Proliferating cell nuclear antigen

Overview
NameProliferating cell nuclear antigen
Smed IDSMED30004304
Uniprot Best hitProliferating cell nuclear antigen OS=Drosophila melanogaster GN=PCNA PE=1 SV=2 (E=1.57153e-115)
Length (bp)907
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proliferating cell nuclear antigen (SMED30004304) t-SNE clustered cells

Violin plots show distribution of expression levels for Proliferating cell nuclear antigen (SMED30004304) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proliferating cell nuclear antigen (SMED30004304) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proliferating cell nuclear antigen (SMED30004304) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Proliferating cell nuclear antigen ( PCNA ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the blastomere, neoblast compartment and blastomere compartment

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Cell cycle activity is restricted to piwi-1 blastomere

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S3 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

Homology
BLAST of Proliferating cell nuclear antigen vs. Ensembl Human
Match: PCNA (proliferating cell nuclear antigen [Source:HGNC Symbol;Acc:HGNC:8729])

HSP 1 Score: 338.961 bits (868), Expect = 2.148e-115
Identity = 151/259 (58.30%), Postives = 211/259 (81.47%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D S +G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLS IG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLSS V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Human
Match: PCNA (proliferating cell nuclear antigen [Source:HGNC Symbol;Acc:HGNC:8729])

HSP 1 Score: 338.961 bits (868), Expect = 2.148e-115
Identity = 151/259 (58.30%), Postives = 211/259 (81.47%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D S +G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLS IG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLSS V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Celegans
Match: pcn-1 (Proliferating cell nuclear antigen [Source:UniProtKB/Swiss-Prot;Acc:O02115])

HSP 1 Score: 253.447 bits (646), Expect = 1.946e-82
Identity = 115/260 (44.23%), Postives = 178/260 (68.46%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADS-SETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEAKL    + KK++E+IKDLV +A  DCSE  +SLQAMD+SHV+LVS+ L    F+TYRCDR +NLGL++ ++SK LK   ++D+  +K  ++  ++I         ++  +  +K+MD+D +HLGIPD +Y  + +MP+ + Q+ C+DLS   +++ I  TK G+ F   GD+G   +  + +S+ D E E VT+E+ +PV++ +S++Y N FTKA  LS +V LSL  +VP V+E+ IE+ G++R+YLAPKI+DDE
Sbjct:    1 MFEAKLANAGLLKKIVESIKDLVTDAPFDCSETAMSLQAMDSSHVALVSLKLEVGLFDTYRCDRTINLGLSLANMSKALKCANNDDTCMLKYEENEGDSIIFTFADPKRDKTQDVTVKMMDIDSEHLGIPDQDYAVVCEMPAGEFQKTCKDLSTFSDSLNITATKAGIVFTGKGDIGSSVVTYSPSSNTDDETEAVTLEVKDPVNVNFSIKYMNQFTKATALSDRVRLSLCNDVPVVVEYPIEENGYLRFYLAPKIDDDE 260          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Fly
Match: PCNA (Proliferating cell nuclear antigen [Source:FlyBase gene name;Acc:FBgn0005655])

HSP 1 Score: 340.887 bits (873), Expect = 1.590e-116
Identity = 149/259 (57.53%), Postives = 210/259 (81.08%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L +  + KK+++AIKDL+ EAT DCS++GI LQAMD SHVSLVS+ LRSDGF+ +RCDRN+++G+N+ S++KILK   + D++TMKA D+++T++++ ESAN+ ++S+YE+KLM+LD +HLGIP+T++ C+V+MP+ +  RICRDL+Q  E++ IC TK+GV F+A+GD+G   IKL Q  S DKE E V IEM EPV++T++ RY N FTKA PLS+QV LS+  +VP V+E+ I+DLG IRYYLAPKIED+E
Sbjct:    1 MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSLTLRSDGFDKFRCDRNLSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVTIMFESANQEKVSDYEMKLMNLDQEHLGIPETDFSCVVRMPAMEFARICRDLAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAVIIEMQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDNE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Fly
Match: PCNA (Proliferating cell nuclear antigen [Source:FlyBase gene name;Acc:FBgn0005655])

HSP 1 Score: 340.887 bits (873), Expect = 1.590e-116
Identity = 149/259 (57.53%), Postives = 210/259 (81.08%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L +  + KK+++AIKDL+ EAT DCS++GI LQAMD SHVSLVS+ LRSDGF+ +RCDRN+++G+N+ S++KILK   + D++TMKA D+++T++++ ESAN+ ++S+YE+KLM+LD +HLGIP+T++ C+V+MP+ +  RICRDL+Q  E++ IC TK+GV F+A+GD+G   IKL Q  S DKE E V IEM EPV++T++ RY N FTKA PLS+QV LS+  +VP V+E+ I+DLG IRYYLAPKIED+E
Sbjct:    1 MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSLTLRSDGFDKFRCDRNLSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVTIMFESANQEKVSDYEMKLMNLDQEHLGIPETDFSCVVRMPAMEFARICRDLAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAVIIEMQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDNE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Fly
Match: CG10262 (pep:known chromosome:BDGP6:2L:19582823:19583990:-1 gene:FBgn0032813 transcript:FBtr0081262 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG10262)

HSP 1 Score: 264.233 bits (674), Expect = 1.691e-86
Identity = 121/257 (47.08%), Postives = 182/257 (70.82%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIED 844
            M EA+L +  + KK+++A+K+++ + TLDCSENG+ LQ+MD SHVSLV++ L SD FE + CDRNV+LGL++ S+ K+LK   S+D++T+KA D  E I+L  ES  +   ++YE+KL++LD DH+ IP  +Y C +++PSS+  RICRD+S   E++TI  +  G+ F A GDLG   I+L+  ++ D     V+IE+ EPV+ +++ RY N FTKA PL+ +V L L++  P ++E+ IED G IRYYLAPK+ D
Sbjct:    1 MLEARLSQTLLLKKIVDALKEIIAQGTLDCSENGLELQSMDNSHVSLVALSLASDCFEKFHCDRNVSLGLDLKSLGKVLKCANSDDAVTIKAVDRPEKITLSFESDGKERTADYELKLLNLDQDHMEIPKKDYTCFIQLPSSEFARICRDMSMFDESLTIACSSKGIRFLAKGDLGTANIQLSAGTAMD-----VSIEVQEPVTQSFAGRYLNTFTKATPLADRVKLYLSDERPLLVEYPIEDYGHIRYYLAPKVND 252          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Zebrafish
Match: pcna (proliferating cell nuclear antigen [Source:ZFIN;Acc:ZDB-GENE-000210-8])

HSP 1 Score: 328.561 bits (841), Expect = 1.394e-111
Identity = 145/258 (56.20%), Postives = 208/258 (80.62%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L++G + KKV+EA+KDL+ EA  D S +GISLQ+MD+SHVSLV + LRSDGF++YRCDRN+ +G+N++S+SKILK  G+ D +T++A D+++ ++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLSQIG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE+E VTIEM EPV + ++L Y N FTKA PLS  V+LS++ ++P V+E+ I D+G ++YYLAPKI+++
Sbjct:    1 MFEARLVQGSILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRSDGFDSYRCDRNLAMGVNLSSMSKILKCAGNEDIITLRAEDNADALALVFETLNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVKFSASGELGTGNIKLSQTSNVDKEDEAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVTLSMSADIPLVVEYKIADMGHVKYYLAPKIDEE 258          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Zebrafish
Match: pcna (proliferating cell nuclear antigen [Source:ZFIN;Acc:ZDB-GENE-000210-8])

HSP 1 Score: 326.635 bits (836), Expect = 8.029e-111
Identity = 144/258 (55.81%), Postives = 208/258 (80.62%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L++G + KKV+EA+KDL+ EA  D S +GISLQ+MD+SHVSLV + LRSDGF++YRCDRN+ +G+N++S+SKILK  G+ D +T++A D+++ ++L+ E+ ++ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLSQIG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE+E VTIEM EPV + ++L Y N FTKA PLS  V+LS++ ++P V+E+ I D+G ++YYLAPKI+++
Sbjct:    1 MFEARLVQGSILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRSDGFDSYRCDRNLAMGVNLSSMSKILKCAGNEDIITLRAEDNADALALVFEAQDQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVKFSASGELGTGNIKLSQTSNVDKEDEAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVTLSMSADIPLVVEYKIADMGHVKYYLAPKIDEE 258          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Xenopus
Match: pcna (proliferating cell nuclear antigen [Source:Xenbase;Acc:XB-GENE-972522])

HSP 1 Score: 335.88 bits (860), Expect = 8.376e-115
Identity = 148/259 (57.14%), Postives = 209/259 (80.69%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D + +GISLQ+MD+SHVSLV + LRSDGF+TYRCDRN ++G+ ++S+SKILK   S D +T++A D+++T++++ ES N+ ++S+YE+KLMDLD + LGIP+ EY C++KMPS +  RICRDLSQIG+A+ I   KDGV F+A+G+LG G +KL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLS  V+LS++ ++P V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLIDEACWDITSSGISLQSMDSSHVSLVQLTLRSDGFDTYRCDRNQSIGVKMSSMSKILKCAASEDIITLRAEDNADTVTMVFESPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSGEFARICRDLSQIGDAVVISCAKDGVKFSASGELGTGNVKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADIPLVVEYKIADMGHVKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Mouse
Match: Pcna (proliferating cell nuclear antigen [Source:MGI Symbol;Acc:MGI:97503])

HSP 1 Score: 335.109 bits (858), Expect = 4.223e-114
Identity = 149/259 (57.53%), Postives = 209/259 (80.69%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+LI+G + KKV+EA+KDL+ EA  D S  G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C++KMPS +  RICRDLS IG+A+ I   K+GV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLS  V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSGEFARICRDLSHIGDAVVISCAKNGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. Ensembl Mouse
Match: Pcna-ps2 (proliferating cell nuclear antigen pseudogene 2 [Source:MGI Symbol;Acc:MGI:97505])

HSP 1 Score: 335.109 bits (858), Expect = 4.811e-114
Identity = 149/259 (57.53%), Postives = 209/259 (80.69%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+LI+G + KKV+EA+KDL+ EA  D S  G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C++KMPSS+  RICRDLS IG+A+ I   K+GV F+A+G+LG G IKL+Q S+ DKE E V IEM EPV +T++LRY N FTKA PLS  V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSSEFARICRDLSHIGDAVVISCAKNGVKFSASGELGNGNIKLSQTSNVDKEEEAVAIEMNEPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. UniProt
Match: sp|P17917|PCNA_DROME (Proliferating cell nuclear antigen OS=Drosophila melanogaster GN=PCNA PE=1 SV=2)

HSP 1 Score: 340.887 bits (873), Expect = 1.572e-115
Identity = 149/259 (57.53%), Postives = 210/259 (81.08%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L +  + KK+++AIKDL+ EAT DCS++GI LQAMD SHVSLVS+ LRSDGF+ +RCDRN+++G+N+ S++KILK   + D++TMKA D+++T++++ ESAN+ ++S+YE+KLM+LD +HLGIP+T++ C+V+MP+ +  RICRDL+Q  E++ IC TK+GV F+A+GD+G   IKL Q  S DKE E V IEM EPV++T++ RY N FTKA PLS+QV LS+  +VP V+E+ I+DLG IRYYLAPKIED+E
Sbjct:    1 MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSLTLRSDGFDKFRCDRNLSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVTIMFESANQEKVSDYEMKLMNLDQEHLGIPETDFSCVVRMPAMEFARICRDLAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAVIIEMQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDNE 259          
BLAST of Proliferating cell nuclear antigen vs. UniProt
Match: sp|P61258|PCNA_MACFA (Proliferating cell nuclear antigen OS=Macaca fascicularis GN=PCNA PE=2 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.104e-114
Identity = 151/259 (58.30%), Postives = 211/259 (81.47%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D S +G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLS IG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLSS V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. UniProt
Match: sp|P12004|PCNA_HUMAN (Proliferating cell nuclear antigen OS=Homo sapiens GN=PCNA PE=1 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.104e-114
Identity = 151/259 (58.30%), Postives = 211/259 (81.47%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D S +G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLS IG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLSS V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. UniProt
Match: sp|O16852|PCNA_SARCR (Proliferating cell nuclear antigen OS=Sarcophaga crassipalpis GN=PCNA PE=3 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.312e-114
Identity = 148/259 (57.14%), Postives = 208/259 (80.31%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+LI   + KK+++AIK+L+ EAT +CSE+GI LQAMD SHVSL S+ LRSDGF+ +RCDRN+++G+N+ S++KILK   ++D++T+KA D+++T++ + ES N  ++S+YE+KLM+LD +HLGIP+T+Y C+V+MPS +  RICRDL+Q  E++ IC TK+GV F+A+GD+G   +KL Q SS DKE E V IEM EPV++T++ RY N FTKA PLS+QV LS+  +VP V+E+ I++LG IRYYLAPKIEDDE
Sbjct:    1 MFEARLINATILKKILDAIKELLHEATFECSESGIQLQAMDNSHVSLGSLTLRSDGFDKFRCDRNISMGMNLGSMAKILKCANNDDTVTVKAQDNADTVTFMFESPNHEKVSDYEMKLMNLDQEHLGIPETDYSCVVRMPSMEFARICRDLAQFSESMLICCTKEGVKFSASGDVGSANVKLAQTSSVDKEEEAVIIEMQEPVTLTFACRYLNAFTKATPLSAQVQLSMCADVPLVVEYAIKELGHIRYYLAPKIEDDE 259          
BLAST of Proliferating cell nuclear antigen vs. UniProt
Match: sp|P57761|PCNA_CRIGR (Proliferating cell nuclear antigen OS=Cricetulus griseus GN=PCNA PE=1 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 6.791e-114
Identity = 150/259 (57.92%), Postives = 209/259 (80.69%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L++G + KKV+EA+KDL+ EA  D S  G++LQ+MD+SHVSLV + LRS+GF+TYRCDRN+ +G+N+TS+SKILK  G+ D +T++A D+++T++L+ E+ N+ ++S+YE+KLMDLD + LGIP+ EY C+VKMPS +  RICRDLS IG+A+ I   KDGV F+A+G+LG G IKL+Q S+ DKE E VTIEM EPV +T++LRY N FTKA PLS  V+LS++ +VP V+E+ I D+G ++YYLAPKIED+E
Sbjct:    1 MFEARLVQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSTDVPLVVEYKISDMGHLKYYLAPKIEDEE 259          
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Match: tr|Q5H7M5|Q5H7M5_DUGJA (Proliferating cell nuclear antigen OS=Dugesia japonica GN=Djpcna PE=2 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 3.234e-150
Identity = 215/259 (83.01%), Postives = 243/259 (93.82%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEAK+IKGE+ KK IEAIKDL+QEATLDCSENGISLQAMDTSHVSLVS+LLRS+GFETYRCDRN+NLGLN+ SVSKILK LGSNDSLTMKAADS++TIS LIES+NE+ELSE+EIKLMD++GDHLGIPDTEYKCIVKMPS+KLQ+IC+++SQ+GEAITI V KDGVTF + GD+G G   L+QNSSADKENEGVTIEMTEPVSMTYSLRYFNMF KAAPLS  VSLSLTENVPAV+EF+I+D+G+IRYYLAPKIEDDE
Sbjct:    1 MFEAKIIKGEILKKAIEAIKDLIQEATLDCSENGISLQAMDTSHVSLVSLLLRSEGFETYRCDRNINLGLNVVSVSKILKCLGSNDSLTMKAADSNDTISFLIESSNESELSEFEIKLMDIEGDHLGIPDTEYKCIVKMPSAKLQKICKEMSQMGEAITITVAKDGVTFVSTGDIGNGKTTLHQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFAKAAPLSPIVSLSLTENVPAVVEFLIDDIGYIRYYLAPKIEDDE 259          
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Match: tr|C1L8V7|C1L8V7_SCHJA (Proliferating cell nuclear antigen OS=Schistosoma japonicum PE=2 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 4.012e-139
Identity = 187/258 (72.48%), Postives = 227/258 (87.98%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L + +VWKKVI+AIKDLVQEATLDC+ENGISLQAMD +HVSLVS+LLRSDGFETYRCDRN++LGLNITS SKIL+    ND++T+KA D ++T++ + ES N+   SE+EIKLMDLD DHLGIPDT+YKCI++MPS++LQRICRDLSQIG+++ I V KDGV+F++ GDLG G +KL+Q+++ADK  E V+IEM E VSMTYSL YFN+FTKAAPLSSQV LSLTENVPAV+EF IEDLG+IRYYLAPKIEDD
Sbjct:    1 MFEARLTQADVWKKVIDAIKDLVQEATLDCTENGISLQAMDNAHVSLVSLLLRSDGFETYRCDRNLSLGLNITSASKILRCASGNDAITLKAGDKADTLTFVFESKNQERSSEFEIKLMDLDVDHLGIPDTDYKCIIRMPSAQLQRICRDLSQIGDSVVISVAKDGVSFSSNGDLGTGNVKLSQSANADKPEESVSIEMHEAVSMTYSLHYFNIFTKAAPLSSQVVLSLTENVPAVVEFGIEDLGYIRYYLAPKIEDD 258          
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Match: tr|C1L8V9|C1L8V9_SCHJA (Proliferating cell nuclear antigen OS=Schistosoma japonicum PE=2 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 1.234e-138
Identity = 186/258 (72.09%), Postives = 227/258 (87.98%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L + +VWKKVI+AIKDLVQEATLDC+ENGISLQAMD +HVSLVS+LLRSDGFETYRCDRN++LGLNITS SKIL+    ND++T+KA D ++T++ + ES N+   SE+EIKLMDLD DHLGIPDT+YKCI++MPS++LQRICRDLSQIG+++ I V KDGV+F++ GDLG G +KL+Q+++ADK  E V+IEM E VSMTYSL YFN+FTKAAPLSSQV LSLTENVPAV+EF I+DLG+IRYYLAPKIEDD
Sbjct:    1 MFEARLTQADVWKKVIDAIKDLVQEATLDCTENGISLQAMDNAHVSLVSLLLRSDGFETYRCDRNLSLGLNITSASKILRCASGNDAITLKAGDKADTLTFVFESKNQERSSEFEIKLMDLDVDHLGIPDTDYKCIIRMPSAQLQRICRDLSQIGDSVVISVAKDGVSFSSNGDLGTGNVKLSQSANADKPEESVSIEMHEAVSMTYSLHYFNIFTKAAPLSSQVVLSLTENVPAVVEFGIDDLGYIRYYLAPKIEDD 258          
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Match: tr|A0A183K5K8|A0A183K5K8_9TREM (Proliferating cell nuclear antigen OS=Schistosoma curassoni PE=3 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 3.295e-138
Identity = 186/258 (72.09%), Postives = 227/258 (87.98%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDD 847
            MFEA+L + +VWKKVI+AIKDLVQEATLDC+ENGISLQAMD +HVSLVS+LLRSDGFETYRCDRN++LGLNITS SKIL+    ND++T+KA D ++T++ + ES +++  SE+EIKLMDLD DHLGIPDT+YKCI++MPS++LQRICRDLSQIG+++ I V KDGV+F++ GDLG G +KL Q+++ADK  E V+IEM EPV MTYSL YFN+FTKAAPLSSQV LSLTENVPAV+EF IEDLG+IRYYLAPKIEDD
Sbjct:    1 MFEARLTQADVWKKVIDAIKDLVQEATLDCTENGISLQAMDNAHVSLVSLLLRSDGFETYRCDRNLSLGLNITSASKILRCASGNDAITLKAGDKADTLTFVFESKSQDRSSEFEIKLMDLDVDHLGIPDTDYKCIIRMPSAQLQRICRDLSQIGDSVVISVAKDGVSFSSNGDLGTGNVKLCQSANADKPEESVSIEMHEPVCMTYSLHYFNIFTKAAPLSSQVVLSLTENVPAVVEFEIEDLGYIRYYLAPKIEDD 258          
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Match: tr|A0A0R3SSF9|A0A0R3SSF9_HYMDI (Proliferating cell nuclear antigen OS=Hymenolepis diminuta PE=3 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 6.770e-138
Identity = 183/259 (70.66%), Postives = 231/259 (89.19%), Query Frame = 2
Query:   74 MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSMLLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETISLLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRDLSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMTEPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYYLAPKIEDDE 850
            MFEA+L + +VWKKVI+AIK+LVQEAT+DCS+ GISLQAMD++HVSLVS+LLRSDGFET+RCDRN++LGLNI+S +KILK  GS+DS+T+KA D ++TI+ L ES N+ ++SE+E+KLMDLD DHLGIP+T+YKC++KMP+S+LQRICRDL QIG+++ I V+KDGV F++ GDLG G IKL+Q ++ADK  E VTIEM+EPVSMTYSL YFN+FTKAAPL+SQV LSLT +VPAV+EF IEDLG++RYYLAPKIEDDE
Sbjct:    1 MFEARLPQADVWKKVIDAIKELVQEATIDCSDTGISLQAMDSAHVSLVSLLLRSDGFETFRCDRNMSLGLNISSAAKILKCAGSSDSITLKAGDKADTITFLFESKNQEKVSEFELKLMDLDVDHLGIPETDYKCVIKMPASELQRICRDLGQIGDSVVISVSKDGVGFSSTGDLGSGKIKLSQTANADKPEEAVTIEMSEPVSMTYSLHYFNIFTKAAPLASQVILSLTADVPAVVEFPIEDLGYVRYYLAPKIEDDE 259          
The following BLAST results are available for this feature:
BLAST of Proliferating cell nuclear antigen vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 2
Match NameE-valueIdentityDescription
PCNA2.148e-11558.30proliferating cell nuclear antigen [Source:HGNC Sy... [more]
PCNA2.148e-11558.30proliferating cell nuclear antigen [Source:HGNC Sy... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 1
Match NameE-valueIdentityDescription
pcn-11.946e-8244.23Proliferating cell nuclear antigen [Source:UniPro... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 3
Match NameE-valueIdentityDescription
PCNA1.590e-11657.53Proliferating cell nuclear antigen [Source:FlyBase... [more]
PCNA1.590e-11657.53Proliferating cell nuclear antigen [Source:FlyBase... [more]
CG102621.691e-8647.08pep:known chromosome:BDGP6:2L:19582823:19583990:-1... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 2
Match NameE-valueIdentityDescription
pcna1.394e-11156.20proliferating cell nuclear antigen [Source:ZFIN;Ac... [more]
pcna8.029e-11155.81proliferating cell nuclear antigen [Source:ZFIN;Ac... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 1
Match NameE-valueIdentityDescription
pcna8.376e-11557.14proliferating cell nuclear antigen [Source:Xenbase... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 2
Match NameE-valueIdentityDescription
Pcna4.223e-11457.53proliferating cell nuclear antigen [Source:MGI Sym... [more]
Pcna-ps24.811e-11457.53proliferating cell nuclear antigen pseudogene 2 [S... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17917|PCNA_DROME1.572e-11557.53Proliferating cell nuclear antigen OS=Drosophila m... [more]
sp|P61258|PCNA_MACFA1.104e-11458.30Proliferating cell nuclear antigen OS=Macaca fasci... [more]
sp|P12004|PCNA_HUMAN1.104e-11458.30Proliferating cell nuclear antigen OS=Homo sapiens... [more]
sp|O16852|PCNA_SARCR1.312e-11457.14Proliferating cell nuclear antigen OS=Sarcophaga c... [more]
sp|P57761|PCNA_CRIGR6.791e-11457.92Proliferating cell nuclear antigen OS=Cricetulus g... [more]
back to top
BLAST of Proliferating cell nuclear antigen vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|Q5H7M5|Q5H7M5_DUGJA3.234e-15083.01Proliferating cell nuclear antigen OS=Dugesia japo... [more]
tr|C1L8V7|C1L8V7_SCHJA4.012e-13972.48Proliferating cell nuclear antigen OS=Schistosoma ... [more]
tr|C1L8V9|C1L8V9_SCHJA1.234e-13872.09Proliferating cell nuclear antigen OS=Schistosoma ... [more]
tr|A0A183K5K8|A0A183K5K8_9TREM3.295e-13872.09Proliferating cell nuclear antigen OS=Schistosoma ... [more]
tr|A0A0R3SSF9|A0A0R3SSF9_HYMDI6.770e-13870.66Proliferating cell nuclear antigen OS=Hymenolepis ... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000730Proliferating cell nuclear antigen, PCNAPRINTSPR00339PCNACYCLINcoord: 11..30
score: 50.95
coord: 35..53
score: 71.68
coord: 204..218
score: 53.97
coord: 111..133
score: 55.49
coord: 57..81
score: 59.43
coord: 242..259
score: 63.49
NoneNo IPR availableGENE3DG3DSA:3.70.10.10coord: 2..260
e-value: 4.3E-112
score: 373.0
NoneNo IPR availableSUPERFAMILYSSF55979DNA clampcoord: 128..256
NoneNo IPR availableSUPERFAMILYSSF55979DNA clampcoord: 2..127
NoneNo IPR availableTMHMMTMhelixcoord: 7..25
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.486
IPR022648Proliferating cell nuclear antigen, PCNA, N-terminalPFAMPF00705PCNA_Ncoord: 2..125
e-value: 4.8E-50
score: 168.4
IPR022649Proliferating cell nuclear antigen, PCNA, C-terminalPFAMPF02747PCNA_Ccoord: 128..255
e-value: 1.6E-50
score: 170.4
IPR022659Proliferating cell nuclear antigen, PCNA, conserved sitePROSITEPS01251PCNA_1coord: 35..58
IPR022659Proliferating cell nuclear antigen, PCNA, conserved sitePROSITEPS00293PCNA_2coord: 62..80

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000730Pr_cel_nuc_antig
IPR022648Pr_cel_nuc_antig_N
IPR022649Pr_cel_nuc_antig_C
IPR022659Pr_cel_nuc_antig_CS
Vocabulary: molecular function
TermDefinition
GO:0030337DNA polymerase processivity factor activity
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006275regulation of DNA replication
GO:0006260DNA replication
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000212blastomere compartment
PLANA:0004517blastomere
PLANA:0000429neoblast compartment
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
PLANA:0000008Stage 8
PLANA:0000003Stage 3
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000002Stage 2
PLANA:0000007Stage 7
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004304 ID=SMED30004304|Name=Proliferating cell nuclear antigen|organism=Schmidtea mediterranea sexual|type=transcript|length=907bp
CTAAAAGGTAATAATTTAAATTTAATTAGAACATTGTTTTAATATTCGGT
TATATTCTCCATTATTCTAAATTATGTTTGAAGCAAAATTAATAAAAGGC
GAAGTTTGGAAAAAGGTTATAGAAGCTATAAAAGACTTAGTACAAGAAGC
AACATTGGATTGCTCAGAAAATGGAATTAGTCTTCAAGCCATGGATACAT
CTCATGTGTCCTTAGTTAGTATGCTTCTTCGAAGTGATGGTTTTGAGACT
TATCGATGTGATAGAAATGTCAATCTCGGTCTTAATATAACAAGTGTTTC
AAAAATTTTAAAGGCGCTTGGTAGTAATGATTCCCTAACAATGAAAGCCG
CTGATTCAAGTGAAACAATTTCGCTTTTGATAGAATCTGCAAATGAAAAT
GAATTATCTGAATACGAAATAAAATTAATGGACTTGGATGGAGATCACTT
AGGTATACCAGATACTGAATATAAGTGCATTGTGAAAATGCCGAGTTCAA
AGTTACAAAGAATATGTCGAGATTTAAGCCAAATTGGAGAAGCAATCACG
ATTTGTGTTACTAAAGATGGTGTAACTTTTGCTGCTGCTGGAGATCTAGG
AAAAGGAGCTATAAAACTTAATCAAAATTCTAGTGCTGACAAAGAAAATG
AAGGAGTAACTATTGAAATGACCGAACCTGTTTCGATGACATATTCATTG
AGGTATTTCAATATGTTTACAAAGGCTGCACCTCTTTCTTCTCAAGTATC
TCTGTCGTTGACTGAAAATGTTCCAGCAGTTATTGAGTTCATAATCGAAG
ATTTGGGATTTATTCGATATTACCTAGCTCCTAAAATCGAAGACGACGAG
TGAAAGTTTAACTATTAATGTTGTATGTTTAATAGATGTTATTTTGTTTA
AAAAAAA
back to top

protein sequence of SMED30004304-orf-1

>SMED30004304-orf-1 ID=SMED30004304-orf-1|Name=SMED30004304-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MFEAKLIKGEVWKKVIEAIKDLVQEATLDCSENGISLQAMDTSHVSLVSM
LLRSDGFETYRCDRNVNLGLNITSVSKILKALGSNDSLTMKAADSSETIS
LLIESANENELSEYEIKLMDLDGDHLGIPDTEYKCIVKMPSSKLQRICRD
LSQIGEAITICVTKDGVTFAAAGDLGKGAIKLNQNSSADKENEGVTIEMT
EPVSMTYSLRYFNMFTKAAPLSSQVSLSLTENVPAVIEFIIEDLGFIRYY
LAPKIEDDE*
back to top
Aliases
The feature 'Proliferating cell nuclear antigen' has the following synonyms
Synonym
PCNA