIRRSPGSEADSLFDYLASAESEFRQAGEPSQEERLHEILAKPALRQRLRAGCCLHCG 490          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 248.44 bits (633), Expect = 3.181e-72
Identity = 133/356 (37.36%), Postives = 213/356 (59.83%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  ++D +    F  LL RWKGS+YKL+Y++L+ +  +Y  I+++YRF L    Q+R FE++  +CD     IP+SF+LGF+VT V++RW+  +  +P+ +R+A L    + G D+   L IR++L+RY NLS +L  R +S  +  RF                      +  +Q+    ++T  E R  +++ + +          +FWVP  W   L  +A   G I++   L++I+++L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP    +GH++D Y+P+FT+ QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  SV
Sbjct:    1 MTVTYSRRVADAR-LGTFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDN-EQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRGADEGARL-IRRSLVRYANLSGVLIYRSISTAVYKRFPTI-------------------EHLVQA---GLMTVEERRQLDDLPSPHN---------KFWVPCMWFVNLALRARTEGRINNDVALSAILNELNTLRSQCMKLYSYDWISLPLVYTQVVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV 322          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 236.884 bits (603), Expect = 1.471e-68
Identity = 132/356 (37.08%), Postives = 210/356 (58.99%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F KLL  W+GS+YK++YK+++ +  +Y  I++ YRF L    QKR FE++  +C++  + IP+SF+LGF+VT ++ RW+  Y  IP  + +  +  G + GGD E+   +R+TLMRY +L+ +L +R VS  +  RF                      D  +++ F   +T  E + FE++ +  Y+K        +W+P  W + L   A   G I D  T   ++ +L+  RG+   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP     GH++DLYVPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FCGFSKLLLAWRGSIYKVLYKEVLAFFILYTAISITYRFFLLD-EQKRYFEKLSIYCNHYASLIPMSFVLGFYVTLIVNRWWSQYTSIPLPDSIMCVLSGGLQGGD-ERGRLLRRTLMRYASLASLLILRSVSTAVFKRFPTM-------------------DHVVEAGF---MTREERKKFESLHSP-YNK--------YWIPCVWFTNLAAVARSEGRIKDDNTYKLLLEELNKFRGKCSLLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQAYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAV 322          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 214.542 bits (545), Expect = 3.207e-63
Identity = 128/359 (35.65%), Postives = 205/359 (57.10%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQ-VIIIAVYSYFLCQLFASQFVDPE--SKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTVSY+ ++++ + F  F KLL RWKGS+YKL+YK+ + +  +Y + +LIYR  L T  Q+  FE   + C+     IP+SF+L F+VT    RW+  Y   P  + +  +  G ++G D E+   +R+TLMRY NLS +L +R +S ++  RF                         +Q      +T+ E+R  +++ + +++K        +W+P+ W + L  KA   G + D   L  ++ +L+  RG+   L  +  I IPLVYTQ V+ +AVYS+F   L   QFV PE   ++  H VDLYVP+FT+ +F F+ GWLKV   ++NPFG+DD+DF+T++++D N+ V+  +V
Sbjct:    1 MTVSYTLEVANAR-FAGFTKLLFRWKGSIYKLLYKEFLLFCFLYSLFSLIYRCVL-TDGQQELFERAARHCNKFAKLIPMSFVL-FYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGSD-ERGRLLRRTLMRYANLSSVLILRSISTRVHKRFP-----------------------TLQHIVDAFMTEEEMRTLDHLYS-DFNK--------YWMPLTWFANLASKAREEGRVKDDIALRLLMDELNNYRGKCSMLFHYDWISIPLVYTQQVVTLAVYSFFAFCLIGRQFVKPERADELKVH-VDLYVPVFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 214.157 bits (544), Expect = 6.929e-60
Identity = 121/356 (33.99%), Postives = 197/356 (55.34%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  ++D +    F  LL RWKGS+YKL+Y++L+ +  +Y  I+++YRF L    Q+R FE++  +CD     IP+SF+LGF+VT V++RW+  +  +P+ +R+A L    + G D+   L IR++L+RY NLS +L  R +S  +  RF                      +  +Q+    ++T  E R  +++ + +          +FWVP  W   L  +A   G I++   L++I++                          V+ +AVYS+FL  L   QF+DP    +GH++D Y+P+FT+ QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  SV
Sbjct:    1 MTVTYSRRVADAR-LGTFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDN-EQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRGADEGARL-IRRSLVRYANLSGVLIYRSISTAVYKRFPTI-------------------EHLVQA---GLMTVEERRQLDDLPSPHN---------KFWVPCMWFVNLALRARTEGRINNDVALSAILN--------------------------VVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV 296          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 136.346 bits (342), Expect = 4.409e-34
Identity = 66/169 (39.05%), Postives = 103/169 (60.95%), Query Frame = 1
Query:  868 ITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            +T  E + FEN+ + +          ++W+P  W + L  KA   G I D   L +I+++++  R    TL  +  + IPLVYTQV+ +AVY++F   +   QF+DP     GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG+DD+DF+ +  +D NL V+  +V
Sbjct:   85 MTPEEKKIFENLKSPHL---------KYWIPTVWFTNLASKARKDGRIQDSVDLQTILTEMNRFRTWCSTLFGYDWVGIPLVYTQVVTLAVYTFFSASIIGRQFLDPAQGYPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWCIDRNLQVSLMAV 244          

HSP 2 Score: 79.337 bits (194), Expect = 3.679e-15
Identity = 35/86 (40.70%), Postives = 60/86 (69.77%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGF 564
            MTV+YS  +++   F  F +LL RW+GS+YKL+Y++ + +  +Y +++L+YR+ L  P Q+R FE++  +CD     IP++F+LGF
Sbjct:    1 MTVTYSSKVANAT-FFGFHRLLLRWRGSIYKLLYREFLFFALLYSILSLVYRWVLTDP-QRRLFEKLSIYCDRYAEQIPVTFVLGF 84          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 236.113 bits (601), Expect = 6.131e-72
Identity = 132/356 (37.08%), Postives = 209/356 (58.71%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  +++ +    F +LL RWKGS+YKL+YK+   ++ +++ ++ +YR+ L+   QKR FE++  +C+     IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NLS +L +R VS  +  RF                      D  +++ F   +T AE R F+ + + +          +FWVP  W + L  +A   G I D  +L  I++DL+  R     L  +  + IPLVYTQV+ +AVYS+FL  L   QF+ P+    GH++DLY+P+FT+ QF F+ GWLKVA  ++NPFG+DD+DF+ +  +D NL V+   V
Sbjct:    1 MTVTYSNKVANAR-LGGFSQLLLRWKGSIYKLLYKEFCIFLVLFFTLSSVYRYMLQE-NQKRYFEKLAMYCNKYAELIPVSFVLGFYVTLVVSRWWSQYESLPWPDRLMHLVACNVHGAD-ERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTM-------------------DHVVEAGF---MTPAERRKFDGLRSPH---------NKFWVPCVWFANLAAQAKAEGRILDNVSLQLILNDLNNFRSCCSMLYSYDWVSIPLVYTQVVTVAVYSFFLACLIGRQFLGPQG-YPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEANWCVDRNLQVSLMGV 321          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 235.728 bits (600), Expect = 4.096e-70
Identity = 132/356 (37.08%), Postives = 206/356 (57.87%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ +    F KLL +W+GS+YKL+Y++   Y  +Y  ++L  RFAL +  QKR FE++  +C+N  N IP+    GF+V  V++RW+  Y  IP  +R+     G ++G D E+   +R+TLMRY NLS +L +R VS  +  RF                      D  +++ F   +T  E + F+ +   +Y+K        +WVP  W S L  +A   G + D   L  ++ +++V RG    L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP     GH++DLY+P+FT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  +V
Sbjct:    1 MTVTYTNRVANAR-LCGFSKLLLQWRGSIYKLLYREFSIYFMMYAALSLTSRFAL-SEDQKRLFEKLSLYCNNYANLIPVRSCSGFYVALVVSRWWSQYTSIPTPDRLMCAVAGTVHGVD-ERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTM-------------------DHVVEAGF---MTRDERKRFDGLRC-SYNK--------YWVPCVWLSSLAAQARAEGRVRDDVALKLLLDEMNVYRGNCGMLFHYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPAQGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNLQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: BEST3 (bestrophin 3 [Source:NCBI gene;Acc:101172121])

HSP 1 Score: 249.21 bits (635), Expect = 4.075e-73
Identity = 132/356 (37.08%), Postives = 212/356 (59.55%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  +++   F+ F +LL RW+GS+YKL+Y++ + +  +Y +++LIYR AL    QKR FE++  +CD     IP++F+LGF+VT V+ RW+  +L +P+ +R+ F     + G D+   L +R+TL+RY+NL+ +L  R VS  +  RF                      D  +++ F   +T  E + FENI + +          ++W+P+ W S L  +A   G I D   L +I+++++  R    TL  +  + IPLVYTQV+ +AVY++F   +   QF+DP     GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG+DD+DF+ + I+D NL V+  +V
Sbjct:    1 MTVTYSSKVANAT-FLSFHRLLLRWRGSIYKLLYREFLLFALLYTILSLIYRLALSE-QQKRLFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFLNLPWPDRLMFHISSCVQGKDEYGRL-LRRTLVRYINLTSLLIFRSVSTAVCKRFPTI-------------------DHVVEAGF---MTPEERKVFENIRSPHL---------KYWIPVVWFSNLASRARQEGRIQDAIDLQNILNEMNTFRTWCATLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQFLDPAQGHPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWIIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:101167866])

HSP 1 Score: 244.973 bits (624), Expect = 5.195e-71
Identity = 136/356 (38.20%), Postives = 207/356 (58.15%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+YS  ++D  G   F  LL RWKGS+YKL+Y++L+ +  +YY ++L+Y + L    Q+R FE +  +CD     IP+SF+L F+VT V++RW+  +  IP+ +R+A L  G + G D+   L  R+ LMRY+NLS +L  R VS  +  RF                          +   + ++T  E+R FE + + +          +FWVP  W   L  +A   G I++   L +I+++L+ LR +   L  +  I +PLVYTQV  +AVYS+FL  L   QF+DP     GH+VD Y+P+FT+ QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  SV
Sbjct:    1 MTVTYSRRVADA-GLGTFFHLLLRWKGSIYKLLYRELIIFTLLYYFLSLVY-YMLDN-DQRRLFERLSIYCDRYAELIPVSFVL-FYVTLVVSRWWGQFENIPWPDRLAALVGGHVRGTDEASRL-TRRALMRYVNLSGVLIYRSVSTAVYKRFP-----------------------TTEHLVQALMTSEELRHFEELPSPHN---------KFWVPCMWFVNLALRARTEGRINNDVALTAILTELNSLRAKCMKLYGYDWISLPLVYTQVATVAVYSFFLACLIGRQFLDPAQGYPGHDVDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWVVDRNLQVSLLSV 319          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best2 (bestrophin 2 [Source:NCBI gene;Acc:110015962])

HSP 1 Score: 238.81 bits (608), Expect = 1.397e-69
Identity = 134/357 (37.54%), Postives = 209/357 (58.54%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNR-MAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1374
            MTV+Y+  +++ + F  F KLL  WKGS+YK++YK+ + +  +Y  I++ YRF L    QKR FE++  +C++  + IP+SF+LGF+VT ++ RW+  Y  IP  +R M  LS GL   G+ E+   +R+++MRY +LS +L +R VS  +  RF                      D  +++ F   +T  E + FE + +  Y+K        +W+P  W + L   A   G I D   L  ++ +L+  RG+   L  +  + +PLVYTQV+ +AVYS+FL  L   QF+DP     GH++DLYVPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:    1 MTVTYTARVANAR-FCGFSKLLLAWKGSIYKVLYKEFLAFFVLYAAISITYRFFLYE-DQKRYFEKLAIYCNHYASLIPMSFVLGFYVTLIVNRWWNQYTSIPLPDRIMCVLSGGL--QGNDERGRLLRRSMMRYASLSALLILRSVSTAVFKRFPTM-------------------DHVVEAGF---MTREERKKFEGLHSP-YNK--------YWIPCVWFTNLAAVARCEGRIRDDHALKLLLEELNAFRGKCSLLFHYDMVSVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQGYQGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAV 322          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000070057.1 (SMESG000070057.1)

HSP 1 Score: 945.651 bits (2443), Expect = 0.000e+0
Identity = 482/482 (100.00%), Postives = 482/482 (100.00%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGXXXXXXXXXXKAKFFRKHKQNVPQDNIIIEESIDNPKDLLVQKV 1752
            MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGSPTITTPTSPKAKFFRKHKQNVPQDNIIIEESIDNPKDLLVQKV
Sbjct:    1 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGSPTITTPTSPKAKFFRKHKQNVPQDNIIIEESIDNPKDLLVQKV 482          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000070057.1 (SMESG000070057.1)

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 464/482 (96.27%), Postives = 470/482 (97.51%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGXXXXXXXXXXKAKFFRKHKQNVPQDNIIIEESIDNPKDLLVQKV 1752
            MT+ Y +D++         +LL +WKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGSPTITTPTSPKAKFFRKHKQNVPQDNIIIEESIDNPKDLLVQKV
Sbjct:    1 MTILYLDDVTRRTEIGCIFRLLKKWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGSPTITTPTSPKAKFFRKHKQNVPQDNIIIEESIDNPKDLLVQKV 482          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000055094.1 (SMESG000055094.1)

HSP 1 Score: 520.39 bits (1339), Expect = 7.767e-180
Identity = 252/430 (58.60%), Postives = 326/430 (75.81%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRF---KXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEIT---PNKCLNFLKC 1578
            MTV YS+ +  G+G  IF++LL  WKGSLYKLV+ DL+ Y+G+YY+INLIYR AL    QK++F ++V+F D MK NIP  FLLGFFV+GVI RW ++YL IP+L+R AFL +G ING +    L++R+T++RYLNL+WIL MRQ+SDQI +RF   K N+  N+ E   R  FINFN+D KIQ+T+ KIITDAE+RAFE IA K+ S  K  + PE+WVPIQW+SR++QK+F+H ++SDPRT+N +I +LD +R  M  LQ+F GIMIPLVYTQV+IIAVYS+FLC+LFASQF+DP  K+ GHE+D YVPIFTIFQFLF MGWLKVAMCVMNPFGDDDEDFQTS+ILD+NLD T+RSV+ +  M+PE LDPP M Y+     + D L+ F+ +ID DLE+    +   +V  LE+    P K +N+ K 
Sbjct:    1 MTVDYSKQLEKGRGIDIFVRLLWLWKGSLYKLVWVDLLSYMGVYYLINLIYRLALNK-TQKKTFVKMVQFADEMKGNIPFFFLLGFFVSGVIGRWIKMYLLIPWLHRQAFLFQGCINGNEPAMSLRLRRTILRYLNLAWILQMRQISDQISLRFRNNKINNSTNSVETTIRDIFINFNKDPKIQNTYGKIITDAEIRAFEAIAIKSDSNGKPNYVPEYWVPIQWASRVIQKSFIHKYVSDPRTVNKMIEELDRVRNNMQNLQVFCGIMIPLVYTQVVIIAVYSFFLCELFASQFIDPREKVKGHELDFYVPIFTIFQFLFLMGWLKVAMCVMNPFGDDDEDFQTSEILDNNLDTTYRSVSGELEMFPERLDPPKMNYECLLKTEPDNLETFLDEIDYDLEDLDCTSETNEVKTLEMKDSIPKKIINYFKS 429          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000055094.1 (SMESG000055094.1)

HSP 1 Score: 503.827 bits (1296), Expect = 1.597e-173
Identity = 242/412 (58.74%), Postives = 314/412 (76.21%), Query Frame = 1
Query:  361 IKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRF---KXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEIT---PNKCLNFLKC 1578
            + +L +WKGSLYKLV+ DL+ Y+G+YY+INLIYR AL    QK++F ++V+F D MK NIP  FLLGFFV+GVI RW ++YL IP+L+R AFL +G ING +    L++R+T++RYLNL+WIL MRQ+SDQI +RF   K N+  N+ E   R  FINFN+D KIQ+T+ KIITDAE+RAFE IA K+ S  K  + PE+WVPIQW+SR++QK+F+H ++SDPRT+N +I +LD +R  M  LQ+F GIMIPLVYTQV+IIAVYS+FLC+LFASQF+DP  K+ GHE+D YVPIFTIFQFLF MGWLKVAMCVMNPFGDDDEDFQTS+ILD+NLD T+RSV+ +  M+PE LDPP M Y+     + D L+ F+ +ID DLE+    +   +V  LE+    P K +N+ K 
Sbjct:    2 VTILAKWKGSLYKLVWVDLLSYMGVYYLINLIYRLALNK-TQKKTFVKMVQFADEMKGNIPFFFLLGFFVSGVIGRWIKMYLLIPWLHRQAFLFQGCINGNEPAMSLRLRRTILRYLNLAWILQMRQISDQISLRFRNNKINNSTNSVETTIRDIFINFNKDPKIQNTYGKIITDAEIRAFEAIAIKSDSNGKPNYVPEYWVPIQWASRVIQKSFIHKYVSDPRTVNKMIEELDRVRNNMQNLQVFCGIMIPLVYTQVVIIAVYSFFLCELFASQFIDPREKVKGHELDFYVPIFTIFQFLFLMGWLKVAMCVMNPFGDDDEDFQTSEILDNNLDTTYRSVSGELEMFPERLDPPKMNYECLLKTEPDNLETFLDEIDYDLEDLDCTSETNEVKTLEMKDSIPKKIINYFKS 412          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000065100.1 (SMESG000065100.1)

HSP 1 Score: 493.041 bits (1268), Expect = 1.112e-169
Identity = 233/399 (58.40%), Postives = 304/399 (76.19%), Query Frame = 1
Query:  307 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRF---KXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDL 1494
            MT+SY+ +ISDGQG      L  RWKGSLYKL++ DL+ YVG+YY+IN++YRFAL    Q+R FEEIVKFCD+ KNNIP+SFLLGFFV G+I RW+++YL IP+LN++AF+ + +I G    K  ++R  +MRY+NL+WIL MR +S QI +RF   K+   N   E++ +    N N D++I+ TF+KIIT +E+RAFENIA K  ++ K ++ PEFWVPIQW+SR++ K F+HGFISDPRT+ S+  +++ LR QM  LQI+S I+IPLVYTQV++IAVYSYFL  LFA+QFVDP  +I GHEVD Y+P+FTIFQFLF MGWLKVAMCVMNPFGDDDEDFQTS++LD NLD++FRS  A   MYP  L P  M Y+ Q   DED L DF+ D++++L
Sbjct:    1 MTISYAAEISDGQGLYCIYTLFMRWKGSLYKLLWVDLLIYVGLYYLINIMYRFAL-NEQQRRIFEEIVKFCDSKKNNIPLSFLLGFFVAGIIGRWWKMYLCIPWLNKIAFICQSIIIGNGPVKSRRVRLIIMRYMNLAWILLMRNISAQIKVRFQQHKNMKVNYRSENYIKEILENINADERIRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNL 398          
The following BLAST results are available for this feature:
BLAST of Bestrophin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BEST18.017e-7437.40bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703][more]
BEST25.465e-7238.76bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST25.465e-7238.76bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST25.465e-7238.76bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST39.447e-7236.52bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best-231.734e-5635.23Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:A... [more]
best-33.230e-5633.42Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-51.651e-5530.14Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot... [more]
best-87.057e-5532.99Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-87.057e-5532.99Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best18.509e-7537.37gene:FBgn0040238 transcript:FBtr0082183[more]
Best11.157e-7437.37gene:FBgn0040238 transcript:FBtr0337020[more]
Best12.464e-7437.37gene:FBgn0040238 transcript:FBtr0114590[more]
Best13.548e-7437.37gene:FBgn0040238 transcript:FBtr0306023[more]
Best37.722e-6734.60gene:FBgn0036492 transcript:FBtr0075618[more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best11.368e-7337.92bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best21.167e-7138.27bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best43.129e-6233.99bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best43.660e-6234.19bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best18.947e-3740.00bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best15.842e-7537.92bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best11.405e-7437.92bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best11.977e-7437.92bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best13.353e-7437.92bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best15.162e-7337.92bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best24.390e-7138.76bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best24.390e-7138.76bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best24.390e-7138.76bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best33.310e-7036.80bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298][more]
Best12.140e-6936.80bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
back to top
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O76090|BEST1_HUMAN3.850e-7337.40Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1... [more]
sp|Q6UY87|BEST1_MACFA2.384e-7236.94Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BES... [more]
sp|Q8NFU1|BEST2_HUMAN2.624e-7138.76Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1... [more]
sp|Q8BGM5|BEST2_MOUSE4.065e-7038.76Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=... [more]
sp|Q6H1V1|BEST3_MOUSE2.315e-6936.80Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=... [more]
back to top
BLAST of Bestrophin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FNT51.537e-12346.82Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A1I8HMQ92.400e-12346.61Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267GQY77.353e-11943.50Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267FLK31.272e-11843.50Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267FEW01.750e-11639.96Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best13.181e-7237.36bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
best21.471e-6837.08bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best43.207e-6335.65bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best16.929e-6033.99bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
BEST34.409e-3439.05bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
best16.131e-7237.08bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best24.096e-7037.08bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BEST34.075e-7337.08bestrophin 3 [Source:NCBI gene;Acc:101172121][more]
best15.195e-7138.20bestrophin-2 [Source:NCBI gene;Acc:101167866][more]
best21.397e-6937.54bestrophin 2 [Source:NCBI gene;Acc:110015962][more]
back to top
BLAST of Bestrophin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070057.10.000e+0100.00SMESG000070057.1[more]
SMESG000070057.10.000e+096.27SMESG000070057.1[more]
SMESG000055094.17.767e-18058.60SMESG000055094.1[more]
SMESG000055094.11.597e-17358.74SMESG000055094.1[more]
SMESG000065100.11.112e-16958.40SMESG000065100.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004315 ID=SMED30004315|Name=Bestrophin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=2003bp
TTTAGATCGATGAATAAATGAAAATTTGCCCAATTCGGTAGTTATAAATA
TGTGAACCTTTAAATATAAATCCATTCTAAATTTATCTTTAAAAATTATT
TAGTTATATAATTTTCCCGTTAGACAGATCTAGGCTTTTCAGACCGACAG
TTCAGTTATTTAGTGGTTTATACAAATACAGGGCTCGGGGTGATTTATTC
TTATAAAAAAATAATAATAATAAAATTTTATATAATTATGAATTTTATTA
TTATTATCATTATTATAATAATAGTTATTATTAACCATATTTGGTAAGTT
TCAACAATGACAGTTTCGTATTCTGAGGACATCTCAGACGGGCAGGGTTT
CATGATCTTTATCAAGTTGCTCACCAGATGGAAAGGCAGCCTGTACAAAT
TGGTGTATAAAGATCTGATGGGATACGTCGGGATTTATTACGTAATCAAC
TTGATATATCGGTTTGCTCTAAAAACCCCAGCACAAAAAAGGAGTTTTGA
AGAAATAGTCAAATTCTGTGATAATATGAAAAATAATATTCCAATATCCT
TTTTGTTGGGTTTCTTTGTCACTGGTGTCATTGCCCGCTGGTTTCAATTG
TACCTTTACATTCCTTACCTCAATCGGATGGCCTTTTTGTCAGAAGGTTT
AATTAATGGTGGCGACAAGGAAAAATGCTTGAAGATTCGTCAAACTCTTA
TGCGATACCTGAATTTGTCCTGGATTCTCTGCATGAGGCAAGTCAGCGAT
CAAATCGACATCAGATTCAAGCACAATGACGAGAATAACAATGAAGAGCA
TCACTTTAGGCATACCTTCATAAACTTCAACAGAGACAAAAAAATTCAAT
CAACATTTAGAAAAATTATTACAGATGCTGAAGTAAGGGCATTTGAAAAT
ATTGCTGCGAAGAATTATTCCAAAACCAAAAGTAAATTCCCTCCCGAGTT
TTGGGTACCCATTCAATGGTCATCAAGACTTCTGCAAAAAGCCTTTGTAC
ATGGATTTATAAGCGATCCAAGAACCCTTAATTCTATCATTAGTGATCTT
GACGTTCTTCGTGGGCAAATGCATACCCTACAAATATTCAGTGGAATCAT
GATCCCGCTTGTGTATACTCAAGTAATAATCATTGCTGTTTATAGCTATT
TCCTTTGCCAGCTCTTTGCGTCTCAATTCGTTGACCCCGAAAGCAAAATA
ACTGGCCATGAAGTTGACCTGTACGTTCCAATCTTTACAATCTTTCAATT
CCTATTTTTTATGGGATGGCTAAAGGTCGCCATGTGCGTTATGAATCCTT
TTGGAGATGACGATGAAGATTTTCAAACTTCGAAAATTCTCGATGACAAC
CTCGATGTTACTTTTCGCTCAGTTACAGCTGACTCGTCAATGTATCCAGA
ACATCTCGACCCTCCTGCAATGTGGTATAAAACGCAGAAAAATTGCGACG
AAGACCTTTTAGATGATTTTATGAAAGATATAGACAGCGACTTAGAAGAA
ACCGTTCAGTTAAACAATGAAAAAGATGTCACTAATCTAGAAATAACTCC
AAATAAATGCTTAAATTTTCTAAAATGTATTTCATGTGGCCTGTGTAAAT
TTGTTCGGCATAATATTGGATCTCCAACCATTACAACTCCAACTAGTCCT
AAAGCCAAATTTTTCAGAAAACATAAACAAAATGTTCCACAGGATAATAT
TATTATTGAGGAAAGCATAGATAATCCAAAAGATTTGCTCGTGCAAAAGG
TATGAAGCAAGTGAAGACTAGAAGCATATCAGAAAGTTTTTAATGATAAA
TGCAGCAAAGCTCCAGATGAAATATAAAATATTATTAAATTTTTCTTCAA
TCTTTTTCAGCATTTATCTGATCTTGGGGGATTCATTTATATTTATTACG
TTAAAATTTAGAGGAAATTTAGTACAAAATTTGCTGTATTTCATTGACGC
TTTTTAAAAGTTTTTATGATGTTTAGATTTTTTTTGCAAAAATTTGAGTG
AAT
back to top

protein sequence of SMED30004315-orf-1

>SMED30004315-orf-1 ID=SMED30004315-orf-1|Name=SMED30004315-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=483bp
MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLI
YRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYL
YIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQI
DIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIA
AKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDV
LRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITG
HEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLD
VTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETV
QLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGSPTITTPTSPKA
KFFRKHKQNVPQDNIIIEESIDNPKDLLVQKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR000615Bestrophin
IPR021134Bestrophin/UPF0187
Vocabulary: molecular function
TermDefinition
GO:0005254chloride channel activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0034707chloride channel complex
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006821chloride transport
GO:1902476chloride transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021134Bestrophin/UPF0187PFAMPF01062Bestrophincoord: 16..349
e-value: 5.6E-70
score: 236.0
IPR000615BestrophinPANTHERPTHR10736BESTROPHINcoord: 1..374
NoneNo IPR availableTMHMMTMhelixcoord: 76..98
NoneNo IPR availableTMHMMTMhelixcoord: 261..283
NoneNo IPR availableTMHMMTMhelixcoord: 37..55
NoneNo IPR availableTMHMMTMhelixcoord: 303..322