Chromobox protein

Overview
NameChromobox protein
Smed IDSMED30004311
Length (bp)2623
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromobox protein (SMED30004311) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromobox protein (SMED30004311) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromobox protein (SMED30004311) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromobox protein (SMED30004311) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004311

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004311h1SMcG0002448 dd_Smed_v4_8167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004311h1SMcG0002448 dd_Smed_v4_8167_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromobox protein vs. Ensembl Human
Match: ASB15 (ankyrin repeat and SOCS box containing 15 [Source:HGNC Symbol;Acc:HGNC:19767])

HSP 1 Score: 58.9214 bits (141), Expect = 6.411e-9
Identity = 36/93 (38.71%), Postives = 51/93 (54.84%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTNFY 1745
            TPL LAV    V  VR LL  G  P+ T N   ETPL++A   G    V  L+ ++   D   +K  +A++ A + GR D+V++LLK G N +
Sbjct:  113 TPLTLAVKAGLVENVRTLLEKGVWPN-TKNDKGETPLLIAVKKGSYDMVSTLIKHNTSLDQPCVKRWSAMHEAAKQGRKDIVALLLKHGGNVH 204          
BLAST of Chromobox protein vs. Ensembl Human
Match: ANKRD50 (ankyrin repeat domain 50 [Source:HGNC Symbol;Acc:HGNC:29223])

HSP 1 Score: 60.8474 bits (146), Expect = 1.067e-8
Identity = 44/116 (37.93%), Postives = 62/116 (53.45%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTD-YRIKSRTALYFAIENGRVDVVSMLLKFGTNF-YRIADNLSGSSLINDMFMGNRL 1808
            +TPL +A  +  V++V LLL  GA  D TDN +  TPL+ A+S+G+   V  LL + A  D    + RT L  A   G V+VV  LL  G +  +R  D+   + L    F G+RL
Sbjct:  570 MTPLLVAAYEGHVDVVDLLLEGGADVDHTDN-NGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENHR--DDAGWTPLHMAAFEGHRL 682          

HSP 2 Score: 54.6842 bits (130), Expect = 8.392e-7
Identity = 32/94 (34.04%), Postives = 54/94 (57.45%), Query Frame = 3
Query: 1461 ECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLKFGTN 1739
            E  + LQ A  +  V +V+LL+ +GA  D T N  A T L +A+  G+I  V+ LL++ A  ++  +  RTA+  A +NG   ++ +L K+G +
Sbjct:  832 EKRSALQSAAWQGHVKVVQLLIEHGAVVDHTCNQGA-TALCIAAQEGHIDVVQVLLEHGADPNHADQFGRTAMRVAAKNGHSQIIKLLEKYGAS 924          
BLAST of Chromobox protein vs. Ensembl Human
Match: ANKRD50 (ankyrin repeat domain 50 [Source:HGNC Symbol;Acc:HGNC:29223])

HSP 1 Score: 60.8474 bits (146), Expect = 1.109e-8
Identity = 44/116 (37.93%), Postives = 62/116 (53.45%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTD-YRIKSRTALYFAIENGRVDVVSMLLKFGTNF-YRIADNLSGSSLINDMFMGNRL 1808
            +TPL +A  +  V++V LLL  GA  D TDN +  TPL+ A+S+G+   V  LL + A  D    + RT L  A   G V+VV  LL  G +  +R  D+   + L    F G+RL
Sbjct:  749 MTPLLVAAYEGHVDVVDLLLEGGADVDHTDN-NGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENHR--DDAGWTPLHMAAFEGHRL 861          

HSP 2 Score: 54.6842 bits (130), Expect = 8.756e-7
Identity = 31/91 (34.07%), Postives = 53/91 (58.24%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLKFGTN 1739
            + LQ A  +  V +V+LL+ +GA  D T N  A T L +A+  G+I  V+ LL++ A  ++  +  RTA+  A +NG   ++ +L K+G +
Sbjct: 1014 SALQSAAWQGHVKVVQLLIEHGAVVDHTCNQGA-TALCIAAQEGHIDVVQVLLEHGADPNHADQFGRTAMRVAAKNGHSQIIKLLEKYGAS 1103          
BLAST of Chromobox protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 60.4622 bits (145), Expect = 1.499e-8
Identity = 35/95 (36.84%), Postives = 52/95 (54.74%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            +  T   LTP+ +A     +NIV LLL+ GA PD T N   ET L +A+  G +  V+ LL   A  D R +  +T L+ A   G+ ++V +LL+
Sbjct:  396 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ 489          

HSP 2 Score: 56.9954 bits (136), Expect = 1.650e-7
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFGT 1736
            TPL +A  KNR+ ++ LL++YGA       +   TP+ +A+ +G+++ V  LL   A  D   I+  TAL+ A   G+V+VV  LL+ G 
Sbjct:  371 TPLHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGA 459          

HSP 3 Score: 52.7582 bits (125), Expect = 3.172e-6
Identity = 40/120 (33.33%), Postives = 59/120 (49.17%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYV 1826
            TPL +A     VN+  LLL  GA  DFT   +  TPL +AS  G  + VK LLD     D + +   T L+ A  +G   VV +LL+ G     +A   +G S ++    G+ +  V ++
Sbjct:  206 TPLHIAAHYGNVNVATLLLNRGAAVDFTAR-NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL--LARTKNGLSPLHMAAQGDHVECVKHL 322          

HSP 4 Score: 51.9878 bits (123), Expect = 6.741e-6
Identity = 34/91 (37.36%), Postives = 46/91 (50.55%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTN 1739
            TPL +A  KN++ I   LL YGA  +        TPL LAS  G+   V  LLD  A      KS  T+L+ A +  +V+V  +L K G +
Sbjct:  569 TPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV-TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD 658          
BLAST of Chromobox protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 60.4622 bits (145), Expect = 1.499e-8
Identity = 35/95 (36.84%), Postives = 52/95 (54.74%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            +  T   LTP+ +A     +NIV LLL+ GA PD T N   ET L +A+  G +  V+ LL   A  D R +  +T L+ A   G+ ++V +LL+
Sbjct:  396 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ 489          

HSP 2 Score: 56.9954 bits (136), Expect = 1.650e-7
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFGT 1736
            TPL +A  KNR+ ++ LL++YGA       +   TP+ +A+ +G+++ V  LL   A  D   I+  TAL+ A   G+V+VV  LL+ G 
Sbjct:  371 TPLHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGA 459          

HSP 3 Score: 52.7582 bits (125), Expect = 3.172e-6
Identity = 40/120 (33.33%), Postives = 59/120 (49.17%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYV 1826
            TPL +A     VN+  LLL  GA  DFT   +  TPL +AS  G  + VK LLD     D + +   T L+ A  +G   VV +LL+ G     +A   +G S ++    G+ +  V ++
Sbjct:  206 TPLHIAAHYGNVNVATLLLNRGAAVDFTAR-NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL--LARTKNGLSPLHMAAQGDHVECVKHL 322          

HSP 4 Score: 51.9878 bits (123), Expect = 6.741e-6
Identity = 34/91 (37.36%), Postives = 46/91 (50.55%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTN 1739
            TPL +A  KN++ I   LL YGA  +        TPL LAS  G+   V  LLD  A      KS  T+L+ A +  +V+V  +L K G +
Sbjct:  569 TPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV-TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD 658          
BLAST of Chromobox protein vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 56.6102 bits (135), Expect = 8.328e-8
Identity = 39/104 (37.50%), Postives = 55/104 (52.88%), Query Frame = 3
Query: 1443 NEKFTPEC-LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSA----FTDYRIKSRTALYFAIENGRVDVVSMLLKFGTN 1739
            N++F+ E   TPL LA      ++VR+LL  G   D T  T    PL LA+  G+I  V  LL  S       D+R   RT L+ A +NG  ++VS+L+  G+N
Sbjct: 1197 NKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWR--GRTPLHLAAQNGHYEMVSLLIAQGSN 1298          
BLAST of Chromobox protein vs. Ensembl Celegans
Match: hpl-2 (Chromo-domain protein; HP1 Like (Heterochromatin protein) [Source:UniProtKB/TrEMBL;Acc:G5EFS9])

HSP 1 Score: 51.2174 bits (121), Expect = 3.826e-7
Identity = 23/57 (40.35%), Postives = 39/57 (68.42%), Query Frame = 3
Query:  360 DNFYIVEKIVGHKMCN-GKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDFKNKIS 527
            DN ++VEK++  +    G+  F +QWQG+ ES+ SWEP ENL  V +++++F+ + S
Sbjct:   16 DNVFMVEKVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENLQCV-EMLDEFEREFS 71          
BLAST of Chromobox protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 54.6842 bits (130), Expect = 3.835e-7
Identity = 40/124 (32.26%), Postives = 61/124 (49.19%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLL 1835
             TPL +A  KNR+ +V LLL+Y A  + T  +   TPL +A+ +G I+ V  LL   A  D   ++  T L+ A    + DVV +L++ G        +     L   + + +RL N   V LL
Sbjct:  393 FTPLHIACKKNRIKVVELLLKYRAAIEATTES-GLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKV-----DAQARELQTPLHIASRLGNTDIVILL 510          

HSP 2 Score: 53.5286 bits (127), Expect = 8.795e-7
Identity = 36/99 (36.36%), Postives = 50/99 (50.51%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKS-RTALYFAIENGRVDVVSMLLKFGTN 1739
            E  T   LTPL +A     +NIV  LL+ GA PD  +    ETPL LA+       V+ L+   A  D + +  +T L+ A   G  D+V +LL+ G N
Sbjct:  419 EATTESGLTPLHVAAFMGAINIVIYLLQQGANPD-VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGAN 516          

HSP 3 Score: 52.7582 bits (125), Expect = 1.462e-6
Identity = 34/93 (36.56%), Postives = 49/93 (52.69%), Query Frame = 3
Query: 1455 TPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKF 1730
            T   L PL +A   + V+  R LL + AP D     D  TPL +A+  G++   K LLD SA  + R +   T L+ A +  R+ VV +LLK+
Sbjct:  323 TKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV-TVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY 414          
BLAST of Chromobox protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 54.6842 bits (130), Expect = 3.835e-7
Identity = 40/124 (32.26%), Postives = 61/124 (49.19%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLL 1835
             TPL +A  KNR+ +V LLL+Y A  + T  +   TPL +A+ +G I+ V  LL   A  D   ++  T L+ A    + DVV +L++ G        +     L   + + +RL N   V LL
Sbjct:  393 FTPLHIACKKNRIKVVELLLKYRAAIEATTES-GLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKV-----DAQARELQTPLHIASRLGNTDIVILL 510          

HSP 2 Score: 53.5286 bits (127), Expect = 8.795e-7
Identity = 36/99 (36.36%), Postives = 50/99 (50.51%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKS-RTALYFAIENGRVDVVSMLLKFGTN 1739
            E  T   LTPL +A     +NIV  LL+ GA PD  +    ETPL LA+       V+ L+   A  D + +  +T L+ A   G  D+V +LL+ G N
Sbjct:  419 EATTESGLTPLHVAAFMGAINIVIYLLQQGANPD-VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGAN 516          

HSP 3 Score: 52.7582 bits (125), Expect = 1.462e-6
Identity = 34/93 (36.56%), Postives = 49/93 (52.69%), Query Frame = 3
Query: 1455 TPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKF 1730
            T   L PL +A   + V+  R LL + AP D     D  TPL +A+  G++   K LLD SA  + R +   T L+ A +  R+ VV +LLK+
Sbjct:  323 TKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV-TVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY 414          
BLAST of Chromobox protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 54.6842 bits (130), Expect = 3.908e-7
Identity = 40/124 (32.26%), Postives = 61/124 (49.19%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLL 1835
             TPL +A  KNR+ +V LLL+Y A  + T  +   TPL +A+ +G I+ V  LL   A  D   ++  T L+ A    + DVV +L++ G        +     L   + + +RL N   V LL
Sbjct:  393 FTPLHIACKKNRIKVVELLLKYRAAIEATTES-GLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKV-----DAQARELQTPLHIASRLGNTDIVILL 510          

HSP 2 Score: 53.5286 bits (127), Expect = 9.037e-7
Identity = 36/99 (36.36%), Postives = 50/99 (50.51%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKS-RTALYFAIENGRVDVVSMLLKFGTN 1739
            E  T   LTPL +A     +NIV  LL+ GA PD  +    ETPL LA+       V+ L+   A  D + +  +T L+ A   G  D+V +LL+ G N
Sbjct:  419 EATTESGLTPLHVAAFMGAINIVIYLLQQGANPD-VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGAN 516          

HSP 3 Score: 52.7582 bits (125), Expect = 1.477e-6
Identity = 34/93 (36.56%), Postives = 49/93 (52.69%), Query Frame = 3
Query: 1455 TPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKF 1730
            T   L PL +A   + V+  R LL + AP D     D  TPL +A+  G++   K LLD SA  + R +   T L+ A +  R+ VV +LLK+
Sbjct:  323 TKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV-TVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY 414          
BLAST of Chromobox protein vs. Ensembl Fly
Match: rhi (gene:FBgn0004400 transcript:FBtr0086897)

HSP 1 Score: 57.3806 bits (137), Expect = 3.836e-8
Identity = 20/52 (38.46%), Postives = 35/52 (67.31%), Query Frame = 3
Query:  369 YIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDFKNKI 524
            Y+VEKI+G +  NG+    V+W G+    ++WEP EN+ N + L+ DF++++
Sbjct:   24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEV 75          
BLAST of Chromobox protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344224)

HSP 1 Score: 56.9954 bits (136), Expect = 9.100e-8
Identity = 39/124 (31.45%), Postives = 64/124 (51.61%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAE-TPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLL 1835
            TPL +A  KNR+ +V LLLR+GA    +  T++  TPL +A+ +G ++ V  LL + A  D   ++  T L+ A    + D++ +LL+ G        +         + + +RL NV  V LL
Sbjct:  372 TPLHIACKKNRLKVVELLLRHGA--SISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQV-----DARAREQQTPLHIASRLGNVDIVMLL 488          
BLAST of Chromobox protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303125)

HSP 1 Score: 56.9954 bits (136), Expect = 1.001e-7
Identity = 39/124 (31.45%), Postives = 64/124 (51.61%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAE-TPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLL 1835
            TPL +A  KNR+ +V LLLR+GA    +  T++  TPL +A+ +G ++ V  LL + A  D   ++  T L+ A    + D++ +LL+ G        +         + + +RL NV  V LL
Sbjct:  372 TPLHIACKKNRLKVVELLLRHGA--SISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQV-----DARAREQQTPLHIASRLGNVDIVMLL 488          
BLAST of Chromobox protein vs. Ensembl Fly
Match: CG3104 (gene:FBgn0031473 transcript:FBtr0335132)

HSP 1 Score: 55.0694 bits (131), Expect = 1.262e-7
Identity = 30/92 (32.61%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTNF 1742
            TPL  A     +++V++L++ GA  D T + D  TPL +A   G++  V+ LLD  A  +  +K R T ++ + +NG   V+S+L++ G   
Sbjct:   78 TPLFFAAQGGHLDVVKILIKAGASVD-TPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEI 168          

HSP 2 Score: 50.8322 bits (120), Expect = 2.619e-6
Identity = 34/100 (34.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTD-YRIKSRTALYFAIENGRVDVVSMLLKFGTNF 1742
            +K TP  +     A+  + V ++R+L       D  D  D  TPLILA++ G+ + V  LLD  A  +  R+   T L+FA + G +DVV +L+K G + 
Sbjct:    4 KKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDE-DGTTPLILAAAGGHTYCVMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASV 102          
BLAST of Chromobox protein vs. Ensembl Fly
Match: CG3104 (gene:FBgn0031473 transcript:FBtr0077686)

HSP 1 Score: 55.0694 bits (131), Expect = 1.262e-7
Identity = 30/92 (32.61%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTNF 1742
            TPL  A     +++V++L++ GA  D T + D  TPL +A   G++  V+ LLD  A  +  +K R T ++ + +NG   V+S+L++ G   
Sbjct:   78 TPLFFAAQGGHLDVVKILIKAGASVD-TPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEI 168          

HSP 2 Score: 50.8322 bits (120), Expect = 2.619e-6
Identity = 34/100 (34.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTD-YRIKSRTALYFAIENGRVDVVSMLLKFGTNF 1742
            +K TP  +     A+  + V ++R+L       D  D  D  TPLILA++ G+ + V  LLD  A  +  R+   T L+FA + G +DVV +L+K G + 
Sbjct:    4 KKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDE-DGTTPLILAAAGGHTYCVMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASV 102          
BLAST of Chromobox protein vs. Ensembl Zebrafish
Match: ANKRD50 (ankyrin repeat domain 50 [Source:HGNC Symbol;Acc:HGNC:29223])

HSP 1 Score: 64.6994 bits (156), Expect = 5.206e-10
Identity = 38/92 (41.30%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 1461 ECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTD-YRIKSRTALYFAIENGRVDVVSMLLKFG 1733
            +C+TPL +A  +  V++V LLL  GA  D TDN +  TPL+ A+S+G+   V  LL + A  D    + RT L  A   G V+VV  LL  G
Sbjct:  457 DCMTPLLVAAYEGHVDVVDLLLEGGADVDHTDN-NGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRG 547          
BLAST of Chromobox protein vs. Ensembl Zebrafish
Match: kidins220b (kinase D-interacting substrate 220b [Source:NCBI gene;Acc:335881])

HSP 1 Score: 60.8474 bits (146), Expect = 8.757e-9
Identity = 36/91 (39.56%), Postives = 56/91 (61.54%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTN 1739
            TPL LA  +  + IV+ L+R GA  +  D+ D  + LI A+  G++  VK LL+ SA+ ++R +   TAL +A   GRV+V ++LL+ G N
Sbjct:   48 TPLMLASEQGSLEIVQELIRRGANVNL-DDVDCWSALISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGAN 137          
BLAST of Chromobox protein vs. Ensembl Zebrafish
Match: ankk1 (ankyrin repeat and kinase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071015-4])

HSP 1 Score: 60.077 bits (144), Expect = 9.177e-9
Identity = 50/143 (34.97%), Postives = 70/143 (48.95%), Query Frame = 3
Query: 1389 DKYHLLHNALQNG------------VRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSL 1778
            D++  LH A+Q G             R D  EK   +  TPL LA      NIVR+LLR     D  ++    T L +AS  G+I+ VK LL+  A  D +  ++ TAL+ A E G   VV +L+  G +  ++ D  S SSL
Sbjct:  413 DQWTALHFAVQAGDDRATRFLLDNKARADAKEK---DGWTPLHLAAQNGHENIVRILLRRLDSVDVQEHQSCRTALHVASIYGHINIVKLLLNKGADIDKQDNNQSTALHLAAEEGHFRVVRLLVNSGADVNKV-DEQSYSSL 551          
BLAST of Chromobox protein vs. Ensembl Zebrafish
Match: asb2b (ankyrin repeat and SOCS box containing 2b [Source:ZFIN;Acc:ZDB-GENE-040426-20])

HSP 1 Score: 59.6918 bits (143), Expect = 1.127e-8
Identity = 45/137 (32.85%), Postives = 67/137 (48.91%), Query Frame = 3
Query: 1335 SDLISIDNFEDLKCSILMDKYHLLHNALQNG-VRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTN 1739
            ++++  D++  L  +    + H L   L+ G V  D   K T +  T L LAV   ++  VR+LL  GA PD   N   ETPL  A     +  V+ LL   A  D R ++ R+AL+ A E G V +   LL+ G +
Sbjct:   49 TEVLDGDDWTPLHEAAYRGQNHCLQALLREGQVCVD---KRTLQEETALMLAVQARQLECVRILLEAGADPDIC-NKSKETPLYRACEQECVQMVEVLLQRGAVVDQRCVRGRSALHAAAERGCVQICVCLLRAGAS 181          
BLAST of Chromobox protein vs. Ensembl Zebrafish
Match: asb2b (ankyrin repeat and SOCS box containing 2b [Source:ZFIN;Acc:ZDB-GENE-040426-20])

HSP 1 Score: 58.9214 bits (141), Expect = 1.969e-8
Identity = 45/138 (32.61%), Postives = 67/138 (48.55%), Query Frame = 3
Query: 1332 DSDLISIDNFEDLKCSILMDKYHLLHNALQNG-VRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTN 1739
             ++++  D++  L  +    + H L   L+ G V  D   K T +  T L LAV   ++  VR+LL  GA PD   N   ETPL  A     +  V+ LL   A  D R ++ R+AL+ A E G V +   LL+ G +
Sbjct:   48 GTEVLDGDDWTPLHEAAYRGQNHCLQALLREGQVCVD---KRTLQEETALMLAVQARQLECVRILLEAGADPDIC-NKSKETPLYRACEQECVQMVEVLLQRGAVVDQRCVRGRSALHAAAERGCVQICVCLLRAGAS 181          
BLAST of Chromobox protein vs. Ensembl Xenopus
Match: gart (phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase [Source:Xenbase;Acc:XB-GENE-993017])

HSP 1 Score: 62.003 bits (149), Expect = 4.789e-9
Identity = 46/132 (34.85%), Postives = 67/132 (50.76%), Query Frame = 3
Query: 1416 LQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTD-YRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRL 1808
            ++ G   D  +K   + +TPL +A  +  V++V LLL  GA  D TDN +  TPL+ A+S+G+   V  LL + A  D    + RT L  A   G V+VV  LL  G +     D+   + L    F G+RL
Sbjct:  723 IEQGAEVDHCDK---DGMTPLLVAAYEGHVDVVDLLLEGGADVDHTDN-NGRTPLLAAASMGHAAVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENH-RDDAGWTPLHMAAFEGHRL 849          
BLAST of Chromobox protein vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 60.8474 bits (146), Expect = 1.074e-8
Identity = 35/95 (36.84%), Postives = 52/95 (54.74%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            +  T   LTP+ +A     +NIV LLL+ GA PD T N   ET L +A+  G +  V+ LL   A  D R +  +T L+ A   G+ ++V +LL+
Sbjct:  404 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ 497          

HSP 2 Score: 57.7658 bits (138), Expect = 9.278e-8
Identity = 33/89 (37.08%), Postives = 52/89 (58.43%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFG 1733
            TPL +A  KNR+ ++ LL++YGA       +   TP+ +A+ +G+++ V  LL   A  D   I+  TAL+ A   G+V+VV  LL+ G
Sbjct:  379 TPLHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNG 466          

HSP 3 Score: 55.0694 bits (131), Expect = 6.995e-7
Identity = 46/143 (32.17%), Postives = 65/143 (45.45%), Query Frame = 3
Query: 1416 LQNGVRFDWNEKF-----TPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYV 1826
            LQN    D   K      T    TPL +A     VN+  LLL  GA  DFT   +  TPL +AS  G  + VK LLD     D + +   T L+ A  +G   VV +LL+ G     +A   +G S ++    G+ +  V ++
Sbjct:  191 LQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR-NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL--LARTKNGLSPLHMAAQGDHVECVKHL 330          
BLAST of Chromobox protein vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 60.8474 bits (146), Expect = 1.106e-8
Identity = 35/95 (36.84%), Postives = 52/95 (54.74%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            +  T   LTP+ +A     +NIV LLL+ GA PD T N   ET L +A+  G +  V+ LL   A  D R +  +T L+ A   G+ ++V +LL+
Sbjct:  404 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ 497          

HSP 2 Score: 58.151 bits (139), Expect = 8.922e-8
Identity = 33/89 (37.08%), Postives = 52/89 (58.43%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFG 1733
            TPL +A  KNR+ ++ LL++YGA       +   TP+ +A+ +G+++ V  LL   A  D   I+  TAL+ A   G+V+VV  LL+ G
Sbjct:  379 TPLHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNG 466          

HSP 3 Score: 55.0694 bits (131), Expect = 6.609e-7
Identity = 46/143 (32.17%), Postives = 65/143 (45.45%), Query Frame = 3
Query: 1416 LQNGVRFDWNEKF-----TPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYV 1826
            LQN    D   K      T    TPL +A     VN+  LLL  GA  DFT   +  TPL +AS  G  + VK LLD     D + +   T L+ A  +G   VV +LL+ G     +A   +G S ++    G+ +  V ++
Sbjct:  191 LQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR-NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL--LARTKNGLSPLHMAAQGDHVECVKHL 330          
BLAST of Chromobox protein vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 60.8474 bits (146), Expect = 1.116e-8
Identity = 35/95 (36.84%), Postives = 52/95 (54.74%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            +  T   LTP+ +A     +NIV LLL+ GA PD T N   ET L +A+  G +  V+ LL   A  D R +  +T L+ A   G+ ++V +LL+
Sbjct:  441 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ 534          

HSP 2 Score: 58.151 bits (139), Expect = 8.851e-8
Identity = 33/89 (37.08%), Postives = 52/89 (58.43%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFG 1733
            TPL +A  KNR+ ++ LL++YGA       +   TP+ +A+ +G+++ V  LL   A  D   I+  TAL+ A   G+V+VV  LL+ G
Sbjct:  416 TPLHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNG 503          

HSP 3 Score: 55.0694 bits (131), Expect = 6.725e-7
Identity = 46/143 (32.17%), Postives = 65/143 (45.45%), Query Frame = 3
Query: 1416 LQNGVRFDWNEKF-----TPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYV 1826
            LQN    D   K      T    TPL +A     VN+  LLL  GA  DFT   +  TPL +AS  G  + VK LLD     D + +   T L+ A  +G   VV +LL+ G     +A   +G S ++    G+ +  V ++
Sbjct:  228 LQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR-NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL--LARTKNGLSPLHMAAQGDHVECVKHL 367          
BLAST of Chromobox protein vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 60.8474 bits (146), Expect = 1.145e-8
Identity = 35/95 (36.84%), Postives = 52/95 (54.74%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            +  T   LTP+ +A     +NIV LLL+ GA PD T N   ET L +A+  G +  V+ LL   A  D R +  +T L+ A   G+ ++V +LL+
Sbjct:  425 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ 518          

HSP 2 Score: 58.151 bits (139), Expect = 8.925e-8
Identity = 33/89 (37.08%), Postives = 52/89 (58.43%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFG 1733
            TPL +A  KNR+ ++ LL++YGA       +   TP+ +A+ +G+++ V  LL   A  D   I+  TAL+ A   G+V+VV  LL+ G
Sbjct:  400 TPLHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNG 487          

HSP 3 Score: 55.0694 bits (131), Expect = 6.611e-7
Identity = 46/143 (32.17%), Postives = 65/143 (45.45%), Query Frame = 3
Query: 1416 LQNGVRFDWNEKF-----TPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYV 1826
            LQN    D   K      T    TPL +A     VN+  LLL  GA  DFT   +  TPL +AS  G  + VK LLD     D + +   T L+ A  +G   VV +LL+ G     +A   +G S ++    G+ +  V ++
Sbjct:  212 LQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR-NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL--LARTKNGLSPLHMAAQGDHVECVKHL 351          
BLAST of Chromobox protein vs. Ensembl Mouse
Match: Ankrd50 (ankyrin repeat domain 50 [Source:MGI Symbol;Acc:MGI:2139777])

HSP 1 Score: 60.8474 bits (146), Expect = 7.252e-9
Identity = 43/115 (37.39%), Postives = 60/115 (52.17%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTD-YRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRL 1808
            +TPL +A  +  V++V LLL  GA  D TDN +  TPL+ A+S+G+   V  LL + A  D    + RT L  A   G V+VV  LL  G +     D+   + L    F G+RL
Sbjct:  712 MTPLLVAAYEGHVDVVDLLLEGGADVDHTDN-NGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDESH-RDDAGWTPLHMAAFEGHRL 824          

HSP 2 Score: 53.9138 bits (128), Expect = 1.083e-6
Identity = 31/94 (32.98%), Postives = 54/94 (57.45%), Query Frame = 3
Query: 1461 ECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLKFGTN 1739
            E  + LQ A  +  V +V+LL+ +GA  D T N  A T L +A+  G++  V+ LL++ A  ++  +  RTA+  A +NG   ++ +L K+G +
Sbjct:  974 EKRSALQSAAWQGHVKVVQLLIEHGAVVDHTCNQGA-TALCIAAQEGHVDVVQVLLEHGADPNHADQFGRTAMRVAAKNGHSQIIKLLEKYGAS 1066          
BLAST of Chromobox protein vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 60.4622 bits (145), Expect = 1.100e-8
Identity = 40/95 (42.11%), Postives = 53/95 (55.79%), Query Frame = 3
Query: 1461 EC-LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTN 1739
            EC  TPL +A  +  V IV+ L++ GA  +  D  D  T LI AS  G+IH V+ LL   A  ++R +   TAL +A   GR DVV +LL  G N
Sbjct:   36 ECGQTPLMIAAEQGNVEIVKELIKNGANCNLED-LDNWTALISASKEGHIHIVEELLKCGANLEHRDMGGWTALMWACYKGRTDVVELLLSHGAN 129          
BLAST of Chromobox protein vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 60.4622 bits (145), Expect = 1.141e-8
Identity = 40/95 (42.11%), Postives = 53/95 (55.79%), Query Frame = 3
Query: 1461 EC-LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTN 1739
            EC  TPL +A  +  V IV+ L++ GA  +  D  D  T LI AS  G+IH V+ LL   A  ++R +   TAL +A   GR DVV +LL  G N
Sbjct:   36 ECGQTPLMIAAEQGNVEIVKELIKNGANCNLED-LDNWTALISASKEGHIHIVEELLKCGANLEHRDMGGWTALMWACYKGRTDVVELLLSHGAN 129          
BLAST of Chromobox protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 60.077 bits (144), Expect = 1.368e-8
Identity = 35/95 (36.84%), Postives = 52/95 (54.74%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            +  T   LTP+ +A     +NIV LLL+ GA PD T N   ET L +A+  G +  V+ LL   A  D R +  +T L+ A   G+ ++V +LL+
Sbjct:  404 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ 497          

HSP 2 Score: 55.8398 bits (133), Expect = 2.681e-7
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFGT 1736
            TPL +A  KNR+ ++ LL++YGA       +   TP+ +A+ +G+++ V  LL   A  D   I+  TAL+ A   G+V+VV  LL+ G 
Sbjct:  379 TPLHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGA 467          
BLAST of Chromobox protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 59.6918 bits (143), Expect = 1.732e-8
Identity = 35/95 (36.84%), Postives = 52/95 (54.74%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            +  T   LTP+ +A     +NIV LLL+ GA PD T N   ET L +A+  G +  V+ LL   A  D R +  +T L+ A   G+ ++V +LL+
Sbjct:  421 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ 514          

HSP 2 Score: 55.8398 bits (133), Expect = 2.881e-7
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFGT 1736
            TPL +A  KNR+ ++ LL++YGA       +   TP+ +A+ +G+++ V  LL   A  D   I+  TAL+ A   G+V+VV  LL+ G 
Sbjct:  396 TPLHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGA 484          
BLAST of Chromobox protein vs. UniProt/SwissProt
Match: sp|Q9EQG6|KDIS_RAT (Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus OX=10116 GN=Kidins220 PE=1 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 1.233e-8
Identity = 42/95 (44.21%), Postives = 53/95 (55.79%), Query Frame = 3
Query: 1461 EC-LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTN 1739
            EC  TPL LA  +  V IV+ LL+ GA  +  D  D  T LI AS  G+IH V+ LL   A  ++R +   TAL +A   GR DVV +LL  G N
Sbjct:   36 ECGQTPLMLAAEQGNVEIVKELLKNGANCNLED-LDNWTALISASKEGHIHIVEELLKSGASLEHRDMGGWTALMWACYKGRTDVVELLLSHGAN 129          
BLAST of Chromobox protein vs. UniProt/SwissProt
Match: sp|Q9ULJ7|ANR50_HUMAN (Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4)

HSP 1 Score: 60.8474 bits (146), Expect = 5.323e-8
Identity = 44/116 (37.93%), Postives = 62/116 (53.45%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTD-YRIKSRTALYFAIENGRVDVVSMLLKFGTNF-YRIADNLSGSSLINDMFMGNRL 1808
            +TPL +A  +  V++V LLL  GA  D TDN +  TPL+ A+S+G+   V  LL + A  D    + RT L  A   G V+VV  LL  G +  +R  D+   + L    F G+RL
Sbjct:  749 MTPLLVAAYEGHVDVVDLLLEGGADVDHTDN-NGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENHR--DDAGWTPLHMAAFEGHRL 861          

HSP 2 Score: 54.6842 bits (130), Expect = 4.205e-6
Identity = 31/91 (34.07%), Postives = 53/91 (58.24%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLKFGTN 1739
            + LQ A  +  V +V+LL+ +GA  D T N  A T L +A+  G+I  V+ LL++ A  ++  +  RTA+  A +NG   ++ +L K+G +
Sbjct: 1014 SALQSAAWQGHVKVVQLLIEHGAVVDHTCNQGA-TALCIAAQEGHIDVVQVLLEHGADPNHADQFGRTAMRVAAKNGHSQIIKLLEKYGAS 1103          
BLAST of Chromobox protein vs. UniProt/SwissProt
Match: sp|Q7T163|KDISB_DANRE (Kinase D-interacting substrate of 220 kDa B OS=Danio rerio OX=7955 GN=kidins220b PE=1 SV=3)

HSP 1 Score: 60.4622 bits (145), Expect = 6.667e-8
Identity = 36/91 (39.56%), Postives = 56/91 (61.54%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTN 1739
            TPL LA  +  + IV+ L+R GA  +  D+ D  + LI A+  G++  VK LL+ SA+ ++R +   TAL +A   GRV+V ++LL+ G N
Sbjct:   48 TPLMLASEQGSLEIVQELIRRGANVNL-DDVDCWSALISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGAN 137          
BLAST of Chromobox protein vs. UniProt/SwissProt
Match: sp|Q96NW4|ANR27_HUMAN (Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 1.369e-7
Identity = 41/140 (29.29%), Postives = 69/140 (49.29%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLLALLRTYHMSFINSLNRT 1886
            +PL +A    R +++ LLL++GA      N D   PL LA   G+   VK LLD +A  + + +   T L +A   G  ++V++LL+ G +    A N  G++ +++      +   V+V  L LL    +  +N   RT
Sbjct:  746 SPLHVAALHGRADLIPLLLKHGANAG-ARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASIN--ASNNKGNTALHEAV----IEKHVFVVELLLLHGASVQVLNKRQRT 878          
BLAST of Chromobox protein vs. UniProt/SwissProt
Match: sp|Q8NFD2|ANKK1_HUMAN (Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.592e-7
Identity = 38/108 (35.19%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 1416 LQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKS-RTALYFAIENGRVDVVSMLLKFGT 1736
            L +G   D  E+   E  TPL LA   N  N+ RLL+   A P+  +  + +TPL +A+  G++  VK L    A  D + ++ RT L+ A+E G+V  +  LLK G 
Sbjct:  448 LDHGACVDAQER---EGWTPLHLAAQNNFENVARLLVSRQADPNLHE-AEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGA 551          
BLAST of Chromobox protein vs. TrEMBL
Match: G4V7S3 (Chromobox protein-related (Chromobox 1) (Heterochromatin 1) OS=Schistosoma mansoni OX=6183 GN=Smp_144550 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.548e-25
Identity = 72/177 (40.68%), Postives = 96/177 (54.24%), Query Frame = 3
Query:  348 DSRTDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDF----KNKI------------------------------------------SDDKFEEXXXXXXXXXXXXXXGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKRLHLEEGSD 740
            D+ + N YIVE I+  ++  G+ Y+KV+W+G+    DSWEPE+NLTNVLD+I +F    K+KI                                          S+++    S    +  +SR  G YEYVP +++VA+KTKYFDDIRDGKIDL  NDLYSRVKTRKR   E  S+
Sbjct:   43 DTNSVNVYIVESILNERIIKGQKYYKVRWEGFPPEADSWEPEKNLTNVLDIISEFHNGSKSKISKNLDIHKDCQTVFENSPASVPTPPATPCSVLQNSHNSLRGSSEERQLNKSVKRKHFTKSRTGGRYEYVPKHQLVASKTKYFDDIRDGKIDLCSNDLYSRVKTRKRCAAESASN 219          

HSP 2 Score: 62.7734 bits (151), Expect = 3.845e-6
Identity = 51/177 (28.81%), Postives = 92/177 (51.98%), Query Frame = 3
Query: 1797 GNRLSNVVYVDLL-ALLRTYHMSFINSLNRTITRYFTKHFIKQICIIFPHQWVSVLEKEFHIDF-----LLDSSIM-TNIDTPILLLVHG-IQADCDFDFWLDNNCCCV-ESVYVNDAR-QSSLSASSFVTTLWPLNASS-----NKLTVNFTDQHLLSPEEKQ---IRIAIVAVSI 2273
            GN L +V  +  L  L+  +H     S+   +  + T+  + Q+ ++ P QW+SV +    + F     L +S +  + +  PIL+LVHG I     +D W+D++  CV E V ++    Q +LS   FVTT++PL  +S     +++++NF  + + S    +   + I IVAV++
Sbjct:  721 GNALPSVDSLRRLHELIVAHHARLSMSVTNLVRTWLTRADLVQVGLVSPCQWISVRQCSASVKFSWPNELSNSKLQPSRVVAPILILVHGRIAPPACYDVWMDDDGPCVIERVCLDQTYIQRALSRMPFVTTVYPLGWNSLKPQEHEVSINFKPESISSIHSTRPTCVAIMIVAVAL 897          
BLAST of Chromobox protein vs. TrEMBL
Match: A0A2H1C1H2 (Chromo' (CHRromatin Organization MOdifier) domain protein OS=Fasciola hepatica OX=6192 GN=D915_11793 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.352e-24
Identity = 68/166 (40.96%), Postives = 93/166 (56.02%), Query Frame = 3
Query:  357 TDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVL-------------------DLIEDFKNKISDDKF---------------------EEXXXXXXX-----XXXXXXXGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKRL 719
            +D+ Y+VE I+G ++  G+ ++KV+WQG+    DSWEPEENL+NVL                   DL +DF +  ++                        EE    S         +SR+SG YEYVP +++VA+KTKYFDDIRDGKIDL+ NDLYSRVKTR+R+
Sbjct:   52 SDSVYLVENILGERIVKGQKFYKVRWQGFPPEADSWEPEENLSNVLEAINLYHRRQTEELTNTGTDLTKDFPSVCANSPASVPTPPSTPGCSQTKRLRGGSEERHSHSLGIKRKHGPKSRSSGRYEYVPKHELVASKTKYFDDIRDGKIDLSSNDLYSRVKTRRRM 217          
BLAST of Chromobox protein vs. TrEMBL
Match: A0A0R3WEK2 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9255 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.422e-23
Identity = 64/144 (44.44%), Postives = 81/144 (56.25%), Query Frame = 3
Query:  360 DNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDFKNKI-----------------------SDDKFEEXXXXXXXXXXXXXXGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKRLH 722
            D  Y+V+ I+  +    + Y+KV+W G+  SEDSWEPE NLT V +LI +F  K                        S    ++    S   M    +G +EYV  +++VATKTKYFDDIRDGKIDLT NDLYSRVKTRKR H
Sbjct:   15 DETYLVDSIIDERYIKNQKYYKVRWHGFPPSEDSWEPEANLTGVRELIREFHLKKKSSSTSRQHSSAKKRPELSSEAHSSKSVQDPPSPSKRRMTKSRTGHFEYVLQSELVATKTKYFDDIRDGKIDLTSNDLYSRVKTRKRCH 158          
BLAST of Chromobox protein vs. TrEMBL
Match: Q5DBZ5 (SJCHGC05321 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.895e-23
Identity = 67/173 (38.73%), Postives = 94/173 (54.34%), Query Frame = 3
Query:  348 DSRTDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDF----------------------------------------KNKI---SDDKFEEXXXXXXXXXXXXXXGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKRLHLEEGS 737
            ++ +   YIVE I   K+  G+ Y+KV+W+G+    DSWEPE NLT+VL++I +F                                         N++   S+++  ++S    +  +SR SG YEYVP +++VA+KTKYFDDIRDGKIDL  NDLYSRVKTR+R   E  S
Sbjct:   45 NAESGEVYIVESIRDEKIIKGQKYYKVRWRGFPPEADSWEPERNLTSVLNIISEFHSSKSKISKSLDMQKNYKAANSPASVPTPPATPNLLLQNLPNRLRGSSEERQLDNSAKRKHCAKSRTSGRYEYVPKHQLVASKTKYFDDIRDGKIDLCSNDLYSRVKTRRRCAAESAS 217          
BLAST of Chromobox protein vs. TrEMBL
Match: A0A5K3FU77 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 3.652e-23
Identity = 61/142 (42.96%), Postives = 83/142 (58.45%), Query Frame = 3
Query:  360 DNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDFKNKI-----------------------SDDKFEEXXXXXXXXXXXXXXGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKR 716
            D  YIVE I+G ++   + ++KV+W+G+  +EDSWEPE NL++V  LI+ F+ K                        S+    +S  +    M     G +EYVP N++VA KTKYFDDIR+GKIDL  NDLYSRVKTR+R
Sbjct:   15 DGVYIVESIIGERVVKKQRFYKVRWEGFSPNEDSWEPESNLSSVRALIKKFQLKQQSISTLRQRSSKKGHSQSVIEQNSNKPNRKSLHLHKRRMTKSRVGHFEYVPQNELVAAKTKYFDDIRNGKIDLISNDLYSRVKTRRR 156          
BLAST of Chromobox protein vs. Ensembl Cavefish
Match: ANKRD50 (ankyrin repeat domain 50 [Source:NCBI gene;Acc:103026486])

HSP 1 Score: 63.929 bits (154), Expect = 8.199e-10
Identity = 38/92 (41.30%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 1461 ECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTD-YRIKSRTALYFAIENGRVDVVSMLLKFG 1733
            +C+TPL +A  +  V++V LLL  GA  D TDN +  TPL+ A+S+G+   V  LL + A  D    + RT L  A   G V+VV  LL  G
Sbjct:  741 DCMTPLLVAAYEGHVDVVDLLLEGGADVDHTDN-NGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRG 831          
BLAST of Chromobox protein vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 62.7734 bits (151), Expect = 1.685e-9
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTN 1739
            TPL LA  +  + I++ L+R GA  +  D+ D  + LI A+  G++  VK LLD SA+ ++R +   TAL +A   GRV+V  +LL+ G N
Sbjct:   48 TPLMLAAEQGSLEIIQELIRRGANVNL-DDVDCWSALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGAN 137          
BLAST of Chromobox protein vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 62.7734 bits (151), Expect = 1.716e-9
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTN 1739
            TPL LA  +  + I++ L+R GA  +  D+ D  + LI A+  G++  VK LLD SA+ ++R +   TAL +A   GRV+V  +LL+ G N
Sbjct:   48 TPLMLAAEQGSLEIIQELIRRGANVNL-DDVDCWSALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGAN 137          
BLAST of Chromobox protein vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 62.7734 bits (151), Expect = 1.729e-9
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTN 1739
            TPL LA  +  + I++ L+R GA  +  D+ D  + LI A+  G++  VK LLD SA+ ++R +   TAL +A   GRV+V  +LL+ G N
Sbjct:   40 TPLMLAAEQGSLEIIQELIRRGANVNL-DDVDCWSALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGAN 129          
BLAST of Chromobox protein vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 58.9214 bits (141), Expect = 2.072e-9
Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTNFY 1745
            TPL  A +KN+  I  LLL  GA P+ TD  ++ TPL  AS+ G    ++ LL  SA T+ +  +  TAL+ A +  RV+   +L++ G + Y
Sbjct:   75 TPLHYAASKNQYEIALLLLENGADPNATDKLES-TPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGASIY 166          
BLAST of Chromobox protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 1.556e-8
Identity = 34/96 (35.42%), Postives = 54/96 (56.25%), Query Frame = 3
Query: 1455 TPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKS-RTALYFAIENGRVDVVSMLLKFGTN 1739
            T   LTP+ +A     +N+V+LLL+ GA  + T N   ETPL +AS  G +  VK LL   A    + +  +T L+ A   G+ ++V +LL+ G++
Sbjct:  400 TESGLTPIHVASFMGHLNVVQLLLQNGASSNAT-NVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSD 494          

HSP 2 Score: 55.0694 bits (131), Expect = 6.412e-8
Identity = 31/90 (34.44%), Postives = 54/90 (60.00%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFGT 1736
            TPL +A  KNR+ ++ LLL++GA    T  +   TP+ +AS +G+++ V+ LL   A ++   ++  T L+ A   G+++VV  LL+ G 
Sbjct:  372 TPLHIACKKNRIKVMELLLKHGASIHTTTESGL-TPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGA 460          

HSP 3 Score: 48.9062 bits (115), Expect = 5.440e-6
Identity = 33/87 (37.93%), Postives = 46/87 (52.87%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            TPL +A     +N+  LLL  GA  DFT   +  TPL +A+  G  + VK LLD  A  D + +   T L+ A  +G   V+ MLL+
Sbjct:  207 TPLHIAAHYGNMNVATLLLNLGAAVDFTAR-NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLE 292          
BLAST of Chromobox protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 1.634e-8
Identity = 34/96 (35.42%), Postives = 54/96 (56.25%), Query Frame = 3
Query: 1455 TPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKS-RTALYFAIENGRVDVVSMLLKFGTN 1739
            T   LTP+ +A     +N+V+LLL+ GA  + T N   ETPL +AS  G +  VK LL   A    + +  +T L+ A   G+ ++V +LL+ G++
Sbjct:  407 TESGLTPIHVASFMGHLNVVQLLLQNGASSNAT-NVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSD 501          

HSP 2 Score: 54.6842 bits (130), Expect = 7.839e-8
Identity = 31/90 (34.44%), Postives = 54/90 (60.00%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFGT 1736
            TPL +A  KNR+ ++ LLL++GA    T  +   TP+ +AS +G+++ V+ LL   A ++   ++  T L+ A   G+++VV  LL+ G 
Sbjct:  379 TPLHIACKKNRIKVMELLLKHGASIHTTTESGL-TPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGA 467          

HSP 3 Score: 49.2914 bits (116), Expect = 4.291e-6
Identity = 34/92 (36.96%), Postives = 47/92 (51.09%), Query Frame = 3
Query: 1455 TPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            T    TPL +A     +N+  LLL  GA  DFT   +  TPL +A+  G  + VK LLD  A  D + +   T L+ A  +G   V+ MLL+
Sbjct:  209 TESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTAR-NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLE 299          
BLAST of Chromobox protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 3.114e-8
Identity = 38/112 (33.93%), Postives = 58/112 (51.79%), Query Frame = 3
Query: 1416 LQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR---TALYFAIENGRVDVVSMLLKFGTNF 1742
            L NG   +   + T +  TPL LA +  R  +V LL+  GA  +  + +D  TPL LA+S GY++ +K LL+  A  + R  S+   + L  A  NG    V +LL  G++ 
Sbjct:  986 LDNGADIEAQSERTKD--TPLSLACSGGRQEVVELLIARGANKEHRNVSD-YTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDI 1094          

HSP 2 Score: 52.7582 bits (125), Expect = 3.647e-7
Identity = 36/113 (31.86%), Postives = 55/113 (48.67%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSA-FTDYRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGN 1802
            +TPL  A +   V+IVRLLL +GA  +   +T   T L  A + GY+  V+ LL+  A   D+     T L  A   G V+V  +LL+ G      ++    S+L    + G+
Sbjct:  168 ITPLMAAASGGFVDIVRLLLAHGADVNAQSST-GNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGH 279          

HSP 3 Score: 51.6026 bits (122), Expect = 8.665e-7
Identity = 47/172 (27.33%), Postives = 75/172 (43.60%), Query Frame = 3
Query: 1329 IDSDLISIDNFEDLKCSILMDKYH--LLHNALQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLKFGTNF-YRIADNLSGSSLINDMFMGNRLSNVVYVDL 1832
            +D D I  ++  D   ++     H  L+   +  G   +  +K   +  TPL LA T   VN+V LLL  GA  +       +TPL LA S G    V+ L+   A  ++R +   T L  A   G V+++ +LL  G     R    L  S L+     G+  +  + +D+
Sbjct:  922 VDIDCIHTESNHDTALTLACAGGHEDLVTVLIARGANIEHRDK---KGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDM 1090          

HSP 4 Score: 49.6766 bits (117), Expect = 3.145e-6
Identity = 33/98 (33.67%), Postives = 50/98 (51.02%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRI-KSRTALYFAIENGRVDVVSMLLKFGTNFYRIADN 1760
            TPL  A +   V + RLLL  GA  +   N   E+ L LA   G++  V+ LL+  A  +++  +  TAL  A  +G V+V  +LL+ G      AD+
Sbjct:  235 TPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADS 332          
BLAST of Chromobox protein vs. Ensembl Sea Lamprey
Match: anks1b (ankyrin repeat and sterile alpha motif domain containing 1B [Source:NCBI gene;Acc:565408])

HSP 1 Score: 54.6842 bits (130), Expect = 8.844e-8
Identity = 45/126 (35.71%), Postives = 65/126 (51.59%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLLALLR 1847
            TPL LA    R+++V LL R   P     NT   TPL LA+  G+   V+ LL+     + + +  +AL+ A   GRVDVV +LL+ G N   I D  S ++L  D+   +R    + +   ALLR
Sbjct:  161 TPLDLAALYGRLDVVTLLTR-SHPNLLACNTKQHTPLHLAARNGHTGTVQVLLEAGMDVNIQSEKGSALHEAALFGRVDVVRLLLEAGINV-NIRDKQSKTAL--DILGEHRSQKALQIS--ALLR 280          
BLAST of Chromobox protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.162e-7
Identity = 36/128 (28.12%), Postives = 66/128 (51.56%), Query Frame = 3
Query: 1347 SIDNFEDLKCSILMDKYHLLHNALQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLK 1727
            +++ F  L  +   ++  ++   L+ G      E  T   LTP+ ++     +NIV +LL+ GA P+ T N   ET L +A+  G    V++LL   A  D + +  +T L+ A   G++++V +LL+
Sbjct:   12 ALNGFTPLHIACKKNRIRVMELLLKYGASI---EAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNAT-NVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQ 135          

HSP 2 Score: 53.1434 bits (126), Expect = 2.456e-7
Identity = 37/121 (30.58%), Postives = 64/121 (52.89%), Query Frame = 3
Query: 1377 SILMDKYHLLHNALQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLKFGT 1736
            S+L+ +Y  +++A ++G             L+PL LA  +++VN+  +L+++GA  + T      TPLI+A   G I  V  LL + A  + + K   T L+ A + G   +V++LLK G 
Sbjct:  296 SLLLARYADVNHATKSG-------------LSPLHLAAQEDKVNVAEILVKHGAHVNATTKL-GYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGA 402          

HSP 3 Score: 51.9878 bits (123), Expect = 6.048e-7
Identity = 30/90 (33.33%), Postives = 51/90 (56.67%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDY-RIKSRTALYFAIENGRVDVVSMLLKFGT 1736
            TPL +A  KNR+ ++ LLL+YGA  +    +   TP+ +++ +G ++ V  LL   A  +   ++  TAL+ A   G+ +VV  LL+ G 
Sbjct:   17 TPLHIACKKNRIRVMELLLKYGASIEAVTESGL-TPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGA 105          

HSP 4 Score: 49.2914 bits (116), Expect = 4.165e-6
Identity = 34/105 (32.38%), Postives = 57/105 (54.29%), Query Frame = 3
Query: 1416 LQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLK 1727
            L+NG + D   +   E  TPL +A    ++ IV+LLL++ A PD    ++  TPL +A+  G+      LL++ A      K   T L+ A + G+++V S+LL+
Sbjct:  101 LRNGAQVDAKAR---EEQTPLHIAARLGKLEIVQLLLQHMASPD-AATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQ 201          
BLAST of Chromobox protein vs. Ensembl Nematostella
Match: EDO34862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN63])

HSP 1 Score: 46.2098 bits (108), Expect = 2.939e-6
Identity = 30/92 (32.61%), Postives = 44/92 (47.83%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKS-RTALYFAIENGRVDVVSMLLKFGTN 1739
            +TPL LA  K    ++  LLR GA  +  D     +PL  A   G  H ++ LL   A  + R  S  TA++ A      +VVS+L  +G +
Sbjct:    6 MTPLHLATLKGNRELITELLRMGADLNVEDGNSGRSPLHHAVESGRYHVIEFLLSRGALVNQRTFSGNTAMHTAAGRQMDEVVSLLASYGAD 97          
BLAST of Chromobox protein vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 48.1358 bits (113), Expect = 4.148e-6
Identity = 31/87 (35.63%), Postives = 43/87 (49.43%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYR-IKSRTALYFAIENGRVDVVSMLLK 1727
            TPL +A  K  + + RLL+  GA  D   N   ETPL +A+ +G   A+K LL      D R    RT    A+  GR +   +LL+
Sbjct:   38 TPLHVACKKGSMEVGRLLVEKGAALD-KKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLE 123          
BLAST of Chromobox protein vs. Ensembl Nematostella
Match: EDO27150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA22])

HSP 1 Score: 43.8986 bits (102), Expect = 6.316e-6
Identity = 19/60 (31.67%), Postives = 38/60 (63.33%), Query Frame = 3
Query:  354 RTDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLD--LIEDFKNKIS 527
            R    Y  E I+  ++ +GK ++ ++W+GY +  ++WEPEE   NVLD  L++ ++ +++
Sbjct:    6 RAAGIYAAETILKERVRDGKVWYFIKWKGYSQRYNTWEPEE---NVLDPRLLKAYQERLA 62          
BLAST of Chromobox protein vs. Ensembl Nematostella
Match: EDO39112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB40])

HSP 1 Score: 48.9062 bits (115), Expect = 8.027e-6
Identity = 36/93 (38.71%), Postives = 48/93 (51.61%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTNF 1742
            LT L +A    R    RLLL  GA  D+ D+ +  TPL   +S+G    VK LL+Y A  + R K+R T L  A   GR++V   LL  G + 
Sbjct:  107 LTALHIAAAAARTEACRLLLEKGAEVDYRDD-ERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADI 198          
BLAST of Chromobox protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 59.6918 bits (143), Expect = 1.428e-8
Identity = 46/141 (32.62%), Postives = 69/141 (48.94%), Query Frame = 3
Query: 1416 LQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSA-FTDYRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLL 1835
            LQN  + D   K   +  TPL  A       +V+LLL + A PD +  T   TPL +A+  G+IH ++ LLD  A       K  T L+ A + G+VDV  +LL+ G N      N +G + +  + +    +N+  V LL
Sbjct:  455 LQNAAQVDARAK---DDQTPLHCAARMGHKELVKLLLDHKANPD-SATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGAN-----PNAAGKNGLTPLHVAVHHNNLDVVKLL 586          

HSP 2 Score: 56.6102 bits (135), Expect = 1.178e-7
Identity = 37/99 (37.37%), Postives = 52/99 (52.53%), Query Frame = 3
Query: 1446 EKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLKFGTN 1739
            E  T   LTPL +A     +NIV+ LL+ GA P+ + N   ETPL +AS  G+    + LL  +A  D R K  +T L+ A   G  ++V +LL    N
Sbjct:  396 EAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNAS-NVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKAN 493          

HSP 3 Score: 53.5286 bits (127), Expect = 1.170e-6
Identity = 44/147 (29.93%), Postives = 70/147 (47.62%), Query Frame = 3
Query: 1467 LTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIK-SRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLLAL-----LRTYHMSFINSLNRTI 1889
            LTPL L   +  V I   L++ GA   +  +    TPL +A   G I  VK LL   A  + + +   T L+ A + G  D+V++LLK G     I  N  G+S    + +  RL  +  +D+L L     + T+ MSF  +++  +
Sbjct:  667 LTPLHLVAQEGHVGIADTLVKQGAS-VYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSN--GTS---PLGIAKRLGYISVIDVLKLVTEESVSTHRMSFPETVDEIL 807          

HSP 4 Score: 51.2174 bits (121), Expect = 5.749e-6
Identity = 45/160 (28.12%), Postives = 75/160 (46.88%), Query Frame = 3
Query: 1263 LHVYSKN--IRQGTVCTFNMPKVQIDSDLISIDNFEDLKCSILMDKYHLLHNALQNGVRFDWNEKFTPE-CLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKF 1730
            LH+ ++N   R   V   N P    + D++S   F  L  +   +   +    L  G     N  FTP+  +TPL +A  +  V +VRLLL  GA  D     D  TPL  A+  G++  ++ LL++ A    + K+  + ++ A +   +D V  LL++
Sbjct:  175 LHIAARNDDTRTAAVLLQNDP----NPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGA----NVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQID-AQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQY 325          
BLAST of Chromobox protein vs. Ensembl Medaka
Match: ENSORLT00000041917.1 (pep primary_assembly:ASM223467v1:19:16436475:16453404:1 gene:ENSORLG00000026670.1 transcript:ENSORLT00000041917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.540e-8
Identity = 38/100 (38.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSG 1769
            TPL ++    + +IV+LLL  GA PD T N+   TPL LA+  G+     ALLD  A     +   T L+ A + G VD+V++LL  G+   R   +L G
Sbjct:   83 TPLHISSRLGKQDIVQLLLTNGADPDATTNS-GYTPLHLAAREGHKDIAAALLDQGA----NLSGITPLHLAAQEGSVDIVTLLLARGSPINRPLCHLVG 177          
BLAST of Chromobox protein vs. Ensembl Medaka
Match: ANKS1A (ankyrin repeat and sterile alpha motif domain containing 1A [Source:NCBI gene;Acc:101163740])

HSP 1 Score: 56.9954 bits (136), Expect = 9.905e-8
Identity = 40/98 (40.82%), Postives = 52/98 (53.06%), Query Frame = 3
Query: 1443 NEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTD-NTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFG 1733
            N KF     TPL LA    R+ +V+LLLR  A P+    NT   TPL LAS  G++  V+ LLD     +Y  +  +AL+ A   G+ DVV  LL  G
Sbjct:  191 NNKFE----TPLDLAALYGRLEVVKLLLR--AHPNLLHCNTKKHTPLHLASRNGHLSVVEVLLDAGMDINYETEKGSALHEAGLFGKADVVQKLLNAG 282          
BLAST of Chromobox protein vs. Ensembl Medaka
Match: ANKS1A (ankyrin repeat and sterile alpha motif domain containing 1A [Source:NCBI gene;Acc:101163740])

HSP 1 Score: 56.6102 bits (135), Expect = 1.048e-7
Identity = 40/98 (40.82%), Postives = 52/98 (53.06%), Query Frame = 3
Query: 1443 NEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTD-NTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFG 1733
            N KF     TPL LA    R+ +V+LLLR  A P+    NT   TPL LAS  G++  V+ LLD     +Y  +  +AL+ A   G+ DVV  LL  G
Sbjct:  191 NNKFE----TPLDLAALYGRLEVVKLLLR--AHPNLLHCNTKKHTPLHLASRNGHLSVVEVLLDAGMDINYETEKGSALHEAGLFGKADVVQKLLNAG 282          
BLAST of Chromobox protein vs. Ensembl Medaka
Match: ANKS1A (ankyrin repeat and sterile alpha motif domain containing 1A [Source:NCBI gene;Acc:101163740])

HSP 1 Score: 56.6102 bits (135), Expect = 1.107e-7
Identity = 40/98 (40.82%), Postives = 52/98 (53.06%), Query Frame = 3
Query: 1443 NEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTD-NTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFG 1733
            N KF     TPL LA    R+ +V+LLLR  A P+    NT   TPL LAS  G++  V+ LLD     +Y  +  +AL+ A   G+ DVV  LL  G
Sbjct:  191 NNKFE----TPLDLAALYGRLEVVKLLLR--AHPNLLHCNTKKHTPLHLASRNGHLSVVEVLLDAGMDINYETEKGSALHEAGLFGKADVVQKLLNAG 282          
BLAST of Chromobox protein vs. Planmine SMEST
Match: SMESG000047257.1 (SMESG000047257.1)

HSP 1 Score: 1303.12 bits (3371), Expect = 0.000e+0
Identity = 700/701 (99.86%), Postives = 700/701 (99.86%), Query Frame = 3
Query:  177 MSARKQGKNNKRHFHEQVDSFDDKKKNINLSHCEVEXXXXXXXXXXXXXXXXXXXXQDSRTDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDFKNKISDDKFEEXXXXXXXXXXXXXXGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKRLHLEEGSDKPXXXXXXXXXXXXXXXXXXXXXXXXXXXDVPISFEKNKFYQSNLFEMTAEFMKTGSFKKSQNTIASKSSSNDDISLFNYSISPNTNQSDDFPVQISPAHVINIESSKQSVYTQTISTDFEVQESIIQKEETESKLINPTLSVKPHVQKIIDKIDQSFEKPSFQKRFVTNDTDLLHVYSKNIRQGTVCTFNMPKVQIDSDLISIDNFEDLKCSILMDKYHLLHNALQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLLALLRTYHMSFINSLNRTITRYFTKHFIKQICIIFPHQWVSVLEKEFHIDFLLDSSIMTNIDTPILLLVHGIQADCDFDFWLDNNCCCVESVYVNDARQSSLSASSFVTTLWPLNASSNKLTVNFTDQHLLSPEEKQIRIAIVAVSIDC 2279
            MSARKQGKNNKRHFHEQVDSFDDKKKNINLSHCEVESRSSSCCSKRSNKKSNNKKSQDSRTDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDFKNKISDDKFEESSRISNNIMRSRNSGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKRLHLEEGSDKPIESTENETDNITIEETTEVVETAIKTEDVPISFEKNKFYQSNLFEMTAEFMKTGSFKKSQNTIASKSSSNDDISLFNYSISPNTNQSDDFPVQISPAHVINIESSKQSVYTQTISTDFEVQESIIQKEETESKLINPTLSVKPHVQKIIDKIDQSFEKPS QKRFVTNDTDLLHVYSKNIRQGTVCTFNMPKVQIDSDLISIDNFEDLKCSILMDKYHLLHNALQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLLALLRTYHMSFINSLNRTITRYFTKHFIKQICIIFPHQWVSVLEKEFHIDFLLDSSIMTNIDTPILLLVHGIQADCDFDFWLDNNCCCVESVYVNDARQSSLSASSFVTTLWPLNASSNKLTVNFTDQHLLSPEEKQIRIAIVAVSIDC
Sbjct:    1 MSARKQGKNNKRHFHEQVDSFDDKKKNINLSHCEVESRSSSCCSKRSNKKSNNKKSQDSRTDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDFKNKISDDKFEESSRISNNIMRSRNSGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKRLHLEEGSDKPIESTENETDNITIEETTEVVETAIKTEDVPISFEKNKFYQSNLFEMTAEFMKTGSFKKSQNTIASKSSSNDDISLFNYSISPNTNQSDDFPVQISPAHVINIESSKQSVYTQTISTDFEVQESIIQKEETESKLINPTLSVKPHVQKIIDKIDQSFEKPSLQKRFVTNDTDLLHVYSKNIRQGTVCTFNMPKVQIDSDLISIDNFEDLKCSILMDKYHLLHNALQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLLALLRTYHMSFINSLNRTITRYFTKHFIKQICIIFPHQWVSVLEKEFHIDFLLDSSIMTNIDTPILLLVHGIQADCDFDFWLDNNCCCVESVYVNDARQSSLSASSFVTTLWPLNASSNKLTVNFTDQHLLSPEEKQIRIAIVAVSIDC 701          
BLAST of Chromobox protein vs. Planmine SMEST
Match: SMESG000065471.1 (SMESG000065471.1)

HSP 1 Score: 1302.35 bits (3369), Expect = 0.000e+0
Identity = 700/701 (99.86%), Postives = 700/701 (99.86%), Query Frame = 3
Query:  177 MSARKQGKNNKRHFHEQVDSFDDKKKNINLSHCEVEXXXXXXXXXXXXXXXXXXXXQDSRTDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDFKNKISDDKFEEXXXXXXXXXXXXXXGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKRLHLEEGSDKPXXXXXXXXXXXXXXXXXXXXXXXXXXXDVPISFEKNKFYQSNLFEMTAEFMKTGSFKKSQNTIASKSSSNDDISLFNYSISPNTNQSDDFPVQISPAHVINIESSKQSVYTQTISTDFEVQESIIQKEETESKLINPTLSVKPHVQKIIDKIDQSFEKPSFQKRFVTNDTDLLHVYSKNIRQGTVCTFNMPKVQIDSDLISIDNFEDLKCSILMDKYHLLHNALQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLLALLRTYHMSFINSLNRTITRYFTKHFIKQICIIFPHQWVSVLEKEFHIDFLLDSSIMTNIDTPILLLVHGIQADCDFDFWLDNNCCCVESVYVNDARQSSLSASSFVTTLWPLNASSNKLTVNFTDQHLLSPEEKQIRIAIVAVSIDC 2279
            MSARKQGKNNKRHFHEQVDSFDDKKKNINLSHCEVESRSSSCCSKRSNKKSNNKKSQDSRTDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDFKNKISDDKFEESSRISNNIMRSRNSGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKRLHLEEGSDKPIESTENETDNITIEETTEVVETAIKTEDVPISFEKNK YQSNLFEMTAEFMKTGSFKKSQNTIASKSSSNDDISLFNYSISPNTNQSDDFPVQISPAHVINIESSKQSVYTQTISTDFEVQESIIQKEETESKLINPTLSVKPHVQKIIDKIDQSFEKPSFQKRFVTNDTDLLHVYSKNIRQGTVCTFNMPKVQIDSDLISIDNFEDLKCSILMDKYHLLHNALQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLLALLRTYHMSFINSLNRTITRYFTKHFIKQICIIFPHQWVSVLEKEFHIDFLLDSSIMTNIDTPILLLVHGIQADCDFDFWLDNNCCCVESVYVNDARQSSLSASSFVTTLWPLNASSNKLTVNFTDQHLLSPEEKQIRIAIVAVSIDC
Sbjct:    1 MSARKQGKNNKRHFHEQVDSFDDKKKNINLSHCEVESRSSSCCSKRSNKKSNNKKSQDSRTDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEENLTNVLDLIEDFKNKISDDKFEESSRISNNIMRSRNSGCYEYVPSNKVVATKTKYFDDIRDGKIDLTKNDLYSRVKTRKRLHLEEGSDKPIESTENETDNITIEETTEVVETAIKTEDVPISFEKNKCYQSNLFEMTAEFMKTGSFKKSQNTIASKSSSNDDISLFNYSISPNTNQSDDFPVQISPAHVINIESSKQSVYTQTISTDFEVQESIIQKEETESKLINPTLSVKPHVQKIIDKIDQSFEKPSFQKRFVTNDTDLLHVYSKNIRQGTVCTFNMPKVQIDSDLISIDNFEDLKCSILMDKYHLLHNALQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTALYFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYVDLLALLRTYHMSFINSLNRTITRYFTKHFIKQICIIFPHQWVSVLEKEFHIDFLLDSSIMTNIDTPILLLVHGIQADCDFDFWLDNNCCCVESVYVNDARQSSLSASSFVTTLWPLNASSNKLTVNFTDQHLLSPEEKQIRIAIVAVSIDC 701          
BLAST of Chromobox protein vs. Planmine SMEST
Match: SMESG000013006.1 (SMESG000013006.1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.336e-10
Identity = 36/104 (34.62%), Postives = 60/104 (57.69%), Query Frame = 3
Query: 1431 RFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKS-RTALYFAIENGRVDVVSMLLKFGTN 1739
            + D NE   P+  TPL  A+  N  +IV LLL+ GA P+   +    TPL+ A+++GY + V+ LL+Y A  D +  +  TAL++A  +G  +   ++L + +N
Sbjct:   37 KCDVNE-IGPDGETPLTCAINANNYDIVELLLKSGADPNLRPDKVESTPLMDAANVGYKNIVQILLEYGANPDIKSSTNNTALHYAACSGHSECCKLILDYSSN 139          

HSP 2 Score: 56.6102 bits (135), Expect = 9.752e-8
Identity = 36/92 (39.13%), Postives = 50/92 (54.35%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTNF 1742
            T L +A  K     V+LLL++GA  D + N   +TPL LA + GYI  V+ L+DY A  +     R T L  A + G + VV  L+K+ T F
Sbjct: 1414 TVLIIAADKGHTEFVKLLLKHGAIVD-SKNKKGDTPLWLACNGGYIDVVRLLIDYKADANSSDNRRMTCLMTAFKKGHIKVVKELVKYVTQF 1504          
BLAST of Chromobox protein vs. Planmine SMEST
Match: SMESG000013006.1 (SMESG000013006.1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.500e-10
Identity = 36/104 (34.62%), Postives = 60/104 (57.69%), Query Frame = 3
Query: 1431 RFDWNEKFTPECLTPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKS-RTALYFAIENGRVDVVSMLLKFGTN 1739
            + D NE   P+  TPL  A+  N  +IV LLL+ GA P+   +    TPL+ A+++GY + V+ LL+Y A  D +  +  TAL++A  +G  +   ++L + +N
Sbjct:   37 KCDVNE-IGPDGETPLTCAINANNYDIVELLLKSGADPNLRPDKVESTPLMDAANVGYKNIVQILLEYGANPDIKSSTNNTALHYAACSGHSECCKLILDYSSN 139          

HSP 2 Score: 56.6102 bits (135), Expect = 1.026e-7
Identity = 36/92 (39.13%), Postives = 50/92 (54.35%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSR-TALYFAIENGRVDVVSMLLKFGTNF 1742
            T L +A  K     V+LLL++GA  D + N   +TPL LA + GYI  V+ L+DY A  +     R T L  A + G + VV  L+K+ T F
Sbjct: 1412 TVLIIAADKGHTEFVKLLLKHGAIVD-SKNKKGDTPLWLACNGGYIDVVRLLIDYKADANSSDNRRMTCLMTAFKKGHIKVVKELVKYVTQF 1502          
BLAST of Chromobox protein vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.705e-8
Identity = 34/90 (37.78%), Postives = 50/90 (55.56%), Query Frame = 3
Query: 1470 TPLQLAVTKNRVNIVRLLLRYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSA-FTDYRIKSRTALYFAIENGRVDVVSMLLKFGT 1736
            TPL +A  K+++ IV LLL+YGA  + T  T   TPL +++ +G   AV  LL   A      ++  TAL+ A  N + + V +LLK G 
Sbjct:  373 TPLHIACKKHKIKIVELLLKYGALIEATTET-GLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGA 461          
The following BLAST results are available for this feature:
BLAST of Chromobox protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASB156.411e-938.71ankyrin repeat and SOCS box containing 15 [Source:... [more]
ANKRD501.067e-837.93ankyrin repeat domain 50 [Source:HGNC Symbol;Acc:H... [more]
ANKRD501.109e-837.93ankyrin repeat domain 50 [Source:HGNC Symbol;Acc:H... [more]
ANK21.499e-836.84ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.499e-836.84ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Chromobox protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-48.328e-837.50TRP (Transient receptor potential) channel family ... [more]
hpl-23.826e-740.35Chromo-domain protein; HP1 Like (Heterochromatin p... [more]
unc-443.835e-732.26AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.835e-732.26AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.908e-732.26AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Chromobox protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhi3.836e-838.46gene:FBgn0004400 transcript:FBtr0086897[more]
Ank29.100e-831.45gene:FBgn0261788 transcript:FBtr0344224[more]
Ank21.001e-731.45gene:FBgn0261788 transcript:FBtr0303125[more]
CG31041.262e-732.61gene:FBgn0031473 transcript:FBtr0335132[more]
CG31041.262e-732.61gene:FBgn0031473 transcript:FBtr0077686[more]
back to top
BLAST of Chromobox protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD505.206e-1041.30ankyrin repeat domain 50 [Source:HGNC Symbol;Acc:H... [more]
kidins220b8.757e-939.56kinase D-interacting substrate 220b [Source:NCBI g... [more]
ankk19.177e-934.97ankyrin repeat and kinase domain containing 1 [Sou... [more]
asb2b1.127e-832.85ankyrin repeat and SOCS box containing 2b [Source:... [more]
asb2b1.969e-832.61ankyrin repeat and SOCS box containing 2b [Source:... [more]
back to top
BLAST of Chromobox protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gart4.789e-934.85phosphoribosylglycinamide formyltransferase, phosp... [more]
ANK21.074e-836.84ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK21.106e-836.84ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK21.116e-836.84ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK21.145e-836.84ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
back to top
BLAST of Chromobox protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd507.252e-937.39ankyrin repeat domain 50 [Source:MGI Symbol;Acc:MG... [more]
Kidins2201.100e-842.11kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Kidins2201.141e-842.11kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Ank21.368e-836.84ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank21.732e-836.84ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
back to top
BLAST of Chromobox protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9EQG6|KDIS_RAT1.233e-844.21Kinase D-interacting substrate of 220 kDa OS=Rattu... [more]
sp|Q9ULJ7|ANR50_HUMAN5.323e-837.93Ankyrin repeat domain-containing protein 50 OS=Hom... [more]
sp|Q7T163|KDISB_DANRE6.667e-839.56Kinase D-interacting substrate of 220 kDa B OS=Dan... [more]
sp|Q96NW4|ANR27_HUMAN1.369e-729.29Ankyrin repeat domain-containing protein 27 OS=Hom... [more]
sp|Q8NFD2|ANKK1_HUMAN1.592e-735.19Ankyrin repeat and protein kinase domain-containin... [more]
back to top
BLAST of Chromobox protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V7S35.548e-2540.68Chromobox protein-related (Chromobox 1) (Heterochr... [more]
A0A2H1C1H21.352e-2440.96Chromo' (CHRromatin Organization MOdifier) domain ... [more]
A0A0R3WEK21.422e-2344.44Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
Q5DBZ51.895e-2338.73SJCHGC05321 protein OS=Schistosoma japonicum OX=61... [more]
A0A5K3FU773.652e-2342.96Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Chromobox protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD508.199e-1041.30ankyrin repeat domain 50 [Source:NCBI gene;Acc:103... [more]
kidins220b1.685e-939.56kinase D interacting substrate 220 [Source:NCBI ge... [more]
kidins220b1.716e-939.56kinase D interacting substrate 220 [Source:NCBI ge... [more]
kidins220b1.729e-939.56kinase D interacting substrate 220 [Source:NCBI ge... [more]
psmd102.072e-937.63proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
back to top
BLAST of Chromobox protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.11.556e-835.42pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.11.634e-835.42pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000002048.13.114e-833.93pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
anks1b8.844e-835.71ankyrin repeat and sterile alpha motif domain cont... [more]
ENSPMAT00000007449.11.162e-728.13pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
back to top
BLAST of Chromobox protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromobox protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO348622.939e-632.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387254.148e-635.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271506.316e-631.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391128.027e-638.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromobox protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b1.428e-832.62ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000041917.11.540e-838.00pep primary_assembly:ASM223467v1:19:16436475:16453... [more]
ANKS1A9.905e-840.82ankyrin repeat and sterile alpha motif domain cont... [more]
ANKS1A1.048e-740.82ankyrin repeat and sterile alpha motif domain cont... [more]
ANKS1A1.107e-740.82ankyrin repeat and sterile alpha motif domain cont... [more]
back to top
BLAST of Chromobox protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047257.10.000e+099.86SMESG000047257.1[more]
SMESG000065471.10.000e+099.86SMESG000065471.1[more]
SMESG000013006.12.336e-1034.62SMESG000013006.1[more]
SMESG000013006.12.500e-1034.62SMESG000013006.1[more]
SMESG000000606.14.705e-837.78SMESG000000606.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004311 ID=SMED30004311|Name=Chromobox protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2623bp
TATTTATACTTTTGTTATTAAAAATTTAAATTTAATATTTTCTGATAATT
TTAAAAATGAATTATTGATAAATTAATTGATATTTTAATAATTTAAAATT
TAAATAAATCATGTTTTATAGTAAATCAAATTAGTTGAAGCCGTAATACA
GCTGTTAATCTATACTTATACGCACAATGTCTGCTAGAAAGCAAGGCAAA
AACAACAAAAGGCACTTTCATGAACAAGTGGATAGCTTTGATGACAAAAA
AAAGAATATAAATTTGTCGCATTGTGAAGTCGAAAGCCGAAGTAGTAGTT
GTTGTAGTAAAAGGTCTAATAAAAAATCAAATAATAAAAAGAGTCAAGAT
AGTCGAACTGATAATTTTTATATAGTTGAAAAAATAGTTGGTCATAAAAT
GTGTAACGGAAAGTCATATTTTAAAGTTCAGTGGCAGGGTTATGATGAAT
CAGAAGATAGTTGGGAACCCGAAGAAAATCTTACAAATGTTCTTGATTTA
ATTGAAGACTTTAAAAACAAAATATCTGATGATAAATTTGAAGAAAGTAG
TAGAATATCAAATAATATTATGCGATCGCGTAATTCTGGGTGTTATGAAT
ATGTTCCATCTAATAAAGTTGTAGCAACGAAAACCAAATATTTTGATGAC
ATTAGAGATGGGAAAATTGATTTAACTAAAAATGATCTTTATTCCCGAGT
GAAAACACGAAAAAGATTACATTTGGAAGAAGGTTCTGATAAGCCTATTG
AAAGTACAGAAAATGAGACAGACAATATAACTATTGAGGAAACAACGGAG
GTTGTTGAAACAGCTATAAAGACTGAAGATGTTCCAATTTCATTCGAAAA
AAATAAATTTTATCAATCAAATCTTTTTGAAATGACAGCGGAATTTATGA
AAACTGGTAGCTTCAAAAAATCACAAAATACAATAGCATCAAAATCATCA
TCGAATGATGATATCAGTTTATTTAATTACAGCATTTCACCTAATACTAA
TCAATCTGATGATTTTCCTGTCCAAATATCACCAGCACATGTCATTAATA
TTGAATCTTCAAAGCAGTCAGTGTACACTCAGACTATTTCTACAGATTTT
GAAGTTCAAGAATCTATTATTCAAAAAGAGGAAACGGAATCGAAATTGAT
AAATCCTACTCTCTCAGTGAAACCCCATGTTCAGAAAATAATAGATAAAA
TTGACCAATCATTTGAAAAGCCTTCATTTCAAAAAAGATTTGTGACCAAT
GACACTGATTTGCTTCATGTGTATTCTAAAAATATTAGACAAGGAACCGT
TTGTACTTTCAATATGCCAAAGGTTCAAATTGATTCCGACTTGATCAGTA
TTGACAATTTTGAGGACCTCAAATGTTCAATATTAATGGATAAGTATCAT
TTATTGCATAATGCTCTTCAAAATGGAGTCAGATTTGATTGGAATGAGAA
GTTCACACCCGAATGTTTAACTCCATTACAATTAGCTGTAACAAAAAACA
GAGTTAATATTGTTCGTTTGCTTCTCCGATATGGTGCTCCACCAGATTTC
ACTGACAACACAGACGCAGAAACGCCTCTAATATTGGCCTCGAGTTTAGG
TTACATTCACGCGGTGAAAGCGCTACTAGATTACAGTGCATTCACCGATT
ATAGAATCAAATCTCGGACCGCCCTTTATTTCGCCATTGAAAATGGTCGG
GTCGATGTTGTCAGCATGTTGCTCAAATTTGGCACGAATTTCTACAGAAT
TGCCGATAATCTTTCTGGGTCATCACTAATCAATGACATGTTTATGGGAA
ACCGATTATCTAATGTTGTTTATGTTGATTTGCTAGCATTATTGCGAACT
TACCACATGTCATTCATCAATTCTCTTAATCGTACAATTACTCGGTACTT
CACAAAACATTTTATTAAACAGATTTGCATAATATTTCCCCATCAATGGG
TCAGTGTGCTCGAGAAAGAATTCCACATTGATTTTCTCCTCGACAGTTCT
ATCATGACGAATATTGACACGCCAATTCTTTTGTTGGTACATGGCATTCA
AGCGGACTGTGATTTTGATTTCTGGTTGGATAACAACTGTTGTTGTGTTG
AGTCTGTGTATGTCAATGATGCTCGCCAGTCCAGTCTCAGTGCTTCGTCA
TTTGTCACGACGCTTTGGCCCCTCAATGCTTCTAGTAACAAATTGACAGT
CAATTTCACAGACCAGCATTTATTGTCACCGGAGGAAAAACAGATCCGGA
TCGCAATTGTTGCCGTGAGTATTGACTGCACCCGTTCGACAAGCACTGCC
ACCAGCAGCAACAACAGCAGCAACAACAACAACAGCAACAACAGTCACAA
GCTGGTAGACAATTTCATGATTTACAAAGACAATTTCAAAGACCAATGAA
AAATCAACAACAAAATTGGTCAAATCAATCATCTCAAGGACAGCAAGGGC
AACTTAATCATTCGTCAAATCAATAGTTATGTTTTCTGTAGAATAATATA
ATTAATTGTCTGTACACAATATTTCACATATTAATAAATCATTTAGTTCT
TCTTTGTTCAATAGTTACAGTTAATTTTTATTGTAGAAAAGTGAACATTT
TATTCATTATTGATTACAAGGGC
back to top

protein sequence of SMED30004311-orf-1

>SMED30004311-orf-1 ID=SMED30004311-orf-1|Name=SMED30004311-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=741bp
MSARKQGKNNKRHFHEQVDSFDDKKKNINLSHCEVESRSSSCCSKRSNKK
SNNKKSQDSRTDNFYIVEKIVGHKMCNGKSYFKVQWQGYDESEDSWEPEE
NLTNVLDLIEDFKNKISDDKFEESSRISNNIMRSRNSGCYEYVPSNKVVA
TKTKYFDDIRDGKIDLTKNDLYSRVKTRKRLHLEEGSDKPIESTENETDN
ITIEETTEVVETAIKTEDVPISFEKNKFYQSNLFEMTAEFMKTGSFKKSQ
NTIASKSSSNDDISLFNYSISPNTNQSDDFPVQISPAHVINIESSKQSVY
TQTISTDFEVQESIIQKEETESKLINPTLSVKPHVQKIIDKIDQSFEKPS
FQKRFVTNDTDLLHVYSKNIRQGTVCTFNMPKVQIDSDLISIDNFEDLKC
SILMDKYHLLHNALQNGVRFDWNEKFTPECLTPLQLAVTKNRVNIVRLLL
RYGAPPDFTDNTDAETPLILASSLGYIHAVKALLDYSAFTDYRIKSRTAL
YFAIENGRVDVVSMLLKFGTNFYRIADNLSGSSLINDMFMGNRLSNVVYV
DLLALLRTYHMSFINSLNRTITRYFTKHFIKQICIIFPHQWVSVLEKEFH
IDFLLDSSIMTNIDTPILLLVHGIQADCDFDFWLDNNCCCVESVYVNDAR
QSSLSASSFVTTLWPLNASSNKLTVNFTDQHLLSPEEKQIRIAIVAVSID
CTRSTSTATSSNNSSNNNNSNNSHKLVDNFMIYKDNFKDQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005768endosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR000953Chromo/chromo_shadow_dom
IPR023780Chromo_domain
IPR020683Ankyrin_rpt-contain_dom
IPR016197Chromo-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006886intracellular protein transport
GO:0015031protein transport
GO:1990126retrograde transport, endosome to plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000953Chromo/chromo shadow domainSMARTSM00298chromo_7coord: 64..117
e-value: 2.4E-14
score: 63.7
IPR000953Chromo/chromo shadow domainPROSITEPS50013CHROMO_2coord: 65..124
score: 16.178
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 463..492
e-value: 4.1
score: 16.4
coord: 429..460
e-value: 0.0085
score: 25.3
coord: 495..524
e-value: 0.0095
score: 25.1
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 495..521
score: 9.458
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 429..461
score: 11.22
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 407..573
e-value: 3.6E-20
score: 74.5
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 382..523
IPR023780Chromo domainPFAMPF00385Chromocoord: 65..115
e-value: 4.7E-14
score: 52.0
NoneNo IPR availableGENE3DG3DSA:2.40.50.40coord: 36..120
e-value: 3.3E-19
score: 70.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 432..521
NoneNo IPR availablePANTHERPTHR24178:SF9ANKYRIN REPEAT AND SOCS BOX PROTEIN 3coord: 432..521
NoneNo IPR availableCDDcd00024CD_CSDcoord: 65..113
e-value: 6.94656E-20
score: 81.3692
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 434..520
e-value: 1.7E-12
score: 47.7
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 429..521
score: 18.749
IPR016197Chromo-like domain superfamilySUPERFAMILYSSF54160Chromo domain-likecoord: 59..118