Proliferating cell nuclear antigen

Overview
NameProliferating cell nuclear antigen
Smed IDSMED30004304
Uniprot Best hitProliferating cell nuclear antigen OS=Drosophila melanogaster OX=7227 GN=PCNA PE=1 SV=2 (E=3.20364e-117)
Length (bp)907
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proliferating cell nuclear antigen (SMED30004304) t-SNE clustered cells

Violin plots show distribution of expression levels for Proliferating cell nuclear antigen (SMED30004304) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proliferating cell nuclear antigen (SMED30004304) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proliferating cell nuclear antigen (SMED30004304) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: EiasCQH3

 

back to top

Expression Details

Proliferating cell nuclear antigen ( PCNA ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the neoblast and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S3 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

Anatomical Expression

PAGE et. al., 2020




SMED30004304

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 34

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30004304 dd_Smed_v4_1920_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
zeta neoblastSMED30004304 dd_Smed_v4_1920_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30004304 SMED_02599_V2_1GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30004304 SMED_02599_V2_1GPL14150PMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
X1 cellSMED30004304 SmedASXL_002240SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
X2 cellSMED30004304 SmedASXL_002240SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
neoblastSMED30004304 SMED30004304smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
neoblastSMED30004304 SMED30004304smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30004304 SMED30004304smed_20140614PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30004304 SMED30004304smed_20140614PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
blastomereSMED30004304 SMED30004304smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
blastomereSMED30004304 SMED30004304smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
blastomereSMED30004304 SMED30004304smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
blastomereSMED30004304 SMED30004304smed_20140614PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
neoblastSMED30004304 SMED30004304smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30004304 SMED30004304smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
parapharyngeal regionSMED30004304 dd_Smed_v6_1920_0_1dd_Smed_v6PMID:28171748whole organismasexual adultRNA-sequencing evidence
X1 cellSMED30004304 EU856391smed_ncbi_20200123PMID:23629965FACS sorted cell populationasexual adultRNA-sequencing evidence
neoblastSMED30004304 EU856391smed_ncbi_20200123PMID:21747960whole organismadult hermaphroditeRNA-sequencing evidence
neoblastSMED30004304 EU856391smed_ncbi_20200123PMID:21747960whole organismasexual adultRNA-sequencing evidence
X1 cellSMED30004304 EU856391smed_ncbi_20200123PMID:21747960FACS sorted cell populationasexual adultRNA-sequencing evidence
neoblastSMED30004304 EU856391smed_ncbi_20200123PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
blastomereSMED30004304 EU856391smed_ncbi_20200123PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30004304 EU856391smed_ncbi_20200123PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
neoblastSMED30004304 EU856391smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30004304 EU856391smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
neoblastSMED30004304 EU856391smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
blastomereSMED30004304 EU856391smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
blastomereSMED30004304 EU856391smed_ncbi_20200123PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
neoblastSMED30004304 EU856391smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30004304 EU856391smed_ncbi_20200123PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30004304 EU856391smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
neoblastSMED30004304 DN300872ncbi_smed_estsPMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
X1 cellSMED30004304 CUFF.66956.1be_Smed_v2PMID:22543868FACS sorted cell populationasexual adultRNA-sequencing evidence
Homology
BLAST of Proliferating cell nuclear antigen vs. Ensembl Human
Match: PCNA (proliferating cell nuclear antigen [Source:HGNC Symbol;Acc:HGNC:8729])

HSP 1 Score: 338.961 bits (868), Expect = 4.730e-117
Identity = 151/259 (58.30%), Postives = 211/259 (81.47%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D S +G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLS IG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLSS V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Human
Match: PCNA (proliferating cell nuclear antigen [Source:HGNC Symbol;Acc:HGNC:8729])

HSP 1 Score: 338.961 bits (868), Expect = 4.730e-117
Identity = 151/259 (58.30%), Postives = 211/259 (81.47%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D S +G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLS IG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLSS V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Celegans
Match: pcn-1 (Proliferating cell nuclear antigen [Source:UniProtKB/Swiss-Prot;Acc:O02115])

HSP 1 Score: 253.447 bits (646), Expect = 6.671e-84
Identity = 115/260 (44.23%), Postives = 178/260 (68.46%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADS-SETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEAKL    + KK++E+IKDLV +A  DCSE  +SLQAMD+SHV+LVS+ L    F+TYRCDR +NLGL++ ++SK LK   ++D+  +K  ++  ++I         ++  +  +K+MD+D +HLGIPD +Y  + +MP+ + Q+ C+DLS   +++ I  TK G+ F   GD+G   +  + +S+ D E E VT+E+ +PV++ +S++Y N FTKA  LS +V LSL  +VP V+E+ IE+ G++R+YLAPKI+DDE
Sbjct:    1 MFEAKLANAGLLKKIVESIKDLVTDAPFDCSETAMSLQAMDSSHVALVSLKLEVGLFDTYRCDRTINLGLSLANMSKALKCANNDDTCMLKYEENEGDSIIFTFADPKRDKTQDVTVKMMDIDSEHLGIPDQDYAVVCEMPAGEFQKTCKDLSTFSDSLNITATKAGIVFTGKGDIGSSVVTYSPSSNTDDETEAVTLEVKDPVNVNFSIKYMNQFTKATALSDRVRLSLCNDVPVVVEYPIEENGYLRFYLAPKIDDDE 260          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Fly
Match: PCNA (gene:FBgn0005655 transcript:FBtr0086308)

HSP 1 Score: 340.887 bits (873), Expect = 3.196e-118
Identity = 149/259 (57.53%), Postives = 210/259 (81.08%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L +  + KK+++AIKDL+ EAT DCS++GI LQAMD SHVSLVS+ LRSDGF+ +RCDRN+++G+N+ S++KILK   + D++TMKA D+++T++++ ESAN+ ++S+YE+KLM+LD +HLGIP+T++ C+V+MP+ +  RICRDL+Q  E++ IC TK+GV F+A+GD+G   IKL Q  S DKE E V IEM EPV++T++ RY N FTKA PLS+QV LS+  +VP V+E+ I+DLG IRYYLAPKIED+E
Sbjct:    1 MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSLTLRSDGFDKFRCDRNLSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVTIMFESANQEKVSDYEMKLMNLDQEHLGIPETDFSCVVRMPAMEFARICRDLAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAVIIEMQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDNE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Fly
Match: PCNA (gene:FBgn0005655 transcript:FBtr0086307)

HSP 1 Score: 340.887 bits (873), Expect = 3.196e-118
Identity = 149/259 (57.53%), Postives = 210/259 (81.08%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L +  + KK+++AIKDL+ EAT DCS++GI LQAMD SHVSLVS+ LRSDGF+ +RCDRN+++G+N+ S++KILK   + D++TMKA D+++T++++ ESAN+ ++S+YE+KLM+LD +HLGIP+T++ C+V+MP+ +  RICRDL+Q  E++ IC TK+GV F+A+GD+G   IKL Q  S DKE E V IEM EPV++T++ RY N FTKA PLS+QV LS+  +VP V+E+ I+DLG IRYYLAPKIED+E
Sbjct:    1 MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSLTLRSDGFDKFRCDRNLSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVTIMFESANQEKVSDYEMKLMNLDQEHLGIPETDFSCVVRMPAMEFARICRDLAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAVIIEMQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDNE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Fly
Match: PCNA2 (gene:FBgn0032813 transcript:FBtr0081262)

HSP 1 Score: 264.233 bits (674), Expect = 4.958e-88
Identity = 121/257 (47.08%), Postives = 182/257 (70.82%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIED 844
            M EA+L +  + KK+++A+K+++ + TLDCSENG+ LQ+MD SHVSLV++ L SD FE + CDRNV+LGL++ S+ K+LK   S+D++T+KA D  E I+L  ES  +   ++YE+KL++LD DH+ IP  +Y C +++PSS+  RICRD+S   E++TI  +  G+ F A GDLG   I+L+  ++ D     V+IE+ EPV+ +++ RY N FTKA PL+ +V L L++  P ++E+ IED G IRYYLAPK+ D
Sbjct:    1 MLEARLSQTLLLKKIVDALKEIIAQGTLDCSENGLELQSMDNSHVSLVALSLASDCFEKFHCDRNVSLGLDLKSLGKVLKCANSDDAVTIKAVDRPEKITLSFESDGKERTADYELKLLNLDQDHMEIPKKDYTCFIQLPSSEFARICRDMSMFDESLTIACSSKGIRFLAKGDLGTANIQLSAGTAMD-----VSIEVQEPVTQSFAGRYLNTFTKATPLADRVKLYLSDERPLLVEYPIEDYGHIRYYLAPKVND 252          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Zebrafish
Match: pcna (proliferating cell nuclear antigen [Source:NCBI gene;Acc:30678])

HSP 1 Score: 328.561 bits (841), Expect = 3.474e-113
Identity = 145/258 (56.20%), Postives = 208/258 (80.62%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L++G + KKV+EA+KDL+ EA  D S +GISLQ+MD+SHVSLV + LRSDGF++YRCDRN+ +G+N++S+SKILK  G+ D +T++A D+++ ++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLSQIG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE+E VTIEM EPV + ++L Y N FTKA PLS  V+LS++ ++P V+E+ I D+G ++YYLAPKI+++
Sbjct:    1 MFEARLVQGSILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRSDGFDSYRCDRNLAMGVNLSSMSKILKCAGNEDIITLRAEDNADALALVFETLNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVKFSASGELGTGNIKLSQTSNVDKEDEAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVTLSMSADIPLVVEYKIADMGHVKYYLAPKIDEE 258          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Xenopus
Match: pcna (proliferating cell nuclear antigen [Source:NCBI gene;Acc:493302])

HSP 1 Score: 335.88 bits (860), Expect = 5.356e-116
Identity = 148/259 (57.14%), Postives = 209/259 (80.69%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D + +GISLQ+MD+SHVSLV + LRSDGF+TYRCDRN ++G+ ++S+SKILK   S D +T++A D+++T++++ ES N+ ++S+YE+KLMDLD + LGIP+ EY C++KMPS +  RICRDLSQIG+A+ I   KDGV F+A+G+LG G +KL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLS  V+LS++ ++P V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLIDEACWDITSSGISLQSMDSSHVSLVQLTLRSDGFDTYRCDRNQSIGVKMSSMSKILKCAASEDIITLRAEDNADTVTMVFESPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSGEFARICRDLSQIGDAVVISCAKDGVKFSASGELGTGNVKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADIPLVVEYKIADMGHVKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Xenopus
Match: pcna (proliferating cell nuclear antigen [Source:NCBI gene;Acc:493302])

HSP 1 Score: 301.212 bits (770), Expect = 2.962e-102
Identity = 133/234 (56.84%), Postives = 188/234 (80.34%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVP 775
            MFEA+L++G + KKV+EA+KDL+ EA  D + +GISLQ+MD+SHVSLV + LRSDGF+TYRCDRN ++G+ ++S+SKILK   S D +T++A D+++T++++ ES N+ ++S+YE+KLMDLD + LGIP+ EY C++KMPS +  RICRDLSQIG+A+ I   KDGV F+A+G+LG G +KL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLS  V+LS++ ++P
Sbjct:    1 MFEARLVQGSILKKVLEALKDLIDEACWDITSSGISLQSMDSSHVSLVQLTLRSDGFDTYRCDRNQSIGVKMSSMSKILKCAASEDIITLRAEDNADTVTMVFESPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSGEFARICRDLSQIGDAVVISCAKDGVKFSASGELGTGNVKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADIP 234          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Mouse
Match: Pcna (proliferating cell nuclear antigen [Source:MGI Symbol;Acc:MGI:97503])

HSP 1 Score: 335.109 bits (858), Expect = 9.832e-116
Identity = 149/259 (57.53%), Postives = 209/259 (80.69%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+LI+G + KKV+EA+KDL+ EA  D S  G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C++KMPS +  RICRDLS IG+A+ I   K+GV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLS  V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSGEFARICRDLSHIGDAVVISCAKNGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. UniProt
Match: sp|P17917|PCNA_DROME (Proliferating cell nuclear antigen OS=Drosophila melanogaster OX=7227 GN=PCNA PE=1 SV=2)

HSP 1 Score: 340.887 bits (873), Expect = 3.204e-117
Identity = 149/259 (57.53%), Postives = 210/259 (81.08%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L +  + KK+++AIKDL+ EAT DCS++GI LQAMD SHVSLVS+ LRSDGF+ +RCDRN+++G+N+ S++KILK   + D++TMKA D+++T++++ ESAN+ ++S+YE+KLM+LD +HLGIP+T++ C+V+MP+ +  RICRDL+Q  E++ IC TK+GV F+A+GD+G   IKL Q  S DKE E V IEM EPV++T++ RY N FTKA PLS+QV LS+  +VP V+E+ I+DLG IRYYLAPKIED+E
Sbjct:    1 MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSLTLRSDGFDKFRCDRNLSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVTIMFESANQEKVSDYEMKLMNLDQEHLGIPETDFSCVVRMPAMEFARICRDLAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAVIIEMQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDNE 259          
BLAST of Proliferating cell nuclear antigen vs. UniProt
Match: sp|P61258|PCNA_MACFA (Proliferating cell nuclear antigen OS=Macaca fascicularis OX=9541 GN=PCNA PE=2 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 2.271e-116
Identity = 151/259 (58.30%), Postives = 211/259 (81.47%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D S +G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLS IG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLSS V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. UniProt
Match: sp|P12004|PCNA_HUMAN (Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 2.271e-116
Identity = 151/259 (58.30%), Postives = 211/259 (81.47%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D S +G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLS IG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLSS V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. UniProt
Match: sp|O16852|PCNA_SARCR (Proliferating cell nuclear antigen OS=Sarcophaga crassipalpis OX=59312 GN=PCNA PE=3 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 2.701e-116
Identity = 148/259 (57.14%), Postives = 208/259 (80.31%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+LI   + KK+++AIK+L+ EAT +CSE+GI LQAMD SHVSL S+ LRSDGF+ +RCDRN+++G+N+ S++KILK   ++D++T+KA D+++T++ + ES N  ++S+YE+KLM+LD +HLGIP+T+Y C+V+MPS +  RICRDL+Q  E++ IC TK+GV F+A+GD+G   +KL Q SS DKE E V IEM EPV++T++ RY N FTKA PLS+QV LS+  +VP V+E+ I++LG IRYYLAPKIEDDE
Sbjct:    1 MFEARLINATILKKILDAIKELLHEATFECSESGIQLQAMDNSHVSLGSLTLRSDGFDKFRCDRNISMGMNLGSMAKILKCANNDDTVTVKAQDNADTVTFMFESPNHEKVSDYEMKLMNLDQEHLGIPETDYSCVVRMPSMEFARICRDLAQFSESMLICCTKEGVKFSASGDVGSANVKLAQTSSVDKEEEAVIIEMQEPVTLTFACRYLNAFTKATPLSAQVQLSMCADVPLVVEYAIKELGHIRYYLAPKIEDDE 259          
BLAST of Proliferating cell nuclear antigen vs. UniProt
Match: sp|P57761|PCNA_CRIGR (Proliferating cell nuclear antigen OS=Cricetulus griseus OX=10029 GN=PCNA PE=1 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 1.410e-115
Identity = 150/259 (57.92%), Postives = 209/259 (80.69%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D S  G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLS IG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLS  V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSTDVPLVVEYKISDMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Match: gnl|BL_ORD_ID|19616633 (tr|Q5H7M5|Q5H7M5_DUGJA Proliferating cell nuclear antigen OS=Dugesia japonica OX=6161 GN=Djpcna PE=2 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 1.123e-151
Identity = 215/259 (83.01%), Postives = 243/259 (93.82%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEAK+IKGE+ KK IEAIKDL+QEATLDCSENGISLQAMDTSHVSLVS+LLRS+GFETYRCDRN+NLGLN+ SVSKILK LGSNDSLTMKAADS++TIS LIES+NE+ELSE+EIKLMD++GDHLGIPDTEYKCIVKMPS+KLQ+IC+++SQ+GEAITI V KDGVTF + GD+G G   L+QNSSADKENEGVTIEMTEPVSMTYSLRYFNMF KAAPLS  VSLSLTENVPAV+EF+I+D+G+IRYYLAPKIEDDE
Sbjct:    1 MFEAKIIKGEILKKAIEAIKDLIQEATLDCSENGISLQAMDTSHVSLVSLLLRSEGFETYRCDRNINLGLNVVSVSKILKCLGSNDSLTMKAADSNDTISFLIESSNESELSEFEIKLMDIEGDHLGIPDTEYKCIVKMPSAKLQKICKEMSQMGEAITITVAKDGVTFVSTGDIGNGKTTLHQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFAKAAPLSPIVSLSLTENVPAVVEFLIDDIGYIRYYLAPKIEDDE 259          
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Match: gnl|BL_ORD_ID|15907205 (tr|C1L8V7|C1L8V7_SCHJA Proliferating cell nuclear antigen OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 1.523e-140
Identity = 187/258 (72.48%), Postives = 227/258 (87.98%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L + +VWKKVI+AIKDLVQEATLDC+ENGISLQAMD +HVSLVS+LLRSDGFETYRCDRN++LGLNITS SKIL+    ND++T+KA D ++T++ + ES N+   SE+EIKLMDLD DHLGIPDT+YKCI++MPS++LQRICRDLSQIG+++ I V KDGV+F++ GDLG G +KL+Q+++ADK  E V+IEM E VSMTYSL YFN+FTKAAPLSSQV LSLTENVPAV+EF IEDLG+IRYYLAPKIEDD
Sbjct:    1 MFEARLTQADVWKKVIDAIKDLVQEATLDCTENGISLQAMDNAHVSLVSLLLRSDGFETYRCDRNLSLGLNITSASKILRCASGNDAITLKAGDKADTLTFVFESKNQERSSEFEIKLMDLDVDHLGIPDTDYKCIIRMPSAQLQRICRDLSQIGDSVVISVAKDGVSFSSNGDLGTGNVKLSQSANADKPEESVSIEMHEAVSMTYSLHYFNIFTKAAPLSSQVVLSLTENVPAVVEFGIEDLGYIRYYLAPKIEDD 258          
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Match: gnl|BL_ORD_ID|17182945 (tr|C1L8V9|C1L8V9_SCHJA Proliferating cell nuclear antigen OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 4.705e-140
Identity = 186/258 (72.09%), Postives = 227/258 (87.98%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L + +VWKKVI+AIKDLVQEATLDC+ENGISLQAMD +HVSLVS+LLRSDGFETYRCDRN++LGLNITS SKIL+    ND++T+KA D ++T++ + ES N+   SE+EIKLMDLD DHLGIPDT+YKCI++MPS++LQRICRDLSQIG+++ I V KDGV+F++ GDLG G +KL+Q+++ADK  E V+IEM E VSMTYSL YFN+FTKAAPLSSQV LSLTENVPAV+EF I+DLG+IRYYLAPKIEDD
Sbjct:    1 MFEARLTQADVWKKVIDAIKDLVQEATLDCTENGISLQAMDNAHVSLVSLLLRSDGFETYRCDRNLSLGLNITSASKILRCASGNDAITLKAGDKADTLTFVFESKNQERSSEFEIKLMDLDVDHLGIPDTDYKCIIRMPSAQLQRICRDLSQIGDSVVISVAKDGVSFSSNGDLGTGNVKLSQSANADKPEESVSIEMHEAVSMTYSLHYFNIFTKAAPLSSQVVLSLTENVPAVVEFGIDDLGYIRYYLAPKIEDD 258          
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Match: gnl|BL_ORD_ID|21487812 (tr|A0A430QDB7|A0A430QDB7_SCHBO Proliferating cell nuclear antigen OS=Schistosoma bovis OX=6184 GN=DC041_0004054 PE=3 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 1.261e-139
Identity = 186/258 (72.09%), Postives = 227/258 (87.98%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L + +VWKKVI+AIKDLVQEATLDC+ENGISLQAMD +HVSLVS+LLRSDGFETYRCDRN++LGLNITS SKIL+    ND++T+KA D ++T++ + ES +++  SE+EIKLMDLD DHLGIPDT+YKCI++MPS++LQRICRDLSQIG+++ I V KDGV+F++ GDLG G +KL Q+++ADK  E V+IEM EPV MTYSL YFN+FTKAAPLSSQV LSLTENVPAV+EF IEDLG+IRYYLAPKIEDD
Sbjct:    1 MFEARLTQADVWKKVIDAIKDLVQEATLDCTENGISLQAMDNAHVSLVSLLLRSDGFETYRCDRNLSLGLNITSASKILRCASGNDAITLKAGDKADTLTFVFESKSQDRSSEFEIKLMDLDVDHLGIPDTDYKCIIRMPSAQLQRICRDLSQIGDSVVISVAKDGVSFSSNGDLGTGNVKLCQSANADKPEESVSIEMHEPVCMTYSLHYFNIFTKAAPLSSQVVLSLTENVPAVVEFEIEDLGYIRYYLAPKIEDD 258          
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Match: gnl|BL_ORD_ID|16747501 (tr|A0A183K5K8|A0A183K5K8_9TREM Proliferating cell nuclear antigen OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS10282 PE=3 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 1.261e-139
Identity = 186/258 (72.09%), Postives = 227/258 (87.98%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L + +VWKKVI+AIKDLVQEATLDC+ENGISLQAMD +HVSLVS+LLRSDGFETYRCDRN++LGLNITS SKIL+    ND++T+KA D ++T++ + ES +++  SE+EIKLMDLD DHLGIPDT+YKCI++MPS++LQRICRDLSQIG+++ I V KDGV+F++ GDLG G +KL Q+++ADK  E V+IEM EPV MTYSL YFN+FTKAAPLSSQV LSLTENVPAV+EF IEDLG+IRYYLAPKIEDD
Sbjct:    1 MFEARLTQADVWKKVIDAIKDLVQEATLDCTENGISLQAMDNAHVSLVSLLLRSDGFETYRCDRNLSLGLNITSASKILRCASGNDAITLKAGDKADTLTFVFESKSQDRSSEFEIKLMDLDVDHLGIPDTDYKCIIRMPSAQLQRICRDLSQIGDSVVISVAKDGVSFSSNGDLGTGNVKLCQSANADKPEESVSIEMHEPVCMTYSLHYFNIFTKAAPLSSQVVLSLTENVPAVVEFEIEDLGYIRYYLAPKIEDD 258          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Cavefish
Match: pcna (proliferating cell nuclear antigen [Source:NCBI gene;Acc:103027123])

HSP 1 Score: 328.176 bits (840), Expect = 3.955e-113
Identity = 145/258 (56.20%), Postives = 208/258 (80.62%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L++G + KKV+EA+KDL+ EA  D S +GISLQ+MD+SHVSLV + LRSDGF++YRCDRN+ +G+N++S+SKILK  G+ D +T++A D++++++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLSQIG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV + ++L Y N FTKA PLS  V+LS++ ++P V+E+ I D+G ++YYLAPKI+++
Sbjct:    1 MFEARLVQGSILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRSDGFDSYRCDRNLAMGVNLSSMSKILKCAGNEDIITLRAEDNADSLALVFETLNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVKFSASGELGTGNIKLSQTSNVDKEEEAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVTLSMSADIPLVVEYKIADMGHVKYYLAPKIDEE 258          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Sea Lamprey
Match: pcna (proliferating cell nuclear antigen [Source:NCBI gene;Acc:30678])

HSP 1 Score: 335.109 bits (858), Expect = 1.672e-116
Identity = 149/259 (57.53%), Postives = 209/259 (80.69%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA++++G + KKV+EA+KDL+ EA  D S  G+SLQ+MD+SHVSLV + +RSDGF+TYRCDRN+ +G+N+TS+SKILK  G++D +T++A D+++ ++L+ E+ N  ++S+YE+KLMDLD + LGIP+ +Y  +VKMPS +  RICRDLSQIG+++ IC TKDGV F+A+G+LG G IKL+Q S ADKE E VTIEM+E V +T++LRY N FTKA PLS  V+L ++ +VP V+E+ I D+G I+YYLAPKIED+E
Sbjct:    1 MFEARILQGNILKKVLEALKDLITEACWDISSTGVSLQSMDSSHVSLVQLTMRSDGFDTYRCDRNLAMGINLTSMSKILKCAGNDDMITLRAEDNADILTLVFEAQNHEKVSDYEMKLMDLDVEQLGIPEQDYSAVVKMPSGEFSRICRDLSQIGDSVVICCTKDGVKFSASGELGTGNIKLSQTSGADKEEEAVTIEMSEAVQLTFALRYLNFFTKATPLSPTVTLRMSADVPLVVEYGIADMGHIKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Yeast
Match: POL30 (Proliferating cell nuclear antigen (PCNA); functions as the sliding replication clamp for DNA polymerase delta; may function as a docking site for other proteins required for mitotic and meiotic chromosomal DNA replication and for DNA repair; PCNA ubiquitination at K164 plays a crucial role during Okazaki fragment processing [Source:SGD;Acc:S000000292])

HSP 1 Score: 201.445 bits (511), Expect = 2.445e-64
Identity = 96/259 (37.07%), Postives = 162/259 (62.55%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            M EAK  +  ++K++I+  KD VQ     C E+GI  QA+D S V LVS+ +  + F+ YRCD  V LG+++TS+SKIL+   + D+LT+ A ++ ++I LL E   ++ ++EY +KLMD+D D L I + +Y   + +PSS+  +I RDLSQ+ ++I I +TK+ + F A GD+G G++ +      +     + +EM +PV +T+  +Y     K + LS +V + L+   PA+ +F ++  GF++++LAPK  D+E
Sbjct:    1 MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKS-GFLQFFLAPKFNDEE 258          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Medaka
Match: pcna (proliferating cell nuclear antigen [Source:NCBI gene;Acc:101155033])

HSP 1 Score: 328.946 bits (842), Expect = 2.179e-113
Identity = 146/258 (56.59%), Postives = 207/258 (80.23%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L++G + KKV+EA+KDL+ EA  D S +GISLQ+MD+SHVSLV + LR DGF++YRCDRN+ +G+N++S+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLSQIG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV + ++L Y N FTKA PLS  V+LS++ ++P V+E+ I D+G I+YYLAPKI+++
Sbjct:    1 MFEARLVQGSILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRHDGFDSYRCDRNLAMGVNLSSMSKILKCAGNEDIITLRAEDAADTLALVFETINQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVKFSASGELGTGNIKLSQTSNVDKEEEAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVTLSMSADIPLVVEYKIADMGHIKYYLAPKIDEE 258          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Medaka
Match: pcna (proliferating cell nuclear antigen [Source:NCBI gene;Acc:101155033])

HSP 1 Score: 299.286 bits (765), Expect = 3.178e-101
Identity = 137/253 (54.15%), Postives = 193/253 (76.28%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAP 832
            MFEA+L++G + KKV+EA+KDL+ EA  D S +GISLQ+MD+SHVSLV + LR DGF++YRCDRN+ +G+N++S+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLSQIG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV + ++L Y N FTKA PLS  V+LS++ ++P         LG + Y + P
Sbjct:    1 MFEARLVQGSILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRHDGFDSYRCDRNLAMGVNLSSMSKILKCAGNEDIITLRAEDAADTLALVFETINQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVKFSASGELGTGNIKLSQTSNVDKEEEAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVTLSMSADIP---------LGKVAYVVCP 244          
BLAST of Proliferating cell nuclear antigen vs. Planmine SMEST
Match: SMESG000046293.1 (SMESG000046293.1)

HSP 1 Score: 261.536 bits (667), Expect = 4.454e-87
Identity = 118/260 (45.38%), Postives = 188/260 (72.31%), Query Frame = 2
Query:   71 IMFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDL-GFIRYYLAPKIEDD 847
            ++FEAKL K + +KK+I+++K+L+QEA  +CS  GI LQAMD+SHVSL+ +L++   F +Y+  RNV+LG+++ S+ KILK    NDS+T+K  +  ET+  + ES++ + +SE+ +KL+DLD D L IP+++Y C+  +PS +  +IC+ L+ IG  +TI VTK  + F+ +GD+GKG I LNQ  +  +  + + IE+  P+SM YSLR+F++F+KA  LS++VSLS   N PA++E+ + +L G +R+YLAPK++DD
Sbjct:    1 MLFEAKLNKVDAFKKLIDSVKELIQEAVFECSSKGIELQAMDSSHVSLIFLLIKKQSFSSYKFTRNVSLGVSLVSLCKILKLSQINDSITIKVDNECETVEFVFESSDSDRMSEFSLKLIDLDIDCLAIPESDYDCVATIPSVEFNKICQQLAVIGSTVTIVVTKQSIQFSCSGDMGKGKILLNQTVNKPRIEDSINIEVVNPLSMVYSLRFFHIFSKAYSLSNRVSLSFANNFPALVEYSMNELEGHLRFYLAPKLDDD 260          
The following BLAST results are available for this feature:
BLAST of Proliferating cell nuclear antigen vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PCNA4.730e-11758.30proliferating cell nuclear antigen [Source:HGNC Sy... [more]
PCNA4.730e-11758.30proliferating cell nuclear antigen [Source:HGNC Sy... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pcn-16.671e-8444.23Proliferating cell nuclear antigen [Source:UniPro... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PCNA3.196e-11857.53gene:FBgn0005655 transcript:FBtr0086308[more]
PCNA3.196e-11857.53gene:FBgn0005655 transcript:FBtr0086307[more]
PCNA24.958e-8847.08gene:FBgn0032813 transcript:FBtr0081262[more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pcna3.474e-11356.20proliferating cell nuclear antigen [Source:NCBI ge... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pcna5.356e-11657.14proliferating cell nuclear antigen [Source:NCBI ge... [more]
pcna2.962e-10256.84proliferating cell nuclear antigen [Source:NCBI ge... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pcna9.832e-11657.53proliferating cell nuclear antigen [Source:MGI Sym... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17917|PCNA_DROME3.204e-11757.53Proliferating cell nuclear antigen OS=Drosophila m... [more]
sp|P61258|PCNA_MACFA2.271e-11658.30Proliferating cell nuclear antigen OS=Macaca fasci... [more]
sp|P12004|PCNA_HUMAN2.271e-11658.30Proliferating cell nuclear antigen OS=Homo sapiens... [more]
sp|O16852|PCNA_SARCR2.701e-11657.14Proliferating cell nuclear antigen OS=Sarcophaga c... [more]
sp|P57761|PCNA_CRIGR1.410e-11557.92Proliferating cell nuclear antigen OS=Cricetulus g... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|196166331.123e-15183.01tr|Q5H7M5|Q5H7M5_DUGJA Proliferating cell nuclear ... [more]
gnl|BL_ORD_ID|159072051.523e-14072.48tr|C1L8V7|C1L8V7_SCHJA Proliferating cell nuclear ... [more]
gnl|BL_ORD_ID|171829454.705e-14072.09tr|C1L8V9|C1L8V9_SCHJA Proliferating cell nuclear ... [more]
gnl|BL_ORD_ID|214878121.261e-13972.09tr|A0A430QDB7|A0A430QDB7_SCHBO Proliferating cell ... [more]
gnl|BL_ORD_ID|167475011.261e-13972.09tr|A0A183K5K8|A0A183K5K8_9TREM Proliferating cell ... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pcna3.955e-11356.20proliferating cell nuclear antigen [Source:NCBI ge... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pcna1.672e-11657.53proliferating cell nuclear antigen [Source:NCBI ge... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
POL302.445e-6437.07Proliferating cell nuclear antigen (PCNA); functio... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pcna2.179e-11356.59proliferating cell nuclear antigen [Source:NCBI ge... [more]
pcna3.178e-10154.15proliferating cell nuclear antigen [Source:NCBI ge... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000046293.14.454e-8745.38SMESG000046293.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004304 ID=SMED30004304|Name=Proliferating cell nuclear antigen|organism=Schmidtea mediterranea sexual|type=transcript|length=907bp
CTAAAAGGTAATAATTTAAATTTAATTAGAACATTGTTTTAATATTCGGT
TATATTCTCCATTATTCTAAATTATGTTTGAAGCAAAATTAATAAAAGGC
GAAGTTTGGAAAAAGGTTATAGAAGCTATAAAAGACTTAGTACAAGAAGC
AACATTGGATTGCTCAGAAAATGGAATTAGTCTTCAAGCCATGGATACAT
CTCATGTGTCCTTAGTTAGTATGCTTCTTCGAAGTGATGGTTTTGAGACT
TATCGATGTGATAGAAATGTCAATCTCGGTCTTAATATAACAAGTGTTTC
AAAAATTTTAAAGGCGCTTGGTAGTAATGATTCCCTAACAATGAAAGCCG
CTGATTCAAGTGAAACAATTTCGCTTTTGATAGAATCTGCAAATGAAAAT
GAATTATCTGAATACGAAATAAAATTAATGGACTTGGATGGAGATCACTT
AGGTATACCAGATACTGAATATAAGTGCATTGTGAAAATGCCGAGTTCAA
AGTTACAAAGAATATGTCGAGATTTAAGCCAAATTGGAGAAGCAATCACG
ATTTGTGTTACTAAAGATGGTGTAACTTTTGCTGCTGCTGGAGATCTAGG
AAAAGGAGCTATAAAACTTAATCAAAATTCTAGTGCTGACAAAGAAAATG
AAGGAGTAACTATTGAAATGACCGAACCTGTTTCGATGACATATTCATTG
AGGTATTTCAATATGTTTACAAAGGCTGCACCTCTTTCTTCTCAAGTATC
TCTGTCGTTGACTGAAAATGTTCCAGCAGTTATTGAGTTCATAATCGAAG
ATTTGGGATTTATTCGATATTACCTAGCTCCTAAAATCGAAGACGACGAG
TGAAAGTTTAACTATTAATGTTGTATGTTTAATAGATGTTATTTTGTTTA
AAAAAAA
back to top

protein sequence of SMED30004304-orf-1

>SMED30004304-orf-1 ID=SMED30004304-orf-1|Name=SMED30004304-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSM
LLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETIS
LLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRD
LSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMT
EPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYY
LAPKIEDDE*
back to top
Aliases
The feature 'Proliferating cell nuclear antigen' has the following synonyms
Synonym
PCNA
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006259DNA metabolic process
GO:0006275regulation of DNA replication
GO:0006260DNA replication
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0004517blastomere
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR000730Pr_cel_nuc_antig
IPR022648Pr_cel_nuc_antig_N
IPR022649Pr_cel_nuc_antig_C
IPR022659Pr_cel_nuc_antig_CS
Vocabulary: molecular function
TermDefinition
GO:0030337DNA polymerase processivity factor activity
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000002Stage 2
PLANA:0000006Stage 6
PLANA:0000004Stage 4
PLANA:0000008Stage 8
PLANA:0000007Stage 7