Transposon Ty3-I Gag-Pol polyprotein

Overview
NameTransposon Ty3-I Gag-Pol polyprotein
Smed IDSMED30004301
Length (bp)4339
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transposon Ty3-I Gag-Pol polyprotein (SMED30004301) t-SNE clustered cells

Violin plots show distribution of expression levels for Transposon Ty3-I Gag-Pol polyprotein (SMED30004301) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transposon Ty3-I Gag-Pol polyprotein (SMED30004301) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transposon Ty3-I Gag-Pol polyprotein (SMED30004301) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004301

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004301SMESG000023258.1 dd_Smed_v4_3718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004301SMESG000023258.1 dd_Smed_v4_3718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004301SMESG000023258.1 dd_Smed_v4_3718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004301SMESG000023258.1 dd_Smed_v4_3718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004301SMESG000023258.1 dd_Smed_v4_3718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004301SMESG000023258.1 dd_Smed_v4_3718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004301SMESG000019014.1 Contig37335uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004301SMESG000019014.1 Contig37335newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004301SMESG000078181.1 SMESG000023258.1 Contig21613uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004301SMESG000078181.1 SMESG000023258.1 Contig21613newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004301SMESG000053822.1 SMESG000023258.1 SMESG000066529.1 Contig16739uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004301SMESG000053822.1 SMESG000023258.1 SMESG000066529.1 Contig16739newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004301SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 SMESG000023258.1 Contig11919uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004301SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 SMESG000023258.1 Contig11919newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30004301SMESG000023258.1 dd_Smed_v6_3718_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30004301SMESG000020556.1 Contig45120uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004301SMESG000020556.1 Contig45120newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004301SMESG000057758.1 SMESG000057756.1 SMESG000023258.1 Contig14979uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004301SMESG000057758.1 SMESG000057756.1 SMESG000023258.1 Contig14979newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004301SMESG000074570.1 SMESG000074512.1 SMESG000023258.1 Contig17553newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004301SMESG000074570.1 SMESG000074512.1 SMESG000023258.1 Contig17553uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004301 Contig52894uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004301 Contig52894newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 101.293 bits (251), Expect = 9.161e-21
Identity = 85/329 (25.84%), Postives = 150/329 (45.59%), Query Frame = 1
Query:  790 EC--TSPWNSPLVCVKKKNSSDIRICLDYRALNN-ITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVEL-----DDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVL-EALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSI 1743
            EC  T+PW      V  +     R+  +Y  L + +T R  + I    EL D L GA++F+ ++L     +  +     +D  K       +  + Y    PF ++  P   Q +++ +L ++     + Y  ++LI+S +  EH   + +V  + +  N+  S  K QF R+ V+FLG ++   G++ +++ +  I  +  P    SLR F+     YR F+E ++  ++ L   L  S Q    W  E + +F+ LK      P+L  P    PF L+T  +   + A L Q D   GK    A+ SR ++  E+ Y     ++L I
Sbjct:  609 ECPSTAPWEP----VGARMQERARLQEEYWDLQDMLTNRQDY-IQMIPELFDQLHGAEWFTKLELRGTIVEESVNGHRTEDVWKAAFGLELEEMKSY---QPFALSPDPIIPQNVIHFILKDMLGFFVLSYGQEVLIYSMSQEEHLHHVRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSSYQ--FYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPI 927          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 101.293 bits (251), Expect = 9.161e-21
Identity = 85/329 (25.84%), Postives = 150/329 (45.59%), Query Frame = 1
Query:  790 EC--TSPWNSPLVCVKKKNSSDIRICLDYRALNN-ITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVEL-----DDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVL-EALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSI 1743
            EC  T+PW      V  +     R+  +Y  L + +T R  + I    EL D L GA++F+ ++L     +  +     +D  K       +  + Y    PF ++  P   Q +++ +L ++     + Y  ++LI+S +  EH   + +V  + +  N+  S  K QF R+ V+FLG ++   G++ +++ +  I  +  P    SLR F+     YR F+E ++  ++ L   L  S Q    W  E + +F+ LK      P+L  P    PF L+T  +   + A L Q D   GK    A+ SR ++  E+ Y     ++L I
Sbjct:  609 ECPSTAPWEP----VGARMQERARLQEEYWDLQDMLTNRQDY-IQMIPELFDQLHGAEWFTKLELRGTIVEESVNGHRTEDVWKAAFGLELEEMKSY---QPFALSPDPIIPQNVIHFILKDMLGFFVLSYGQEVLIYSMSQEEHLHHVRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSSYQ--FYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPI 927          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: KRBA2 (KRAB-A domain containing 2 [Source:HGNC Symbol;Acc:HGNC:26989])

HSP 1 Score: 56.225 bits (134), Expect = 3.257e-7
Identity = 37/147 (25.17%), Postives = 73/147 (49.66%), Query Frame = 1
Query: 2431 LQLAMKGE-RYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHS-ANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            +Q +  GE ++IL   DH +KFI L  ++++    VV +L + + +  G P +++ D G  F ++++ +  E        S  YH   + G +E   R +++ I   ++      W   L  +Q + N  F  +++++P E +FG K
Sbjct:  236 MQSSADGEFKFILYYQDHSTKFIILRPLRTKQAHEVVSVLLDIFTI-LGTPSVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGSLEGASRDVKNMISTWMQSNHSCHWAKGLRFMQMVRNQAFDVSLQQSPFEAMFGYK 381          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: KRBA2 (KRAB-A domain containing 2 [Source:HGNC Symbol;Acc:HGNC:26989])

HSP 1 Score: 56.225 bits (134), Expect = 3.257e-7
Identity = 37/147 (25.17%), Postives = 73/147 (49.66%), Query Frame = 1
Query: 2431 LQLAMKGE-RYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHS-ANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            +Q +  GE ++IL   DH +KFI L  ++++    VV +L + + +  G P +++ D G  F ++++ +  E        S  YH   + G +E   R +++ I   ++      W   L  +Q + N  F  +++++P E +FG K
Sbjct:  236 MQSSADGEFKFILYYQDHSTKFIILRPLRTKQAHEVVSVLLDIFTI-LGTPSVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGSLEGASRDVKNMISTWMQSNHSCHWAKGLRFMQMVRNQAFDVSLQQSPFEAMFGYK 381          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: KRBA2 (KRAB-A domain containing 2 [Source:HGNC Symbol;Acc:HGNC:26989])

HSP 1 Score: 55.8398 bits (133), Expect = 3.623e-7
Identity = 37/147 (25.17%), Postives = 73/147 (49.66%), Query Frame = 1
Query: 2431 LQLAMKGE-RYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHS-ANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            +Q +  GE ++IL   DH +KFI L  ++++    VV +L + + +  G P +++ D G  F ++++ +  E        S  YH   + G +E   R +++ I   ++      W   L  +Q + N  F  +++++P E +FG K
Sbjct:  163 MQSSADGEFKFILYYQDHSTKFIILRPLRTKQAHEVVSVLLDIFTI-LGTPSVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGSLEGASRDVKNMISTWMQSNHSCHWAKGLRFMQMVRNQAFDVSLQQSPFEAMFGYK 308          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX511224.1 (pep chromosome:GRCz11:2:18017000:18022765:1 gene:ENSDARG00000113243.1 transcript:ENSDART00000186877.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511224.1)

HSP 1 Score: 325.094 bits (832), Expect = 1.040e-90
Identity = 222/701 (31.67%), Postives = 345/701 (49.22%), Query Frame = 1
Query:  739 EKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGK--KFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYH--KKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKS-DSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSK---FISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNS 2811
            E +E+ I + L   II   +SP  +    VKKK+ S +R C+DYR LN+IT +  +P+P      + L GA FF+ +DL NAY+ V +    + KTAF+T    + +  +PFG++ APA FQ L+N VL ++      VYLDDILIFS +L EH   + +V Q++    L +   KC F  + V+FLGHI+  +G+R D  KI+ + N+  P   K+L+ FLG AN+YR+FI N+++ +  L +L  SK     W+   E +F  LK    S P+L  PD S+ F+++ DAS   +GA+LSQ+    GK    AY S  ++  E  Y I  +ELL++      ++H+L G    FI+ TDHK + + +K+ K +  +   W       +  I YR G  +   DALSR          +   + +       L   +   + NI    S EIE+          +T    V   I    N++++PEE +S+ +   H  K  CH G ++    V   F    + + +R+ V +C  C   K         +   S  S+ +  I +DF   L  +  G   IL ++D  SK   FISL  + S  E  V  +  +     +G P  +  DRG  F SK  ++F       ++ SS +H  +NGQ ER  + +   ++  L  +   SW   L  V++  NS
Sbjct:  538 EAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGS-LRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVCIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHIQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIHNFSQLAAPLTSLTSSK-TPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSASDGKVHPCAYFSHRLSSAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEY-IKSAKRLNSRQARWALFFGRFNFTISYRPGSKNIKPDALSR----------LFDPSDRTSSPDPVLPQRIV--VANI----SWEIESRV--------RTALDGVTPPIGCPPNRLFVPEELRSDVVRWGHSSKVACHPGVSRTLFVVKQRFWWPAMARDVRDFVLACSVCAVSKSSNRPPAGLLQPLSVPSRPWSHISLDFVTGLP-SSNGNTVILTVVDRFSKAAHFISLPKLPSARETAVAVI--DHVFRIHGLPTDVVSDRGPQFVSKFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLR-CLVSQNPSSWSQQLSWVEYAHNS 1207          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 324.709 bits (831), Expect = 1.260e-90
Identity = 221/719 (30.74%), Postives = 345/719 (47.98%), Query Frame = 1
Query:  739 EKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGK--KFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSR--KECETCVQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYH--KKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKS-DSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSK---FISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFG 2859
            E +E+ I + L   II   +SP  +    VKKK+ S +R C+DYR LN IT +  +P+P      + L GA FF+ +DL NAY+ V + +  + KTAF+T    + +  +PFG++ APA FQ L+N VL ++      VYLDDILIFS +L EH   + +V Q++    L +   KC F  + V FLGHI+  +G+R D  K++ + ++  P   K+L+ FLG AN+YR+FI N+++ +  L AL  S +    W++  + +F  LK    S P+L  PD S+ F+++ DAS   +GA+LSQ+    GK    AY S  +N  E  Y I  +ELL++      ++H+L G    FI+ TDHK + ++   K+  + Q + W       D  I YR G  +   DALSR     E          +P+    +   ++ +T  IE+   +    +E +       P + F                +PEE +S+ I   H  K  CH G ++    +   F    + + IRN V +C  C   K         +   S  S+ +  I +DF   L  +  G   IL ++D  SK   FI L  + S  E     +  +     +G P  +  DRG  F SK  ++F       ++ SS +H  +NGQ ER  + +   ++  L  +   SW   L  V++  NS        +P E   G
Sbjct:  538 EAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGS-LRPCIDYRGLNAITVKNTYPLPLMSSAFERLQGASFFTKLDLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMLDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGMRMDPEKVQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALT-SLKTPFRWSNAAQVAFDRLKSCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSSSDGKMHPCAYFSHRLNNAEQNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIQSAKRLNSRQAR-WALFFGRFDFSISYRPGSKNVKPDALSRIFDHSERA-------SSPETIVPRRLFISAVTWEIES---RVRMALEGVTPPPGCPPSRLF----------------VPEELRSDVIRWGHSSKLACHPGVSRTLYLIKQRFWWPVMARDIRNFVLACSVCAVSKTSNRPPAGLLQPLSVPSRPWSHIALDFVTGLPPS-NGNTVILTVVDRFSKATHFIPLPKLPSARETAAAVI--DHVFRIHGLPTDVVSDRGPQFISKFWREFCHLMGATVSLSSGFHPQSNGQTERANQDLERMLR-CLVSQNPSSWSQQLSWVEYAHNSLPVSATGLSPFECSLG 1223          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 323.168 bits (827), Expect = 2.270e-90
Identity = 225/763 (29.49%), Postives = 364/763 (47.71%), Query Frame = 1
Query:  739 EKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGK--KFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLT-LMTDNIENIWQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYH--KKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKS-DSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSK---FISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFG--KKIYSEWFSEIVEEEKTN--QPTNREFQIGDCVLIKVNVRNKG 2982
            E +E+ I + L   II   +SP  +    VKKK+ S +R C+DYR LN+IT +  +P+P      + L GA FF+ +DL NAY+ V +    + KTAF+T    + +  +PFG++ APA FQ L+N VL ++      VYLDDILIFS +L EH   + +V Q++    L +   KC F  + V+FLGHI+  +G+R D  KI+ + ++  P   K+L+ FLG AN+YR+FI N+++ +  L +L  SK     W+   E +F  LK    S P+L  PD S+ F+++ DAS   +GA+LSQ+    GK    AY S  ++  E  Y I  +ELL++      ++H+L G    FI+ TDHK + ++   K+  + Q + W       +  I YR G  +   DALSR          +   + ++      L   ++  NI   W+  S+              +T    V   I    +++++PEE +S+ +   H  K  CH G ++    +   F    + + +R+ V +C  C   K         +   S  S+ +  I +DF   L  +  G   +L ++D  SK   FISL  + S  E  V  +  +     +G P  +  DRG  F S+  ++F       ++ SS +H  +NGQ ER  + +   ++  L  +   SW   L  V++  NS    +   +P +   G    ++    SE+         Q   R +      L++V  R K 
Sbjct:  512 EAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGS-LRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTSLTSSKM-PFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSSSDGKIHPCAYFSHRLSPAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIRSAKRLNSRQAR-WALFFGRFNFTISYRPGSKNIKPDALSR----------LFDPSDRLSSPDPVLPQGIVVANIS--WEIESRV-------------RTALNGVTPPIGCPPSRLFVPEELRSDVVRWGHSSKVACHPGVSRTLFVIKQRFWWPTMARDVRDFVLACSVCAVSKSSNRPPAGLLQPLSVPSRPWSHISLDFVTGLP-SSNGNTVVLTVVDRFSKAAHFISLPKLPSARETAVAVI--DHVFRIHGLPTDVVSDRGPQFVSRFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLR-CLVSQNPSSWSQQLSWVEYAHNSLPVSSTGLSPFQCSLGYQPPVFPSLESEVAVPSVHAFVQRCRRTWNRARQTLLRVGTRTKA 1242          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: CR855320.1 (pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENSDARG00000099359.2 transcript:ENSDART00000159655.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855320.1)

HSP 1 Score: 322.783 bits (826), Expect = 4.970e-90
Identity = 231/766 (30.16%), Postives = 363/766 (47.39%), Query Frame = 1
Query:  739 EKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGK--KFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLTLMTDNIENI-WQKNSK---EIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYH--KKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKS-DSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSK---FISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFG--KKIYSEWFSEIVEEEKTN--QPTNREFQIGDCVLIKVNVRNKG 2982
            E + + I + L   II   +SP  +    VKKK+ S +R C+DYR LNNIT +  +P+P      + L GA FF+ +DL NAY+ V +    + K+AF+T    + +  +PFG++ APA FQ  +N VL ++      VYLDDILIFS +L EH   I +V Q++    L +   KC F  + V FLGHI+  +G+R D  KI+ + N+  P   K+L+ FLG AN+YR+FI N+++ +  L AL  SK     W+   E +F  LK    S P+L  PD S+ F+++ DAS   +GA+LSQ+    GK    AY S  ++  E  Y I  +ELL++      ++H+L G    FI+ TDHK + + +K+ K +  +   W       +  I YR G  +   DALSR          +   + +   L+  +   +   I NI W+  SK    ++ +   I   P + F                +PE+ +S+ I   H  K  CH G ++    +   F    L + +R+ V +C  C   K         +   S  S+ +  I +DF   L  +  G   IL ++D  SK   F+ L  + S  E T V ++   + + +G P  +  DRG  F SK  ++F       ++ SS +H  +NGQ ER  + +   ++  L  +   SW   L  V++  NS        +P +   G    ++    SE+         Q   R +      L++V VR K 
Sbjct:  540 EAMGKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGS-LRPCIDYRGLNNITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRAGDEWKSAFNTPRGHFEYCVLPFGLSNAPAVFQAFVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHIRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGLRMDPEKIKAVVNWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSSK-TPFRWSSAAEAAFSKLKGCFVSAPILITPDPSRQFVVEVDASEVGVGAILSQRSSSDGKIHPCAYYSHRLSAAESNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEY-IKSAKRLNSRQARWALFFGRFNFTISYRPGSKNIKPDALSR----------LFDSSERTSSLEPVVPKRIV--ISNITWEIESKVRAALDGVTPPIGCPPSRLF----------------VPEKLRSDVIRWGHSSKVACHPGVSRTSFVIKQRFWWPALARDVRDFVLACSVCAVSKTSNRPPAGLLQPLSVPSRPWSHISLDFVTGLPPS-NGNTVILTVVDRFSKAAHFVPLPKLPSARE-TAVAVINHVFRI-HGLPTDVVSDRGPQFISKFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLR-CLVSQNPSSWSQQLSWVEYAHNSLPVSATGLSPFQCSLGYQPPVFPSLESEVAVPSVHAFVQRCRRTWSRARQTLLQVGVRTKA 1270          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: CR925755.2 (pep chromosome:GRCz11:17:42486740:42492668:-1 gene:ENSDARG00000116402.1 transcript:ENSDART00000183946.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR925755.2)

HSP 1 Score: 315.849 bits (808), Expect = 9.152e-88
Identity = 215/718 (29.94%), Postives = 343/718 (47.77%), Query Frame = 1
Query:  739 EKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGK--KFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLT-LMTDNIENIWQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYH--KKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKS-DSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSK---FISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFG 2859
            E +E+ I + L   II   +SP  +    VKKK+ S +R C+DYR LN+IT +  +P+P      + L GA FF+ +DL NAY+ V +    + KTAF+T    + +  +PFG++ APA FQ L+N VL ++      VYLDDILIFS +L EH   + +V Q++    L +   KC F  + V+FLGH +  +G+R D  KI+ + N+  P   K+L+ FLG AN+YR+FI N+ + +  L  L  SK     W++  E +F  LK    S P+L  PD S+ F+++ D S   +GA+LSQ+    GK    AY S  ++  E  Y I  +ELL++      ++H+L G    FI+ TDHK + + +K+ K +  +   W       +  I YR G  +   DALSR          +   + +       L   +   NI   W+  S+              +T    V   I    +++++PE+ +S+ I   H  K  CH G ++    +   F    + + +R+ V +C  C   K         +   S  S+ +  I +DF   L  +  G   +L ++D  SK   F+ L  + S  E  V  +  +     +G P  +  DRG  F SK  ++F       ++ SS +H  +NGQ ER  + +   ++  L  +   SW   L  V++  NS        +P +   G
Sbjct:  511 EAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGS-LRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHTVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIRNFRQLAAPLTNLTSSK-TPFRWSNAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDVSEVGVGAILSQRSALDGKIHPCAYFSHRLSAAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVSTDHKNLEY-IKSAKRLNSRQARWALFFGRFNFSISYRPGSKNIKPDALSR----------LFDRSDRTSSPDPVLPQRVFVANIS--WEIESRV-------------RTALDGVTPPIGCPPSRLFVPEDLRSDVIWWGHSSKVACHPGVSRTLFVIKQRFWWPVMARDVRDFVLACSVCAASKSSNRPPAGLLQPLSVPSRPWSHISLDFVTGLP-SSNGNTVVLTVVDRFSKAAHFVPLPKLPSARETAVAVI--DHVFRIHGLPTDVVSDRGPQFVSKFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLR-CLVSQNPSSWSQQLSWVEYAHNSLPVSATGLSPFQCSLG 1196          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 336.65 bits (862), Expect = 5.841e-99
Identity = 181/468 (38.68%), Postives = 274/468 (58.55%), Query Frame = 1
Query:  574 HISEDKIINNLISTFDGIFMKHKWDVGKTELLKHEILTKGSPIVINPRRQPIHLI-----EKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKK-LMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG-GKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKE 1956
            H+S+   +  ++ ++  +F  +    G+T   +H++ T G+ +   P R P + +      +++  I EML +G+I+   SPW SP+V V KK+ S  R C+DYR LN++T    +P+P  DELLD L  AK+ +T+DL   Y+Q+ L  +++ K+AF T    Y F  MPFG+  APATFQRL+N +L  +  +    YLDDI +FS+T  EH   +++VF +I+ A L + P KC     EV++LGH +G   +R D +K+E I  +  PK  K +  FLG + YYRKFI NY+  +K L  L   ++ + ++WT ECE++   LK  L S+PVL  PDFS+ FIL TDAS   +GAVLSQ +  G+E  +AY SR +   E  Y    KE L+I +     + YLYG++F + TDH  ++++ +       +   W   L   +  IQ+RKG  H+NAD LSR+E
Sbjct:  298 HLSQQDQLRKILRSYSPMFSANP---GRTHWAEHKVDT-GTQL---PIRSPAYRVAEAVRPEMKSQIDEMLAFGVITPSHSPWASPVVLVPKKDGS-TRFCVDYRRLNDVTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLVNRLLEGMQ-DFAQAYLDDIAVFSQTWEEHLQHLQRVFAQIQDAGLTLKPEKCHLAMAEVQYLGHRVGGGQLRPDPAKVEAICQWPIPKTQKQVLAFLGTSGYYRKFIPNYSTVAKPLTDLTSRQRSRTIVWTPECESAMNALKQALASSPVLAAPDFSRRFILQTDASNFGLGAVLSQVNTYGEEHPVAYLSRKLLPREAAYATIEKECLAIVWALQKLQPYLYGREFTVVTDHNPLSWLQRV-SGDNGKLLRWSLLLQQYNFTIQHRKGKEHHNADGLSRQE 755          

HSP 2 Score: 59.6918 bits (143), Expect = 3.456e-8
Identity = 54/234 (23.08%), Postives = 97/234 (41.45%), Query Frame = 1
Query: 2473 IDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKKIYSE-------W-----------------FSEIVEEEKT------------------NQPTNREFQIGDCVLIKVNVR-NKGDNRYMGPGVITKKIHDRSYEI 3045
            +D+ +++    A++  D  TV   L +    + G P  I  D+G  F S+L++   +   +   +SSPYH   NG  ER   T++  ++ T  +   K W   LP + F      Q++   +P E+++G+++          W                 F + +E+  +                   +   R F  GD VL+ V  R +K    + GP V+T K+HD +Y +
Sbjct:    1 MDYATRYPEAVALRKIDAPTVADALIQI-FSRVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCERFNGTLKTMLR-TFVESGEKDWERYLPHLLFAYREVPQESTGFSPFELLYGRRVRGPLDLLCEYWEGAPQSQEVPIIPYVLKFRQRLEQMTSLAHDHLSAAQQRQKVWYDRKARERRFMEGDKVLLLVPTRHDKLQAAWEGPYVVTHKLHDTTYVV 232          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 308.145 bits (788), Expect = 1.417e-85
Identity = 169/498 (33.94%), Postives = 280/498 (56.22%), Query Frame = 1
Query:  535 DEINTIMENSFKNHISEDKIINNLISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSK-----------QKKL------------MWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHELGYCITRKELLSI-FYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRK 1953
            D  N+++   +K+ + +       ++    +F ++  D+G +   KH+I L +  P     RR     +E + ++++E+   GII E  SP+ SP+V V+KKN S IR+C+DYR LN  T    +  P  ++ L+ L G+K+FS +DL + YYQ+ +    K KTAF      + FNRMP G+  APATFQRLM   +G+++    +VYLDD+++F +TL EH   + KVF +++   LK+SP KCQF +  V ++GH++  +GI TD SKIE + ++ +P+ +  LR FLG   YYR+F++ ++K ++ L  L  S             K+L             WT+EC+ +F  LK  LT  PVL + D +KP+ L  DAS + +G +L Q+   + R +A+ SR+++  E  Y   + E L++ +        YLYG +F ++TD+  +T+++ T K +      W+  L+     ++YR G ++ +AD LSR+
Sbjct:  277 DLSNSVIPPEWKSRLRKH------LNEHSALFSRNDLDMGCSTSTKHKIRLREDKPFRERSRRIAPGDLEDLRKHLEELKAAGIIKESRSPYASPIVVVRKKNGS-IRMCVDYRTLNQRTIPDQYTTPRIEDALNCLVGSKWFSVLDLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVFDRLEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDPSKIEAVSSWPKPRTITELRSFLGFCGYYRRFVKGFSKVAQPLNQLLQSNTEVEGSDRDILAKRLRGQGWTRESIEDFWTEECDKAFDQLKYCLTHAPVLAYADATKPYTLHIDASREGLGGILYQEYNKELRPVAFISRSLSPSERNYPAHKLEFLALKWAVVDKLHEYLYGAEFEVQTDNNPLTYILTTAK-LDATGHRWLAALAHYKFSLRYRPGRDNRDADGLSRR 766          

HSP 2 Score: 97.0561 bits (240), Expect = 1.568e-19
Identity = 60/250 (24.00%), Postives = 119/250 (47.60%), Query Frame = 1
Query: 2116 DKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            D   Y+       +   ++ +P++++   ++  H +  H G +K    V + F    ++Q + +  +SC  C +RK   ++       +S S L + + +DF   ++    G   +L + DH++++      K Q   TV ++L E + + YG P+ I+ D+G+ FESKL+ +      +  + ++PYH   + Q ER  RT+ D +  TL  ++   W   +  V    NST       +P  ++FG++
Sbjct:  882 DGLVYRRAPSATDSEKWQLMLPQKHRDSVLMALHDEHGHLGYDKTLGLVRDRFYWPCMKQDVEDYCRSCLRCIQRKTLPSRAAPLSHMESHSPL-DLVCIDFLS-IEPDEGGTSNVLVVTDHYTRYAQAFPTKDQRAITVAKVLVERFFIHYGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPERFNRTLLDMLG-TLPKEKKTHWSRHIATVVHAYNSTKNGATGYSPYFLMFGRE 1128          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000035398.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:9869556:9871940:-1 gene:ENSXETG00000011182.1 transcript:ENSXETT00000035398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 281.182 bits (718), Expect = 5.006e-80
Identity = 207/727 (28.47%), Postives = 334/727 (45.94%), Query Frame = 1
Query:  745 IEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGK--KFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYH--KKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIIC------KSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSK---FISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIER------QFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGK 2862
            ++E I E L+ G I   TSP  +    V+KK+   +R C+DYR LN IT +  +P+P   EL D L GAK FS +DL  AY  + + +  + KTAF+T+   Y +  MPFG+  APA FQ  +N +  +L     +VYLDDILIFS+ L  H S +++   +++  +L     KC F+  ++ FLG+II   G   D +K+  I+ +  P+  K+++ F+G ANYYR+FI+ ++     + +L     +   W      +F++LK    S  VL+ P+   PF ++ DAS    GA+LSQ+    GK    AY S+  +  E  Y I  +ELL++      ++H L G      + TDHK + F+   K+   P+   W    S     + YR G  +  ADALSR       + ++  E   +      + +++    E I    S          +  PD            T     ++P E +   + + H  K+  H G+ K    +        + + +R+ V +C  C      TTK      C         S+ +  + +DF   L  +  G   I  +ID  SK   F+ L  + S  E  + +L  +     +G P  I  DRG  F S+  +   +   + + +SS YH   NG  ER      QF  +R+ + +   D     W D+LP  +F  N+    +  ++P   V+G+
Sbjct:   18 MKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGG-LRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENSLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKRQ-NPRQARWSLFFSRFHFVLTYRPGTKNRKADALSR---SFSPEDRLPIEREPIIPPSRIIASVLPQFAEQILLSQS----------AAPPD------------TPIGMAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLQRLVWWPTIRKDVRDFVAACTVCA-----TTKASHSRPCGLLHPLPVPSRPWTHLGMDFIVELPPSC-GNTVIWVVIDRFSKMAHFVPLRKLPSAVE--LAQLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQF--LRNHVSLCQDD-----WSDLLPWAEFAHNNARHSSTGRSPFLSVYGQ 702          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000034712.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:33567219:33572531:-1 gene:ENSXETG00000011772.1 transcript:ENSXETT00000034712.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 283.108 bits (723), Expect = 6.609e-77
Identity = 239/917 (26.06%), Postives = 401/917 (43.73%), Query Frame = 1
Query:  244 VKLVCLLDTGAKISVIDYNIFKKLG-NLNMTTSNLKLRCANDSPIEICGKTLLNXXXXXXXXXXXXE----FVVAKDINPKLIG---------GIDF----LERFGMQLQ----IENRTDEINTIMENSFKNHISEDKIINNLISTFDGIFMK-HKWDVGKTELLKHEILTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGK--KFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYH--KKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIIC------KSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSK---FISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIER------QFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGK 2862
            + +   LD+GA  + +D    KK+G +L   T ++++   +D P+     TL   ++        +E     ++    +P ++G          ID+    + R+    Q    I      + T+   SF    S  +  +++       F+  H+      +LL   +  +G    ++P          ++E I E L+ G I   TSP  +    V+KK+   +R C+DYR LN IT +  +P+P   EL D L GAK FS +DL  AY  + + +  + KTAF+T+   Y +  MPFG+  APA FQ  +N +  +L     +VYLDDILIFS+ L  H S +++   +++   L     KC F+  ++ FLG+II   G   D +K+  I+ +  P+  K+++ F+G ANYYR+FI++++     + +L     +   W      +F++LK    S  VL+ P+   PF ++ DAS    GA+LSQ+    GK    AY S+  +  E  Y I  +ELL++      ++H L G      + TDHK + F+   K+   P+   W    S  +  + YR G  +  ADALSR           I + P +   +  + +++    E I    S    +                      T     ++P E +   + + H  K+  H G+ K    +        + + +R+ V +C  C      TTK      C         S+ +  + +DF   L  +  G   I  +ID  SK   FI L  + S  E  +  L  +     +G P  I  DRG  F S+  +   +   + + +SS YH   NG  ER      QF  +R+ + +   D     W D+LP  +F  N+    +  ++P   V+G+
Sbjct:  352 IPVSAFLDSGAAGNFMDLAFAKKVGISLFPVTPSIRVFAIDDRPLSTDTITLTTGELSVQIGALHLEKMSFLIIPCPSSPVVLGLPWLRLHNPSIDWSSGQISRWSQYCQRHCLIPQPLQRV-TVSSTSFSALPSVYRDFSDVFCKKSAEFLPPHRRYDCPIDLLPGTMPPRGRTYPLSPAE-----TAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGG-LRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENFLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKDFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKRQ-NPRQARWSLFFSRFNFVLTYRPGTKNRKADALSRSFSPE--DRLPIEQEPIIPPFRI-IASVLPQFAEQILLSQSAAPSD----------------------TPIGMAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLRRLVWWPTIRKDVRDFVAACTVCA-----TTKASHSRPCGLLHPLPIPSRPWTHLGMDFIVELPPSC-GNTVIWVVIDRFSKMAHFIPLRKLPSAVE--LAHLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQF--LRNHVSLCQDD-----WSDLLPWAEFAHNNASHSSTGRSPFLSVYGQ 1220          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000042189.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460667.1:82848:87648:1 gene:ENSXETG00000017765.1 transcript:ENSXETT00000042189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 282.722 bits (722), Expect = 8.627e-77
Identity = 238/917 (25.95%), Postives = 401/917 (43.73%), Query Frame = 1
Query:  244 VKLVCLLDTGAKISVIDYNIFKKLG-NLNMTTSNLKLRCANDSPIEICGKTLLNXXXXXXXXXXXXE----FVVAKDINPKLIG---------GIDF----LERFGMQLQ----IENRTDEINTIMENSFKNHISEDKIINNLISTFDGIFMK-HKWDVGKTELLKHEILTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGK--KFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYH--KKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIIC------KSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSK---FISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIER------QFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGK 2862
            + +   LD+GA  + +D    KK+G +L   T ++++   +D P+     TL   ++        +E     ++    +P ++G          ID+    + R+    Q    I      + T+   SF    S  +  +++       F+  H+      +LL   +  +G    ++P          ++E I E L+ G I   TSP  +    V+KK+   +R C+DYR LN IT +  +P+P   EL D L GAK FS +DL  AY  + + +  + KTAF+T+   Y +  MPFG+  APA FQ  +N +  +L     +VYLDDILIFS+ L  H S +++   +++   L     KC F+  ++ FLG+II   G   D +K+  I+ +  P+  K+++ F+G ANYYR+FI++++     + +L     +   W      +F++LK    S  VL+ P+   PF ++ DAS    GA+LSQ+    GK    AY S+  +  E  Y I  +ELL++      ++H L G      + TDHK + F+   K+   P+   W    +  +  + YR G  +  ADALSR           I + P +   +  + +++    E I    S    +                      T     ++P E +   + + H  K+  H G+ K    +        + + +R+ V +C  C      TTK      C         S+ +  + +DF   L  +  G   I  +ID  SK   FI L  + S  E  +  L  +     +G P  I  DRG  F S+  +   +   + + +SS YH   NG  ER      QF  +R+ + +   D     W D+LP  +F  N+    +  ++P   V+G+
Sbjct:  352 IPVSAFLDSGAAGNFMDLAFAKKVGISLFPVTPSIRVFAIDDRPLSTDTITLTTGELSVQIGALHLEKMSFLIIPCPSSPVVLGLPWLRLHNPSIDWSSGQISRWSQYCQRHCLIPQPLQRV-TVSSTSFSALPSVYRDFSDVFCKKSAEFLPPHRRYDCPIDLLPGTMPPRGRTYPLSPAE-----TAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGG-LRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENFLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKDFSSHIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKRQ-NPRQARWSLFFTRFNFVLTYRPGTKNRKADALSRSFSPK--DRLPIEQEPIIPPFRI-IASVLPQFAEQILLSQSAAPSD----------------------TPIGMAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLRRLVWWPTIRKDVRDFVAACTVCA-----TTKASHSRPCGLLHPLPIPSRPWTHLGMDFIVELPPSC-GNTVIWVVIDRFSKMAHFIPLRKLPSAVE--LAHLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQF--LRNHVSLCQDD-----WSDLLPWAEFAHNNASHSSTGRSPFLSVYGQ 1220          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 84.3445 bits (207), Expect = 1.084e-15
Identity = 67/282 (23.76%), Postives = 126/282 (44.68%), Query Frame = 1
Query:  925 ELLDILDGAKFFSTIDLGN------AYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTK-DSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSI 1743
            EL D L GA +F+ ++L         +     +D  +    F     + Y    PF + +       +++ +L ++     I +  ++L++S +  EH   + +V  + +  N+  S  K QF R+  + LG  I   G++ +++ +  I     P   + L+  + L   YR F+EN+    + ++  L  S+     W +E + + ++LK     +PVL  P    PF L+TD +   + A L Q D   GK+   A+ SR ++  E+ Y      +L I
Sbjct:  912 ELFDQLHGAAWFTKLELLGIKESEMRHTVTHTEDTWRASFGFGLHQMRCY---RPFTMNSYSDEGNNIVHFILKDILGLFVICHGREVLVYSMSQEEHSQHVRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSE--PYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRILPI 1188          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 84.3445 bits (207), Expect = 1.084e-15
Identity = 67/282 (23.76%), Postives = 126/282 (44.68%), Query Frame = 1
Query:  925 ELLDILDGAKFFSTIDLGN------AYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTK-DSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDG--GKERVIAYGSRAMNKHELGYCITRKELLSI 1743
            EL D L GA +F+ ++L         +     +D  +    F     + Y    PF + +       +++ +L ++     I +  ++L++S +  EH   + +V  + +  N+  S  K QF R+  + LG  I   G++ +++ +  I     P   + L+  + L   YR F+EN+    + ++  L  S+     W +E + + ++LK     +PVL  P    PF L+TD +   + A L Q D   GK+   A+ SR ++  E+ Y      +L I
Sbjct:  912 ELFDQLHGAAWFTKLELLGIKESEMRHTVTHTEDTWRASFGFGLHQMRCY---RPFTMNSYSDEGNNIVHFILKDILGLFVICHGREVLVYSMSQEEHSQHVRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSE--PYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRILPI 1188          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 8.864e-100
Identity = 256/797 (32.12%), Postives = 398/797 (49.94%), Query Frame = 1
Query:  658 TELLKHEILTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSD----IRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTD-ECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLT---LMTDNIENIWQKNSKEI---ENIKENIS-----LMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYHK-----------------------------------KLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSK---LFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQD----EKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQI--TLKDKRHKSWVDILPEVQFMLN----STFQKTIRKTPAEMVF 2856
            T   KH I TK +  + +    P    +++E  IQ+ML  GII    SP+NSP+  V KK  +      RI +DYR LN IT     PIPN DE+L  L    +F+TIDL   ++Q+E+D  S  KTAFSTK   Y + RMPFG+  APATFQR MN +L  L     +VYLDDI++FS +L+EH  ++  VF+K+  ANLK+   KC+F ++E  FLGH++  DGI+ +  KIE I+ +  P   K ++ FLGL  YYRKFI N+   +K +   C  K  K+  T+ E +++FK LK  ++  P+LK PDF+K F L TDAS   +GAVLSQ DG     ++Y SR +N+HE+ Y    KELL+I + T  F+HYL G+ F + +DH+ ++++ + K     +   W   LS  D +I+Y KG  +  ADALSR + E     +    + +        +T   L T N + I+ K   +I   +  K++I+     +M  +   +Y+        + ++I  +   E I   HK                                   KL H G  K        +   + +  I+N++  C  C   K +   T  ++  K+  K     E   +D       + +G+ Y+   ID +SKF +L  +K++D    +  ++R+  +      G P+++  DR  +F S  +K + E   +E+  ++    +    IER  +TI + I+I  T  D+  K     L +++ +LN     T   T  +TPA +  
Sbjct:  194 TNQTKHTINTKHNLPLYSKYSYPQAYEQEVESQIQDMLNQGIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLNEITVGDRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEHLQSLGLVFEKLAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLTGYYRKFIPNFADIAKPMTK-CLKKNMKIDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTLTTDASDVALGAVLSQ-DG---HPLSYISRTLNEHEINYSTIEKELLAIVWATKTFRHYLLGRHFEISSDHQPLSWLYRMKDP-NSKLTRWRVKLSEFDFDIKYIKGKENCVADALSRIKLEETYLSEQTQHSAEEDNSDLIFITERPLNTFNRQVIFSKGPPDIKVTKYFKKHITQIFYDIMTREKAEQYLIDHFCGKKSALYIESDADFEVIQAAHKLAINTKYTKILRSTILLKNITTYAEFKELILTAHEKLLHPGIQKTTKLFGETYYFPNSQLLIQNIINECSICNLAKTEHRNT--DMPTKTTPKPEHCREKFMIDI-----YSSEGKHYV-SCIDIYSKFATLEEIKTKDWIECKNALMRIFNQ-----LGKPKLLKADRDGAFSSLALKRWLESEEVELQLNTT--KTGVADIERLHKTINEKIRIIKTSDDEETK-----LSKMETVLNIYNHKTKHDTTGQTPAHIFL 964          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 3.378e-93
Identity = 197/486 (40.53%), Postives = 281/486 (57.82%), Query Frame = 1
Query:  529 RTDEINTIMENSFKNHISEDKIINNLISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPI---HLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKK----NSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECE 1962
            R D +N   E +FK        +  L++ F  +  K    +  T  +KH +  T  SPI    ++ P+   H IE +E  +QEML  G+I E  SP+NSP   V KK     ++  R+ +DYR LN IT    +PIPN DE+L  L   ++F+TIDL   ++Q+E+D+ S  KTAFSTKS  Y + RMPFG+  APATFQR MN +L  L     +VYLDDI+IFS +L EH ++I+ VF K+  ANLK+   KC+F +KE  FLGHI+  DGI+ +  K++ I ++  P   K +R FLGL  YYRKFI NY   +K + +    + K      E   +F+ LK  +   P+L+ PDF K F+L TDAS   +GAVLSQ        I++ SR +N HEL Y    KELL+I + T  F+HYL G++F++ +DH+ + ++   K+    + + W   LS    +I Y KG  ++ ADALSR + E
Sbjct:  159 RLDHLN--QEETFK--------LKGLLNKFRNLEYKEGEKLTFTNTIKHVLNTTHNSPIY--SKQYPLAQTHEIE-VENQVQEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLNEITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQRCMNNILRPLLNKHCLVYLDDIIIFSTSLTEHLNSIQLVFTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFEKLKALIIRDPILQLPDFEKKFVLTTDASNLALGAVLSQNG----HPISFISRTLNDHELNYSAIEKELLAIVWATKTFRHYLLGRQFLIASDHQPLRWLHNLKEP-GAKLERWRVRLSEYQFKIDYIKGKENSVADALSRIKIE 626          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q7LHG5|YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2)

HSP 1 Score: 318.546 bits (815), Expect = 1.433e-87
Identity = 251/880 (28.52%), Postives = 417/880 (47.39%), Query Frame = 1
Query:  667 LKHEILTKGSPIVINPRRQPIHLIEKIEENI----QEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKE--RVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSR----------KECETCVQCQMIHENPKMGKLKTRLLTLMTDNI--ENI-----WQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYHKKLC---HAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKE--EIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAV-KSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFG-----------KKIYSEWFSEI---------------------VEEEKTNQPTNRE--FQIGDCVLI------KVNVRNKGDNRYMGPGVITKKIHDRSYEIKLENGSSVTR--NIEWLK 3093
            +KH+I  K  P    PR QP H+ EK E+ I    Q++L    I    SP +SP+V V KK+ +  R+C+DYR LN  T    FP+P  D LL  +  A+ F+T+DL + Y+Q+ ++   + KTAF T S +Y +  MPFG+  AP+TF R M     +L +    VYLDDILIFS++  EH+  ++ V +++K  NL +   KC+F  +E +FLG+ IG   I   + K   I++F  PK VK  + FLG+ NYYR+FI N +K ++ ++     K +   WT++ + + + LK  L ++PVL   +    + L TDAS D IGAVL + D   +   V+ Y S+++   +  Y     ELL I     HF++ L+GK F LRTDH ++   ++ K     + Q W++ L+  D  ++Y  G  +  ADA+SR          +  +T         +P    +   +  L   N+  E++     +QK  +  E  ++N SL  +  +Y+          +++ +P + ++  +  YH       H G       +S  +    L+ SI   +++C  CQ  K    +     + +  ++ +  + I +DF   L         IL ++D  SK     A  K+ D   ++ LL       +G PR I  DR     +   ++  +   I+   SS  H   +GQ ER  +T+   ++  +     ++W   LP+++F+ NST  +T+ K+P E+  G            ++ +  F+ +                     +E E  N    +     IGD VL+      K     K    Y+GP  + KKI+D +YE+ L +     R  N+++LK
Sbjct:  610 VKHDIEIK--PGARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGT-FRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVN--VYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFICDKSQ---WTEKQDKAIEKLKAALCNSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISL-LSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISRAIYTITPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETFRKNYSLEDEMIYYQ----------DRLVVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLPIAEGRWLD-ISMDFVTGLPPTSNNLNMILVVVDRFSKRAHFIATRKTLDATQLIDLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYVSTNI-QNWHVYLPQIEFVYNSTPTRTLGKSPFEIDLGYLPNTPAIKSDDEVNARSFTAVELAKHLKALTIQTKEQLEHAQIEMETNNNQRRKPLLLNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVVKKINDNAYELDLNSHKKKHRVINVQFLK 1468          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q99315|YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3)

HSP 1 Score: 318.546 bits (815), Expect = 1.974e-87
Identity = 252/882 (28.57%), Postives = 416/882 (47.17%), Query Frame = 1
Query:  667 LKHEILTKGSPIVINPRRQPIHLIEKIEENI----QEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKE--RVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSR----------KECETCVQCQMIHENPKMGKLKTRLLTLMTDNI--ENI-----WQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYHKKLC---HAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKE--EIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAV-KSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFG-----------KKIYSEWFSEI---------------------VEEEKTNQPTNRE--FQIGDCVLI------KVNVRNKGDNRYMGPGVITKKIHDRSYEIKLENGSSVTR--NIEWLKVF 3099
            +KH+I  K  P    PR QP H+ EK E+ I    Q++L    I    SP +SP+V V KK+ +  R+C+DYR LN  T    FP+P  D LL  +  A+ F+T+DL + Y+Q+ ++   + KTAF T S +Y +  MPFG+  AP+TF R M     +L +    VYLDDILIFS++  EH+  ++ V +++K  NL +   KC+F  +E +FLG+ IG   I   + K   I++F  PK VK  + FLG+ NYYR+FI N +K ++ ++     K +   WT++ + +   LK  L ++PVL   +    + L TDAS D IGAVL + D   +   V+ Y S+++   +  Y     ELL I     HF++ L+GK F LRTDH ++   ++ K     + Q W++ L+  D  ++Y  G  +  ADA+SR          +  +T         +P    +   +  L   N+  E++     +QK  +  E  ++N SL  +  +Y+          +++ +P + ++  +  YH       H G       +S  +    L+ SI   +++C  CQ  K    +     + +  ++ +  + I +DF   L         IL ++D  SK     A  K+ D   ++ LL       +G PR I  DR     +   ++  +   I+   SS  H   +GQ ER  +T+   ++        ++W   LP+++F+ NST  +T+ K+P E+  G            ++ +  F+ +                     +E E  N    +     IGD VL+      K     K    Y+GP  + KKI+D +YE+ L +     R  N+++LK F
Sbjct:  584 VKHDIEIK--PGARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGT-FRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVN--VYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFICDKSQ---WTEKQDKAIDKLKDALCNSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISL-LSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISRAVYTITPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETFRKNYSLEDEMIYYQ----------DRLVVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLPIAEGRWLD-ISMDFVTGLPPTSNNLNMILVVVDRFSKRAHFIATRKTLDATQLIDLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLR-AYASTNIQNWHVYLPQIEFVYNSTPTRTLGKSPFEIDLGYLPNTPAIKSDDEVNARSFTAVELAKHLKALTIQTKEQLEHAQIEMETNNNQRRKPLLLNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVVKKINDNAYELDLNSHKKKHRVINVQFLKKF 1444          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P0CT39|TF26_SCHPO (Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-6 PE=3 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 6.617e-87
Identity = 245/836 (29.31%), Postives = 400/836 (47.85%), Query Frame = 1
Query:  724 PIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQK-DGGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYG--KKFILRTDHK-AITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCV--------QCQMIHENPKMGKLKTRLLTLMTDNIE--NIWQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENK--SEFIIEYHK--KLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEI-ICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKF-ISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMV--------------FGKKIYS------EWFSEIVEEEKTNQPTNR-----------EFQIGDCVLIK------VNVRNKGDNRYMGPGVITKKIHDRSYEIKLENG 3060
            P   ++ + + I + LK GII E  +    P++ V KK  + +R+ +DY+ LN   +  I+P+P  ++LL  + G+  F+ +DL +AY+ + +    + K AF      + +  MP+GI+ APA FQ  +N +LGE   +  + Y+DDILI SK+ +EH   ++ V QK+K ANL I+ AKC+F + +VKF+G+ I E G    +  I+ +  +++PK  K LR FLG  NY RKFI   ++ +  L  L   K  +  WT     + +N+K  L S PVL+  DFSK  +L+TDAS   +GAVLSQK D  K   + Y S  M+K +L Y ++ KE+L+I     H++HYL    + F + TDH+  I  +    +    +   W   L   + EI YR G  ++ ADALSR   ET              +++       K +++T  T++ +  N+     K +E   ENI L          +G+++ + ++I +P + +     I +YH+  KL H G   +   +   F  K + + I+  VQ+C  CQ  K    K    +       + +E++ +DF   L  +  G   +  ++D  SK  I +   KS   +   R+  +  I  +G P+ I  D    F S+  KDFA  +N  + +S PY    +GQ ER  +T+   ++       + +WVD +  VQ   N+      + TP E+V              F  K         + F  + E   TN    +           EFQ GD V++K      ++  NK    + GP  + +K    +YE+ L + 
Sbjct:  421 PPGKMQAMNDEINQGLKSGIIRESKAINACPVMFVPKKEGT-LRMVVDYKPLNKYVKPNIYPLPLIEQLLAKIQGSTIFTKLDLKSAYHLIRVRKGDEHKLAFRCPRGVFEYLVMPYGISTAPAHFQYFINTILGEAKESHVVCYMDDILIHSKSESEHVKHVKDVLQKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSVNYLRKFIPKTSQLTHPLNNLL-KKDVRWKWTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQKHDDDKYYPVGYYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEPENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIVDETEPIPKDSEDNSINFVNQISITDDFKNQVVTEYTNDTKLLNLLNNEDKRVE---ENIQLK---------DGLLINSKDQILLPNDTQLTRTIIKKYHEEGKLIHPGIELLTNIILRRFTWKGIRKQIQEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFITALPES-SGYNALFVVVDRFSKMAILVPCTKSITAEQTARMFDQRVIAYFGNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCSTHPN-TWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSPALSPLELPSFSDKTDENSQETIQVFQTVKEHLNTNNIKMKKYFDMKIQEIEEFQPGDLVMVKRTKTGFLHKSNKLAPSFAGPFYVLQKSGPNNYELDLPDS 1240          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A5S6QWV2 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 536.569 bits (1381), Expect = 1.291e-166
Identity = 306/938 (32.62%), Postives = 496/938 (52.88%), Query Frame = 1
Query:  262 LDTGAKISVIDYNIFKKLGNLNM-TTSNLKLRCANDSPIEICGKTLLNXXXXXXXXXXXXEFVVAKDINPKLIGGIDFLERFGMQLQIENRTDEINTIMENSFKNHISEDKIINNLISTFD----------------------------GIFMKHKW-------DVGKTELLKHEILTKGS-PIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETC----VQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKENI------SLMPD------KTFYKYVNGVIMTNNN--KIW-------------IPEENKSEFIIEYHKKLC--HAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            +DTGA +S++ + +F  +   ++    N++L  A    + + G + +N+ + K         V      P LIG  DFL +    +   + T ++N        + +SE  I    ++T D                             +F K+K        D+G+T +++H I T  + PI + PRR P      I++ +  ML+ G+I   +SPW+ P+V  KKKN S  R C+DYR LN+ TE+ + P+P  D+ LDIL G+++FST+DL + Y+QVE++   + KTAFST +  Y F  MPFG+  APATFQRLM  VL  L W   +VYLDDI+IF +T  E    +E+V  +++ A LK+ P+KC+   +EV FLGH++   GI TD  K  T++N+E P+C   LR F+GLA+YYRKF++N+   +  L  L   K K+  W D+CE +F+ +K +L + P+LKFPDF+K F+LD DAS D +GAVLSQ     E  IAY SRA+ K E  YC TR+ELL++ + + HF+ YLYG +F +RTDH  + ++   ++    Q   W+  L+  DMEI +R G  H+NADALSR+ C  C    +        P          T   D + N  Q    +I+ +KE I      S  P+      + F+   N +I+ N    ++W             +P   + E + E H      H G  +        F    + + I+   ++C+ C  RK  + ++++ +        F+ + +DF GPL     G+RY+L ++D+ +K+   +A ++ + KTV ++L + +I ++G P  ++ D+G+SFE+ L+ +  +   I+  +++ YH  +NG +ER  RT+ D + + L  +  ++W ++LP   F  N++   T   +P   +FG++
Sbjct:   13 IDTGAAVSLMSHELFNDIQPADLLPIQNVRLITAAGDELRVVGTSTVNISIGKSPPTSHTLLVAHSLTCPCLIGA-DFLRQHKCIIDFTSGTLQMNGYEVKLKTDRLSEHSIATASLATEDLRTYEEIIDSMCASGATENDYETREQLKKLFWKYKGVLPTTDDDLGRTSVVRHRIRTGNAKPIKMGPRRMPHRDRPIIQDLVDRMLQQGVIERASSPWSFPVVLAKKKNGS-FRFCVDYRKLNDRTEKDVQPLPRIDDALDILSGSRWFSTLDLASGYWQVEVEPEDRPKTAFSTPTGSYQFRVMPFGLCNAPATFQRLMEQVLEGLQWKTCLVYLDDIIIFGRTTTEQMERLEEVLNRLQAAGLKVKPSKCKLMTQEVVFLGHVVSGKGISTDPLKCATVENWEPPRCTNELRQFIGLASYYRKFVKNFASIAAPLHRLL-QKDKRWSWDDDCERAFQEMKRRLLTAPILKFPDFNKTFVLDVDASNDGLGAVLSQVHDDGEHPIAYASRALTKPERRYCATRRELLALVWASKHFRPYLYGTRFKVRTDHNCLIWLNNFREP-EGQIARWLERLAEFDMEICHRPGKLHDNADALSRQTCGQCGKAVIPVAYAQAEP----------TQQQDQM-NTAQNQDGDIKTLKEWIAQDCWPSSCPEGVSRELRIFWGQRNALILDNGTLFRLWETPNSQRPLKLLVVPSHMRREILEELHDAPAGGHLGERRTLEKARCRFYWPGMAKDIKLWCRTCDACACRKGPSRRSRQPLQSIQTGYPFQRVGIDFLGPLPKTTTGKRYVLVVVDYFTKWTEAYATENMEAKTVAKVLVDNFITRFGPPESVHSDQGRSFEATLLAETFQLLGIKKTHTTSYHPQSNGLVERFNRTLLDTLAL-LSKRSPETWDEMLPWTTFAYNTSSHDTTGTSPFLALFGRE 934          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A5J4NFG7 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0001986 PE=4 SV=1)

HSP 1 Score: 535.413 bits (1378), Expect = 2.598e-162
Identity = 317/929 (34.12%), Postives = 492/929 (52.96%), Query Frame = 1
Query:  220 SVTVMINNVKLVCLLDTGAKISVIDYNIFKKLGNLNMTTSN-LKLRCANDSPIEICGKTLLNXXXXXXXXXXXXEFVVAKDINPKLIGGIDFLERFGMQLQIENRTDEINTIMENSFK-----------------------NHISEDKIIN-------NLISTFDGIFMKHKWDVGKTELLKHEILTKG-SPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKP---FILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKENISLMPDKTF-----------YKYVNGVIM---TNNNKIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFG 2859
            SV   IN   ++ L+DTGA  S+I   +  +L       +N ++L  AN + +++   + L+  V   S   + +F+    +  K I G+DFL  FG  L +++    I + + +  K                       NH+  D+ +        +L+S F  +F       G+T  ++HEI T    PI   PRR P+H  + ++  I +ML+  II    SPW+SP+V V+KKN + +R+C+DYR LN IT R  FPIP  D  LD L GA++FS +DL + Y+QVE+  + + KTAF   S  Y F  MPFG+A APATFQRLM   L  L  +  ++YLDDI+++ +T+ EH + +  V ++++   LK+  +KC F ++EV FLGH+I  DGI+TD +K E IKN+ RP+ V+++R FLGLA+YYRKFI+ + + +  L  L   K +   W+DEC  SF+ LK KLT+ P+L FPD S     F+LDTDAS   IGAVLSQ+    E VIAY SR ++K E  Y  TR+ELL++ +F  HF+ YL GK F +RTDH+++ ++   +     Q   W   L   D   +YR+G  H NADALSR    + V   ++++   +         L    I NI+++ +    + K +   M  K F            + ++GV+     +  K+  P+   +  + + H +L HAG  K +  +   +    +   +     SCE C   K  T   +  +         + + VD  GPL +  +G RYIL ++D+ +K+     ++ QD  TV   +  EWI +YGAP +++ D+G +FES+L+K+      I+   ++PYH   NG +ER  RTI+  +Q  L+  +   W ++LP       ++   T R TPA + FG
Sbjct:  281 SVRGRINKEPILFLVDTGASCSLIHSRLAARLTKHRTAPANPVRLLAANGTEMQVA--SFLSASVQLGSFSGEHQFLACPHLQWKAILGMDFLGHFGGVLNLKDSQMTIGSCLVDLEKGRPADACSAVDSKAEVPFVSEVLNHLKSDESLLPMKTQLIHLLSEFKDVFALGNDAPGRTNWVQHEIDTSDHRPIRHAPRRLPVHYEQHLDTMITDMLEKRIIRPSVSPWSSPIVLVRKKNGT-LRLCVDYRKLNEITARDSFPIPRIDATLDALHGAQWFSALDLASGYWQVEVRPSDRGKTAFVVPSGLYEFETMPFGLANAPATFQRLMQKALQGLVPSQCLIYLDDIIVYGRTVAEHNNNLRDVLERLRSTGLKLKGSKCHFLQREVTFLGHVIAADGIKTDPAKSEQIKNWPRPQTVENVRSFLGLASYYRKFIQGFAEIATPLHRLT-EKGRPFTWSDECSASFETLKDKLTTPPILAFPDVSDEAGKFVLDTDASNVSIGAVLSQETPEGEVVIAYASRCLDKCERNYSTTRRELLALIHFLRHFRPYLLGKPFKVRTDHQSLQWLRNFRDP-EGQVARWQERLQEYDFVCEYRRGLRHGNADALSRVTVPSEVNTTLLYDADTVWAED----QLSDSYIANIYKRQAD--GSSKPSAIEMRQKPFDERALWGHWKDLRLIDGVLYRMDQSGPKLITPKLKVAAVLQKIHTELGHAGQLKTEAAIRQRYWWPGIHADVVTQCSSCETCSAIKNHTPGPRAPLEPVVTEHPGQRVGVDIMGPLPVTRRGNRYILVLVDYFTKWSEAVPIERQDACTVAAAIINEWIARYGAPTMLHSDQGAAFESQLLKETCHLLGIKKTRTTPYHPQGNGLVERTNRTIKALLQSFLERHQADRWDELLPRCMLAYRASIHTTTRYTPAYLTFG 1198          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A5S6PYL2 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 530.791 bits (1366), Expect = 2.972e-162
Identity = 325/1026 (31.68%), Postives = 523/1026 (50.97%), Query Frame = 1
Query:  262 LDTGAKISVIDYNIFKKLGNLNMT-TSNLKLRCANDSPIEICGKTLLNXXXXXXXXXXXXEFVVAKDINPKLIGGIDFLERFG----------------MQLQIENRTDEINTIMENSFKNHISEDKIINNL-----------------ISTFDGIFMKHKWDVGKTELLKHEILTKGS-PIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQT--WINHLSGLDMEIQYRKGDNHNNADALSRKECETC------VQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKN----SKEIENIKENISLMPDKTFYKYV-NGVIMTNNNK---------IWIPEENKSEFIIEYHKKL--CHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKKIY--------------SEWFSEIVEEEKTN------------------QPT-------NREFQIGDCVLIKVNVRNKGDNRYMGPGVITKKIHDRSYEI 3045
            +DTGA +S++DY +   L    +    N+++  A  S ++I G   ++V +      K    V      P LIG  DFL R G                ++L+ E+  D    ++  + +   S D++I+ +                 +S +  +      D+G+T +++HEI T  + PI I PRR P      +E  +  ML+ G+I + + PW+ P+V   KK+ S +R C+DYR LN +TE+ + P+P  D+ LD L G+ +FST+DL + Y+QVE++   + KTAFST S  Y F  MPFG+  APATFQRLM  VL  L W   +VYLDDI++F++T  E    +++V  +++ A LK+ P+KC+    EV FLGH I  +GI TD SK   ++ +  P+C+  LR FLGLA+YYRKF++N+   +  L  L   K  K +W  +CE +F+ LK  L S PVL+ PDF+K FILD DAS + +GAVLSQ     E  IAY SR ++K E  YC TR+ELL++ + T HF+ YLYG +FI RTDH  + ++   ++   P+ QT  W+  L+  DMEI++R G  H+NADALSR  C  C      + C  +   P    ++    T     +   W +N    S+  E    N+ ++  +    ++ +G+++   +          I +P   +++ +   H  +   H G  +      + F    + + +    +SC+ C +RK    + +  +        F+ + +DF GPL     G+RY+L + D+ +K+   +A ++ +  TV +LL + +I ++G P  ++ D+G++FE+ LM +     +++   ++PYH  +NG +ER  RT+ D +    KD   + W D+LP   F  N++  +T   +P   +FG++                +E  +  V+E + N                  Q T          FQ GD V + V  + K   R+ GP VI KKI D  Y +
Sbjct:   27 IDTGAAVSLMDYKLLGILQPARLLDVRNIRVLTATGSEMKIAGTCTVDVSIGGAPAKKHTVLVAHGLTCPCLIGA-DFLRRHGCVIDFTTGILQIGSYDVELKSESGNDRTIALIGPAQRELGSCDEVIDAMCSKSTAPQEVLVPLRKTLSKYRDVISMTDDDLGRTSVVRHEIRTGNAKPIKIGPRRTPYRHRSTMETLVNRMLQQGVIEQASGPWSFPVVLAPKKDGS-LRFCVDYRKLNEVTEKNVQPLPRIDDALDALAGSSWFSTLDLASGYWQVEVEARDRPKTAFSTPSGLYQFRVMPFGLCNAPATFQRLMEKVLEGLQWRTCLVYLDDIIVFARTPIEQMQRLDEVLNRLQKAGLKLKPSKCKIMTTEVVFLGHTISANGIATDASKCAAVERWHPPRCLNELRQFLGLASYYRKFVKNFATIAAPLHRLL-RKDSKWVWNQDCEQAFQQLKRNLLSAPVLRLPDFTKTFILDVDASGEGLGAVLSQCFADGEHPIAYASRTLSKPERRYCATRRELLALVWGTKHFRPYLYGARFIARTDHNCLVWLNSFRE---PEGQTARWLERLAEFDMEIRHRPGRLHDNADALSRPLCPQCGKQLVSIDCAQVTLPPPQNDMRDAQDTDDEIKVLKDWIRNGNWPSRCPEGTSRNLRILWGQKDALFLDDGILLRRWDDCSRQQPRRLIVVPSRMQAQVLRGLHDGVGGGHFGKQRTLAKARSRFYWPGMAKDVDLWCKSCDVCARRK-GYRRNRLPLQPLLAGYPFQRVGIDFLGPLPTTTNGKRYVLAVCDYFTKWTEAYATENMEATTVAKLLIDNYITRFGPPESVHSDQGRNFEALLMTELFRLLDVKKTRTTPYHPQSNGLVERFNRTLLDTLAALAKDFPDR-WDDMLPWATFAYNTSNHETTGISPFLALFGREARLPIDLQYDLPASDNTESLTTYVQELRKNLEHVHAAIRQHLHAKQQGQKTYYDRRRHGNPFQNGDRVWLAVPQKGKISARWDGPFVIKKKITDHVYRL 1044          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A5J4NKR9 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0004666 PE=4 SV=1)

HSP 1 Score: 535.413 bits (1378), Expect = 6.010e-162
Identity = 317/929 (34.12%), Postives = 492/929 (52.96%), Query Frame = 1
Query:  220 SVTVMINNVKLVCLLDTGAKISVIDYNIFKKLGNLNMTTSN-LKLRCANDSPIEICGKTLLNXXXXXXXXXXXXEFVVAKDINPKLIGGIDFLERFGMQLQIENRTDEINTIMENSFK-----------------------NHISEDKIIN-------NLISTFDGIFMKHKWDVGKTELLKHEILTKG-SPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKP---FILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKENISLMPDKTF-----------YKYVNGVIM---TNNNKIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFG 2859
            SV   IN   ++ L+DTGA  S+I   +  +L       +N ++L  AN + +++   + L+  V   S   + +F+    +  K I G+DFL  FG  L +++    I + + +  K                       NH+  D+ +        +L+S F  +F       G+T  ++HEI T    PI   PRR P+H  + ++  I +ML+  II    SPW+SP+V V+KKN + +R+C+DYR LN IT R  FPIP  D  LD L GA++FS +DL + Y+QVE+  + + KTAF   S  Y F  MPFG+A APATFQRLM   L  L  +  ++YLDDI+++ +T+ EH + +  V ++++   LK+  +KC F ++EV FLGH+I  DGI+TD +K E IKN+ RP+ V+++R FLGLA+YYRKFI+ + + +  L  L   K +   W+DEC  SF+ LK KLT+ P+L FPD S     F+LDTDAS   IGAVLSQ+    E VIAY SR ++K E  Y  TR+ELL++ +F  HF+ YL GK F +RTDH+++ ++   +     Q   W   L   D   +YR+G  H NADALSR    + V   ++++   +         L    I NI+++ +    + K +   M  K F            + ++GV+     +  K+  P+   +  + + H +L HAG  K +  +   +    +   +     SCE C   K  T   +  +         + + VD  GPL +  +G RYIL ++D+ +K+     ++ QD  TV   +  EWI +YGAP +++ D+G +FES+L+K+      I+   ++PYH   NG +ER  RTI+  +Q  L+  +   W ++LP       ++   T R TPA + FG
Sbjct:  281 SVRGRINKEPILFLVDTGASCSLIHSRLAARLTKHRTAPANPVRLLAANGTEMQVA--SFLSASVQLGSFSGEHQFLACPHLQWKAILGMDFLGHFGGVLNLKDSQMTIGSCLVDLEKGRPADACSAVDSKAEVPFVSEVLNHLKSDESLLPMKTQLIHLLSEFKDVFALGNDAPGRTNWVQHEIDTSDHRPIRHAPRRLPVHYEQHLDTMITDMLEKRIIRPSVSPWSSPIVLVRKKNGT-LRLCVDYRKLNEITARDSFPIPRIDATLDALHGAQWFSALDLASGYWQVEVRPSDRGKTAFVVPSGLYEFETMPFGLANAPATFQRLMQKALQGLVPSQCLIYLDDIIVYGRTVAEHNNNLRDVLERLRSTGLKLKGSKCHFLQREVTFLGHVIAADGIKTDPAKSEQIKNWPRPQTVENVRSFLGLASYYRKFIQGFAEIATPLHRLT-EKGRPFTWSDECSASFETLKDKLTTPPILAFPDVSDEAGKFVLDTDASNVSIGAVLSQETPEGEVVIAYASRCLDKCERNYSTTRRELLALIHFLRHFRPYLLGKPFKVRTDHQSLQWLRNFRDP-EGQVARWQERLQEYDFVCEYRRGLRHGNADALSRVTVPSEVNTTLLYDADTVWAED----QLSDSYIANIYKRQAD--GSSKPSAIEMRQKPFDERALWGHWKDLRLIDGVLYRMDQSGPKLITPKLKVAAVLQKIHTELGHAGQLKTEAAIRQRYWWPGIHADVVTQCSSCETCSAIKNHTPGPRAPLEPVVTEHPGQRVGVDIMGPLPVTRRGNRYILVLVDYFTKWSEAVPIERQDACTVAAAIINEWIARYGAPTMLHSDQGAAFESQLLKETCHLLGIKKTRTTPYHPQGNGLVERTNRTIKALLQSFLERHQADRWDELLPRCMLAYRASIHTTTRYTPAYLTFG 1198          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A4Y2TRM5 (Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ventricosus OX=182803 GN=TY3B-I_784 PE=4 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 1.824e-161
Identity = 329/962 (34.20%), Postives = 492/962 (51.14%), Query Frame = 1
Query:  139 LTSNELNVLNRDKRNDIIVYDKMQGRPSVTV--MINNVKLVCLLDTGAKISVIDYNIFKKLGNLNMTTSNLKLRCA-NDSPIEICGKTLLNXXXXXXXXXXXXEF-VVAKDINPKLIGGIDFLERFGMQLQIENRTDEIN------TIMENSFKNHISEDKIINNLISTFDGIFMKHKWDVGKTELLKHEILTKGSPIVIN-PRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKEC-ETCVQCQMIH------------------------------ENPKMGKLKTRLLTLMTDNIEN--IWQKNSKEIENIKENISL-----MPDKTFY-KYVNGVIMTNNNKIWIPEENKSEFIIEYHKKLC--HAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKKI 2868
            LT   L  LN+     + V     GR  + +   I  +  + L+DTGA ++            L +  ++ K R A  D P ++C K +L          + +   V+  D  PK+I     +      + I  R  E +      +I+EN    +  +   +  L+  F  +F     DVG+  + +H I T   P +   PRR P+   E+ E  ++EM+  GII E + PW SP+V VKKK+ S  R C+DYR LN IT +  +P+P  D+ LD L+G+++FST+DL + Y+QVE+    K KTAF+T    + F  MPFG+  APATF+RLM  VL  L     +VYLDDI+I  +T  EH + I KVFQ+++ ANLK+SP KC+F RKE  +LGHII  DG++TD  K + + ++ RP+ V  LR FLGL  YYR+F+ N++  ++ L  L  ++     WT+ECE SF +LK  L ++PVL +P   K FILDTDAS + IGAVLSQK G +E VIAY S+++ K E  YC+TRKELL+I     HF HYLYG+KF+LRTDH ++ +++  ++    Q   WI  L   D+EIQ+RKG +H NADALSR+ C E+C  C                                  E+P +  +  R L     N E+   WQ+ + E    K   +L     + D   Y K+ +    ++  ++ +P+    E + E H      H G  K        F    L   +    + C  C  RK   T+TK  +   +    FE + +D  GPL +  KG RY+L ++D+ +K+     +  Q+  TV   L   WI +YG P I++ D+G +F S L  +  +   I    ++  H  ++G +ER  RTI + + + +  K    W   LP       S   +    TPA+M+FG+ +
Sbjct:    5 LTGRRLPFLNKAPEEGLKVSALCGGRNGLYLEGSICGIPCLMLVDTGANVT------------LGVPEASGKFRYAVTDFPSQVCQKGVLVAATLVDLKKEAIPVRVLNLDHKPKIIDKGAVIATCEPVVDIVARPQEFSESLRLPSILENLEGLNEEQRTAVKELLQEFQNLFSTSDSDVGRCNMTQHRINTGNHPPIKQYPRRLPLAKKEEAERLVKEMVDNGIIEESSGPWASPIVLVKKKDGS-TRFCVDYRKLNEITIKDSYPLPRIDDTLDALNGSQWFSTLDLKSGYWQVEIQPEDKEKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRGLTSEACLVYLDDIIIVGRTFQEHLNNIRKVFQRLQKANLKLSPKKCRFFRKEFSYLGHIISADGVKTDPEKTKAVVDWPRPETVHDLRSFLGLCTYYRRFVRNFSAIARPLHKLTEARS-NFNWTEECEKSFNSLKQALITSPVLTYPRTDKEFILDTDASNEGIGAVLSQKIGNEECVIAYFSKSLGKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFREP-EGQIARWIQRLQEYDIEIQHRKGTSHGNADALSRRPCKESCKHCTNAEKKFGMETDISMKALTTEDAWSSSEVQKAQLEDPAIRPILERKL-----NSEDRPSWQEIAPESPATKRYWALWDSLHLKDGVLYRKWESDDGSSSRWQLILPKSRIQEVLRETHDSASGGHFGVMKTLSKTRERFYWDRLRADVEKWCRECHACGARKGPKTRTKGRLQRYNVGAPFERMALDILGPLPVTTKGNRYVLVLMDYFTKWPEAIPIPDQEASTVAEELVRAWISRYGVPTILHSDQGTNFNSALFTELCKLLGILKTRTTALHPESDGMVERFNRTILNHLSLFV-SKNQTDWDTHLPLFLLAYRSADHEATGCTPADMLFGRTL 945          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000045469.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000976.1:426503:430633:1 gene:ENSAMXG00000030479.1 transcript:ENSAMXT00000045469.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 462.996 bits (1190), Expect = 4.865e-139
Identity = 270/818 (33.01%), Postives = 444/818 (54.28%), Query Frame = 1
Query:  604 LISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDS----KVLEALCGSKQKKLM---------WTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHEL---GYCITRKELLSI-FYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECET---CVQCQMIHENPKMG----KLKTRLLTLMTDNIENI------------------------WQKN----SKEIENIKENISLMPDKTFYKYV--NGVIMTNNN---------KIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            L+     +F +H  D+G T L++H I L    P+    RR P    + ++ +IQE++++ ++   +SP+ SP+V V+KK+ S IR+C+DYR LN  T +  FP+P  +E LD L G+K+FST+DL + Y QV + +  K KTAF T    + FNRMPFG+  AP+TFQRLM  + G+ +++  ++YLDDI+IFS  L +H   ++ V  +++  NLK+   KC F +  V +LGH+I E G+ TD  KI  + +++RP  VK +R FLG A+YYR+F+E +   +    K++ AL GSK++            W + CETSF+ LK +L   PVL F DF++PFI++ DAS   +GAVLSQ+  GK R IA+ SR +   E     Y   + ELL++ +  T  F+ YL G +F + TD+  ++++   K A     Q W + L+  + E++YR G ++ NADALSR   +T    V  + I   P++     +  +R   +++  ++ I                        W++     ++E+ N +E +  +  + + + V   GV+  +           ++ +P+  ++E ++  H +  H G  +    V        + Q I+     CE C   K    K +  +     ++  E + +DF   L+ A  G+  +L + D  SKF   +AV  Q   TVVR+L E+W   YG P+ I+ D+G+SFE +L+K   E + IE + ++PYH   NGQ ER  RT+ D ++ TL  ++ + W  +LP + F  N+T  ++ + +P E++FG+K
Sbjct:  324 LLRRHQNLFSEHAGDLGCTTLVQHSIPLLDSVPVRQRYRRLPPSQYDLVKAHIQELVEHQVVRPSSSPYASPIVVVQKKDGS-IRLCVDYRQLNAKTRKDAFPLPRIEESLDALSGSKWFSTLDLASGYNQVPVLEKDKEKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERIFGDQSFHTLLLYLDDIVIFSSDLQQHLQRLDMVLSRLQQHNLKLKLEKCHFFQTRVSYLGHVISESGVETDPEKIRAVVDWKRPTTVKEVRSFLGFASYYRRFVEGFAALAAPLHKLVGALQGSKKQPRSKMHSIVIPHWDEVCETSFRALKDRLVRAPVLGFADFTRPFIVEIDASHTGLGAVLSQEQEGKRRPIAFASRGLRPSERNMSNYSSMKLELLALKWAVTEKFREYLLGTQFTVYTDNNPLSYLQSAKLAAVE--QRWASQLALFNYELKYRPGTSNGNADALSRLPADTDQSSVGVRGISVPPEVPLADKETASRSQVVISSTVDAIPSRSSVDLQILQAADPLIAAFSVYWRRGQAPTARELRNEREGVKEL-VRQWQRIVERQGVLYRSVQLPPAKHTVFQLVLPKALQTEVLLALHDQHGHQGMERTTDLVRQRCYWPKMWQDIKKWCTECERCSIAKAMHPKVRTFMGSLLATRPLEILAMDFTV-LERASNGQENVLVLTDVFSKFTQAYAVADQKASTVVRVLVEKWFYVYGVPKRIHSDQGRSFEGELLKHLCETYGIEKSRTTPYHPEGNGQCERFNRTLHDLLR-TLPPEKKRKWPQLLPHLLFAYNTTIHQSTQYSPYELLFGQK 1135          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000041682.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002320.1:24977:29035:1 gene:ENSAMXG00000038531.1 transcript:ENSAMXT00000041682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 459.914 bits (1182), Expect = 4.224e-138
Identity = 270/816 (33.09%), Postives = 433/816 (53.06%), Query Frame = 1
Query:  583 EDKIINNLISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDS----KVLEALCGSKQK------KLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHEL---GYCITRKELLSI-FYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHEN------P-KMGKLKTRLLTL-------------------MTDNIENIWQKN-----SKEIENIKENISLMPDKTFYKYVNGVI--MTNNN-------KIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            + ++  +L+  +  +F + + ++G T L++HEI L   +P+    RR P    + ++ +IQE+L   +I    SP++SP+V V+K++ + IR+C+DYR LN+ T +  +P+P  +E LD L GA+FFST+DL + Y QV + +  K KTAF T    + FNRMPFG+  AP+TFQRLM  + G+  +   ++YLDDI+IFS T + H   +E V ++++  NLK+  +KC F + +VK+LGH+I   G+ TD  KI+ +  +ERP+ V  LR FLG A+YYR+F+E + K +    +++  L G K++      +  W+D CE +F+ LKLKL S PVL + DFSKPFIL+ DAS   +GAVLSQ   G  R IAY SR +   E     Y   + ELL + +  T  F+ YL G +F + TD+  ++++   K       Q W++ L+  +  I+YR G ++ NADALSR     C   Q   E       P ++G  K  + T+                   +       W +       +  +  KE + L+      +  +GV+  +T          ++ +PE  + E +   H    H GA +    V        + + I    + C  C   K+   K +  +   S SK  E I +DF   +  A  G   +L I D  SKF      + Q   TV  +L E+W   YG P+ I+ D+G++FES L+K   + ++++ + ++PYH   NGQ ER  RT+ D ++ TL  ++ + W   LP++ F  N+T  +T   +P E++FG++
Sbjct:  285 QSQLGKDLLQRYSSVFSQDEGELGCTHLIEHEIPLIDDTPVKQRYRRLPPSQYDLVKGHIQELLDRKVIRASCSPYSSPVVVVQKRDGT-IRLCVDYRQLNSKTRKDAYPLPRIEESLDALGGARFFSTLDLASGYNQVPMAEHDKSKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERIFGDERFQSLLLYLDDIVIFSSTFDLHLQRLEVVLKRLQQNNLKLKLSKCHFFQSQVKYLGHVISSAGVATDPEKIKAVSEWERPQTVTQLRSFLGFASYYRRFVEGFAKHASPLHRLVAVLQGGKRRVKTKPVEGHWSDACEEAFETLKLKLVSAPVLGYADFSKPFILEIDASHGGLGAVLSQDQEGGRRPIAYASRGLRDSERNMSNYSSMKLELLGLKWAVTEKFREYLLGAQFTVYTDNNPLSYLQTAKLGAVE--QRWVSQLALFNFNIKYRPGLSNRNADALSR--LPACPTPQSFQETVSGISIPLQVGATKATISTIDAVPLRPKADLQRLQSADPVIGPFLQYWHRQKFPTAGERAQESKEVLELVRQWNKLRECDGVLYRLTRTPDGVEEFLQLVLPECLQKEVLTALHDNHGHQGAERTASLVRQRCFWPHMWKKIERWCKECSRCVVAKMGQPKIRTFMGNLSASKPLEIIAIDFTL-MDRASDGRENVLVITDVFSKFTQAFPTQDQRASTVAHILVEKWFYVYGVPQRIHSDQGRNFESDLLKSLCKIYDVKKSRTTPYHPQGNGQCERFNRTMHDLLR-TLPSEQKRRWPKYLPQLLFAYNTTVHQTTAHSPYELMFGRQ 1093          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000054230.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:19483082:19487098:1 gene:ENSAMXG00000038338.1 transcript:ENSAMXT00000054230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 452.981 bits (1164), Expect = 1.203e-135
Identity = 267/820 (32.56%), Postives = 432/820 (52.68%), Query Frame = 1
Query:  583 EDKIINNLISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDS----KVLEALCGSKQKK-------LMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHEL---GYCITRKELLSI-FYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKE----------CETCVQCQMIHENPKMGKLKTRLLTLMTDNIENI----------------WQKNSKEIENIKENIS-------------LMPDKTFYKYV---NGVIMTNNNKIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICK-SDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            E  ++ +L+  ++ +F  H  D+G T L++HEI L    P+    RR P    E ++ +I ++L+  ++ E +SP+ SP+V VKKK+ S +R+C+DYR LN+ T +  FP+P  +E LD L GA++FST+DL + Y QV + +  K KTAF T    + +NRMPFG+  AP+TFQRLM  + G+  +   ++YLDDI++FS ++++H   +E V  +++   LK   +KC F ++EV +LGH+I   G+ TD +KIE +  ++RP+ V  LR FLG A+YYR+F+E + + +    K++ AL GSK KK       + WT +CE SF+ LK +L S PVL + DFS PFIL+ DAS+  +GAVLSQ+  G  R +AY SR +   E     Y   + E L++ +  T  F+ YL G K ++ TD+  ++++   K  +      W   L+  D EI+YR G ++ NADALSR+             T V   +   +P +   +  +  L   +  +I                W+K  +     K  +S             +  D   Y+ V   +G     + ++ +P   K E + + H+   H G  +    V        +   I+   + CE CQ  K D        +     S+  E + +DF   L+ +  G   +L + D  SK+      + Q   TV ++L  EW  K+G P  I+ D+G+SFES L++ F   + +E + ++PYH + NGQ ER  RT+ + ++ TL   R + W   LP+V F  N+T  +   ++P  ++FG++
Sbjct:  260 EQGVVRSLLQKYNSVFSAHDGDLGCTNLIEHEIPLLDNIPVRQRHRRIPPSDYELVKAHIDQLLEAQVVRESSSPYASPIVLVKKKDGS-LRMCVDYRLLNSKTRKDAFPLPRIEESLDALSGARWFSTLDLASGYNQVPVAEQDKPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGDQQYQSLLLYLDDIIVFSSSVSQHLQRLEVVLGRLQKEGLKAKLSKCVFFKQEVGYLGHVISNKGVSTDPAKIEAVAQWQRPRTVSELRSFLGFASYYRRFVEGFAQLAGPLHKLVAALVGSKTKKGSGQALGMAWTAQCEQSFEALKARLVSAPVLAYADFSLPFILEIDASYSGLGAVLSQEHDGAVRPVAYASRGLRPPERNMDNYSSMKLEFLALKWAMTEKFREYLLGHKCVVYTDNNPLSYLQSAK--LGAMEHRWAAQLAAFDFEIKYRSGRSNKNADALSRQYQLGPSVTEYVPGTPVPELVQQASPVVSATQALVSVLPGSSPVDIHSLQDADPLLREVLVFWRKQVQPTSAEKRQVSRPAMALLRQWDRLVERDGVLYRRVFRPDG--GEESFQLLLPAVLKPEVLKQLHQDHGHQGIERTSELVRQRCYWPGMFADIKQWCRECERCQVAK-DAGPVPHSFMGHLLASRPNEIVAIDFTV-LEPSRNGLENVLVMTDVFSKYTIAVPTRDQRASTVAQVLLREWFYKFGVPGRIHSDQGRSFESALIQQFCHLYGVERSRTTPYHPAGNGQCERFNRTLHNLLR-TLPTSRKQDWASNLPQVIFCYNTTPHQGTGESPYYLMFGQE 1071          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000041754.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001938.1:55959:59870:1 gene:ENSAMXG00000043385.1 transcript:ENSAMXT00000041754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 440.654 bits (1132), Expect = 1.432e-131
Identity = 263/809 (32.51%), Postives = 429/809 (53.03%), Query Frame = 1
Query:  604 LISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDS----KVLEALCGSKQK--------KLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHEL---GYCITRKELLSI-FYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCV----------------------QCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSK------EIENIKENISLMPDKTFYKYV--NGVIM---------TNNNKIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQ-ITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFG 2859
            L   +  IF K + D+G T L+ HEI L    P+    RR P      ++ +IQ++L   +I E +SP++SP+V V KK+ S +R+C+DYR LN  T R  +P+P  +E LD L GAK+FST+DL + Y QV +++  K KTAF T    + FNRMPFG+  AP TFQRLM  + G+  +   ++YLDD+++FS+T+ EH   +E+VF +++  NLK+  +KCQF + +V +LGH++  +G+ TD +KIE +K ++ P  +  LR FLG A+YYR+F+E ++K +    +++  L G ++K           W  ECE +F++LK +LTSTPVL + DF+KPFI++ DAS   +GAVLSQ+  GK R IA+ SR +   E     Y   + ELL++ +  T  F+ YL G +F + TD+  ++ +   K       Q W + L+  +  I+YR G ++ NADALSR+  E                         QC+ +   P        +L      I  +W+  S+      E  +   N+S +  + + + V   GV+          +   ++ +P+  + E +   H    H G  +    + +     ++ Q +    Q C+ C   K    K +        +   E + +DF   L+ A  G+  +L + D  +K+    A K Q   TV   L + W  ++G P  I+ D+G++FES L+K   + ++I+ + ++ Y    NGQ ER  RT+ D ++ + +++KRH  W   LP++ F  N+T  +T  +TP  ++FG
Sbjct:  275 LFQKYSNIFAKSEGDLGCTSLISHEIPLLDEVPVRQPYRRIPPSQYSTVKAHIQQLLDSRVIRESSSPFSSPIVLVTKKDGS-LRLCVDYRQLNAKTRRDSYPLPRIEESLDALCGAKWFSTLDLASGYNQVPVEEKDKSKTAFCTPFGLFEFNRMPFGLCNAPGTFQRLMERIFGDCRYQSVLLYLDDVIVFSQTVEEHLERLEEVFSRLQKQNLKVKLSKCQFFQHQVSYLGHVVSAEGVTTDPAKIEVVKEWKSPSHLAELRSFLGFASYYRRFVEGFSKLAAPLHRLVGGLSGPRRKGKTPKTSLAAFWDAECEQAFQSLKDRLTSTPVLAYADFNKPFIVEVDASHGGLGAVLSQEQEGKVRPIAFASRGLRPTERNMENYSSMKLELLAVKWAVTEKFREYLLGHQFTIYTDNNPLSHLQTAKLGAVE--QRWASQLASFNFTIKYRPGKHNQNADALSRQYLERFAVGTKVPPLVMEAVHEERSALENQCRQVVAFPGRSPSDLGVLQRADPVIGPVWKFRSEGRRPRTEERDTLCNLSKVLIRQWDRLVEREGVLYRRAYPSGRGSEYFQLLLPQCLQKEVLHSVHDDHGHQGTERTLQLLRDRCFWPNMTQDVERWCQQCQRCTLGKAVQPKVRAFQGTLQAAHPNEILAIDFTI-LEPASDGKENVLILTDIFTKYTQAIATKDQRASTVAWALVQHWFHRFGPPVRIHSDQGRNFESLLIKQLCKVYSIQKSRTTSYRPQGNGQCERFNRTLHDLLRTLPVEEKRH--WPRHLPQLTFAYNTTPHQTTGQTPHFLMFG 1077          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000037150.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:22265216:22268869:1 gene:ENSAMXG00000033912.1 transcript:ENSAMXT00000037150.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 420.239 bits (1079), Expect = 8.056e-125
Identity = 255/820 (31.10%), Postives = 417/820 (50.85%), Query Frame = 1
Query:  577 ISEDKI--INNLISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGS------KQKKL------MWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHEL---GYCITRKELLSI-FYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRK-------------------ECETCV----QCQMIHENPKMGKLKTRLLTLMTDNIENI--WQKNSKEIENIKENISLMPDKTFYKYV------NGVIM---------TNNNKIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFG 2859
            +SE+++  ++ L   +  IF + + D+G T LL HEI L    P+    RR P    E ++ +IQ++L   +I    SP++SP+V V KK+ S +R+C+DYR LN  T R  +P+P  +E LD L GAK+FST+DL + Y QV + +  + KTAF T    + FNRMPFG+  APATFQRLM  + G+  +   ++YLDD+++FS ++ +H   + +VF +++   LK+  +KC F + +V +LGH++  +G+ TD +KI+ ++ + RP  +  LR FLG A+YYR+F+E ++K +  L  L G       K K L       W + CE +F++LK +LTS PVL + DFSKPFI++ DAS   +GAVLSQ+  GK R IA+ SR +   E     Y   + ELL++ +  T  ++ YL G +  + TD+  ++ +   K   T   Q W + L+  + +I+YR G ++ NADALSR+                   E E  V    QC  +        L   LL      I  +  ++K  +     +      P K  ++        +GV+              ++ +P+  + E +   H    H G  +    + +      + + +    Q C  C   K    K +        ++  E + +DF   L+ A  G   +L + D  +K+      + Q   TV ++L + W  ++G P  I+ D+G++FES L++     + I+ + ++ Y    NGQ ER  RT+ D ++ TL     + W   L  + F  N+T  +T  KTP  ++FG
Sbjct:  280 LSEEQMAAVSLLFDQYQDIFAQTEGDLGCTTLLTHEIPLLDEVPVRQPYRRIPPSQYEAVKLHIQQLLDSKVIRNSASPYSSPIVLVTKKDGS-LRLCVDYRQLNAKTRRDAYPLPRIEESLDALAGAKWFSTLDLASGYNQVPVSEKDRYKTAFCTPFGLFEFNRMPFGLCNAPATFQRLMERMFGDCRYQSVLLYLDDVIVFSSSVEQHLERLAEVFSRLQKQGLKVKLSKCHFFQPQVNYLGHVVSREGVATDPAKIDAVRGWRRPSHLAELRSFLGFASYYRRFVEGFSKLAAPLHQLVGKLGGARRKGKTLPVPLAASWDERCEKAFQSLKERLTSAPVLAYADFSKPFIVEVDASHGGLGAVLSQEQEGKVRPIAFASRGLRPAERNMDNYSSMKLELLAVKWAVTEKYREYLLGNEVTILTDNNPLSHLQTAKLGATE--QRWASQLASFNFKIKYRPGKSNQNADALSRQYVDRFAIGTKVPPLRMELLESEPMVHKTGQCTEMVALAGRSALDLHLLQEADPVIGPVCKFRKEGRYPRAEEREALSSPTKALFRQWDRLLEKDGVLYRAVQPSGGGPETCQLLLPKHLQEEVLSSVHDDHGHQGVERTLKQLQSRCFWPGMAKHVERWCQQCRRCVLSKAVQPKIRAFQGTLQATRPHEILAIDFTL-LEPASDGRENVLVLTDVFTKYTQAIPTRDQRASTVAQVLVQHWFHRFGLPSRIHSDQGRNFESMLIQQLCNMYGIQKSRATAYRPQGNGQCERFNRTLHDLLR-TLPQSEKRRWPHYLSPMVFAYNTTPHQTTGKTPYYLMFG 1094          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009777.1 (pep scaffold:Pmarinus_7.0:GL476990:135790:139231:-1 gene:ENSPMAG00000008837.1 transcript:ENSPMAT00000009777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.368e-10
Identity = 49/248 (19.76%), Postives = 106/248 (42.74%), Query Frame = 1
Query: 2134 YVNGVIMTNNNKIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESK----LMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            Y  G        + + EE+K   +   H    H G  + +  +  ++  K +   IR+ + +CE C+++    +      + K+ S  +E + +D  GP     +  R++L I+D+ +K+  L  +  Q    VV  L      ++G P+ + C+  + + ++    + + F     + I+     H  ANG      + +RD   ++    RH+ W   L +  F  +++     R +P  ++ G++
Sbjct:   51 YYTGQKSGRKRLVVMNEEDKRSILQRVHGAD-HCGQTRTRKLLEEHYYWKGMVNDIRDYINACEICKQKSYKRSSISHVKLLKA-SYPWEVLGMDLLGPFPATSRAHRFVLLIVDYFTKWAELTPMTDQSAAHVVAALTTA-FHRFGFPKKLFCNVSEEYVAQINEEMFRHFPMCSGLAIS-----HLWANGAHRGTSQALRDC--VSKATGRHRDWELQLEQRLFEYHTSKHSATRYSPFYLMLGRE 288          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004123.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004123.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 6.227e-6
Identity = 34/150 (22.67%), Postives = 69/150 (46.00%), Query Frame = 1
Query: 2182 EENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMK 2631
            E+ K   ++  H    H G  K  + +  ++    +   ++N++ SC  C+ +           + K+ S  +E + +D  GPL +  +  RY+L +ID+ SK+     +  + ++ V   L   +  +YG PR +    GK F +++ K
Sbjct:   75 EDEKRNILMSVHGA-GHFGQKKTILKLEADYYWLGMISDVKNLIASCGVCRNKGSRRVAMPSMKLLKA-SGPWEVLGLDVLGPLPVTSRANRYLLLLIDYFSKWAEAVPLIEKSQEHVASALTVVFC-RYGFPRKVFSSLGKEFVTQVNK 221          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004121.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004121.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 8.108e-6
Identity = 34/151 (22.52%), Postives = 69/151 (45.70%), Query Frame = 1
Query: 2182 EENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKD 2634
            E+ K   ++  H    H G  K  + +  ++    +   ++N++ SC  C+ +           + K+ S  +E + +D  GPL +  +  RY+L +ID+ SK+     +  + ++ V   L   +  +YG PR +    GK F +++ K 
Sbjct:   75 EDEKRNILMSVHGA-GHFGQKKTILKLEADYYWLGMISDVKNLIASCGVCRNKGSRRVAMPSMKLLKA-SGPWEVLGLDVLGPLPVTSRANRYLLLLIDYFSKWAEAVPLIEKSQEHVASALTVVFC-RYGFPRKVFSSLGKEFVTQVNKS 222          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Nematostella
Match: EDO33875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR01])

HSP 1 Score: 63.1586 bits (152), Expect = 3.504e-12
Identity = 30/86 (34.88%), Postives = 51/86 (59.30%), Query Frame = 1
Query: 1162 DDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANY 1419
            DD++ F  +  EH   IE++ Q ++ +  K S  K QF  + VKFLGH+I ++G+R    K++ I+ +E P   + LR F+G+  +
Sbjct:    1 DDVICFHSSFEEHLRGIERMLQAVRASGFK-SIKKSQFATRSVKFLGHVIDQNGVRPQPEKLD-IRQWETPTNEEELRKFIGVCTF 84          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Nematostella
Match: EDO33090 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST86])

HSP 1 Score: 53.9138 bits (128), Expect = 2.333e-7
Identity = 31/118 (26.27%), Postives = 53/118 (44.92%), Query Frame = 1
Query: 1057 FNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYL-DDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLG 1407
            + R   G+  +    + LM  VLG+L   G +V L DD+     T +E +S  ++  Q +   NL++S +K     K    LG I     ++    ++ T+     P  V  +R F+G
Sbjct:  209 YTRCAMGMPGSETALEELMCRVLGDLLAEGVVVKLADDLYCGGNTPHELFSNWKRTLQALHECNLRLSASKTIINPKTTTILGWIWSAGTLKASPHRVATLAQCPTPTTVGLMRSFIG 326          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Nematostella
Match: EDO43256 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZD2])

HSP 1 Score: 48.1358 bits (113), Expect = 5.385e-6
Identity = 24/75 (32.00%), Postives = 41/75 (54.67%), Query Frame = 1
Query:  973 LGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNE 1197
            + + Y+  +L DA+ L   F+T   ++ F RMPFGI+ A    Q+++    G++   G +   DDI++  KT  E
Sbjct:    1 MSSCYWHKKLTDAASLLCTFNTPFGRFRFRRMPFGISCASEVAQKMVEEHFGDI--EGVLPVYDDIIVSGKTEAE 73          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000039099.1 (pep primary_assembly:ASM223467v1:16:31928608:31932747:-1 gene:ENSORLG00000023909.1 transcript:ENSORLT00000039099.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 461.07 bits (1185), Expect = 2.338e-138
Identity = 265/822 (32.24%), Postives = 432/822 (52.55%), Query Frame = 1
Query:  580 SEDKIINNLISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALC----GSKQKKLM-------WTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHE---LGYCITRKELLSIFYFTGH-FKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECE-----------TCV--QCQMIHENPKMGKLKTRLLTLMTDNIENI----------------WQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNN---------------KIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
             E + +  L+  +  +F  H+ D+G T L+ HEI L   +P+    RR P       +E+I  +L+  +I E +SP+ SP+V ++KK+   +R+C+DYR LN+ T +  FP+P  +E LD L GA++FST+DL + Y+QV + +A + KTAF T    + +NRMPFG+  AP+TFQRLM  + GE      ++YLDDI++FS T+ +H   +E V ++++L  LK+  AKC F + +V +LGH+I + G+ TD  K+E + N+E P  V  LR F+G A+YYR+F+E + K +  L  L     G+K +K         WT+EC+ SF+ LK KLT+TPVL + DFS+PFIL+ DAS   +GAVLSQ+  GK R IAY SR +   E   + Y   R E L++ +     F+ YL G+K I+ TD+  ++++   K  +    Q W   L+  D+EI+YR G ++ NADALSR+              +C+    Q + +   +G  +  ++ L   +  ++                W++ ++     +  +S  P     +  N ++                    +I +P   + E +   H++  H G ++    +        +   +      CE CQ  KV     +  +     SK  E + +DF   L+    G   +L I D  SK+    A + Q   TV ++L  EW  K+G P  I+ D+G+SFES L++   + + +E + ++PYH   NGQ ER  RT+ D ++ TL   R + W   LP++ +  N+T   +  ++P  ++FG++
Sbjct:  307 GEQEKVRTLLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKDGG-LRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYLGHVISDQGVSTDPGKVEAVANWEPPTTVFQLRSFIGFASYYRRFVEGFAKLAAPLHRLVAELEGNKVRKKSARGLTNHWTEECQRSFEALKAKLTTTPVLAYADFSRPFILEVDASNGGLGAVLSQEQEGKVRPIAYASRGLRPTERNPVNYSSMRLEFLALKWAVAEKFREYLLGQKCIVYTDNNPLSYLSTAK--LGAMEQRWAAQLAAFDLEIRYRSGRSNRNADALSRQHFPDMQAWRDVLPGSCLPMSLQQVQQTETVGTTQATMVALPHHSPSDMASLQGADPVLKEFLPFWERQTRPSPEERRQLS-SPTLALLRQWNRLVEQGGVLYRRVFRDDGGEAVLQILLPGSIREEVLTAVHQQHGHQGVDRTLDLLRQRCYWPGMSAEVAEWCSQCERCQVAKVTRPAARAPMGHLLASKPNEILAMDFSV-LEPTTSGIENVLVITDIFSKYTMAVATRDQRAATVAQVLVTEWFSKFGVPARIHSDQGRSFESALIQQLCDLYAVEKSRTTPYHPEGNGQCERFNRTLHDLLR-TLPVSRKRDWNVCLPQLLYSYNTTPHHSTGESPFFLMFGQE 1122          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000029819.1 (pep primary_assembly:ASM223467v1:24:6358775:6362914:-1 gene:ENSORLG00000022361.1 transcript:ENSORLT00000029819.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 460.685 bits (1184), Expect = 3.420e-138
Identity = 265/822 (32.24%), Postives = 432/822 (52.55%), Query Frame = 1
Query:  580 SEDKIINNLISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALC----GSKQKKLM-------WTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHE---LGYCITRKELLSIFYFTGH-FKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECE-----------TCV--QCQMIHENPKMGKLKTRLLTLMTDNIENI----------------WQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNN---------------KIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
             E + +  L+  +  +F  H+ D+G T L+ HEI L   +P+    RR P       +E+I  +L+  +I E +SP+ SP+V ++KK+   +R+C+DYR LN+ T +  FP+P  +E LD L GA++FST+DL + Y+QV + +A + KTAF T    + +NRMPFG+  AP+TFQRLM  + GE      ++YLDDI++FS T+ +H   +E V ++++L  LK+  AKC F + +V +LGH+I + G+ TD  K+E + N+E P  V  LR F+G A+YYR+F+E + K +  L  L     G+K +K         WT+EC+ SF+ LK KLT+TPVL + DFS+PFIL+ DAS   +GAVLSQ+  GK R IAY SR +   E   + Y   R E L++ +     F+ YL G+K I+ TD+  ++++   K  +    Q W   L+  D+EI+YR G ++ NADALSR+              +C+    Q + +   +G  +  ++ L   +  ++                W++ ++     +  +S  P     +  N ++                    +I +P   + E +   H++  H G ++    +        +   +      CE CQ  KV     +  +     SK  E + +DF   L+    G   +L I D  SK+    A + Q   TV ++L  EW  K+G P  I+ D+G+SFES L++   + + +E + ++PYH   NGQ ER  RT+ D ++ TL   R + W   LP++ +  N+T   +  ++P  ++FG++
Sbjct:  307 GEQEKVRALLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKDGG-LRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYLGHVISDQGVSTDPGKVEAVANWEPPTTVFQLRSFIGFASYYRRFVEGFAKLAAPLHRLVAELEGNKVRKKSARGLTNHWTEECQRSFEALKAKLTTTPVLAYADFSRPFILEVDASNGGLGAVLSQEQEGKVRPIAYASRGLRPTERNPVNYSSMRLEFLALKWAVAEKFREYLLGQKCIVYTDNNPLSYLSTAK--LGAMEQRWAAQLAAFDLEIRYRSGRSNRNADALSRQHFPDMQAWRDVLPGSCLPMSLQQVQQTETVGTTQATMVALPHHSPSDMASLQGADPVLKEFLPFWERQTRPSPEERRQLS-SPTLALLRQWNRLVEQGGVLYRRVFRDDGGEAVLQILLPGSIREEVLTAVHQQHGHQGVDRTLDLLRQRCYWPGMSAEVAEWCSQCERCQVAKVTRPAARAPMGHLLASKPNEILAMDFSV-LEPTTSGIENVLVITDIFSKYTMAVATRDQRAATVAQVLVTEWFSKFGVPARIHSDQGRSFESALIQQLCDLYAVEKSRTTPYHPEGNGQCERFNRTLHDLLR-TLPVSRKRDWNVCLPQLLYSYNTTPHHSTGESPFFLMFGQE 1122          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000032171.1 (pep primary_assembly:ASM223467v1:18:2114932:2117958:1 gene:ENSORLG00000025397.1 transcript:ENSORLT00000032171.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 450.284 bits (1157), Expect = 1.245e-137
Identity = 272/861 (31.59%), Postives = 445/861 (51.68%), Query Frame = 1
Query:  472 LIGGIDFLERFGMQLQIENRTDEI-NTIMENSFKNHISEDKI-INNLISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCG------SKQKKLM-----WTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHE---LGYCITRKELLSI-FYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETC------------------VQCQMIHENPKMGKLKTRLLTLMTDNIENI-------------WQ----KNSKEIENI-KENISLMPDKTFYKYVNG-----VIMTNNN----KIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            L  GI  + R    + I+  +D I   I     +   +ED+     L+  +  +F  H+ D+G T L+ HEI L   +P+    RR P    E ++++I ++L  G+I E  SP+ SP+V  +KK+ S +R+C+DYR LN+ T R  FP+P  DE LD L GA++F+T+DL + Y QV + +  + KTAF T    + +NRMPFG+  AP TFQRLM  + G+      ++YLDDI++FS T++EH   +E V  +++   L++   KC F ++EV++LGH+I + G+ TD  KIE +  ++ P  V  LR FLG A+YYR+F+E + + +  L  L G      S+++K       WT EC+ +F  LK KLTS PVL + DF+ PF L+ DAS + +GAV  Q+ GG  R IAY SR +   E     Y   + E L++ +  T  F+ YL G   ++ TD+  ++++   K  +    Q W+  L+  D EI+YR G  + NADALSR    +                   VQ Q +  + +M +L        T  ++++             W+     N  E E + K  ++L+        V+G     V+M ++     ++ +PE    E + + H+   H G  +    +        + + + +  Q+CE CQ  K ++      +     S+  E + +DF   L+ +  G   +L + D  SK+      + Q   TV ++L  EW  K+G P  ++ D+G+SFES+L++     + IE + ++PYH + NGQ ER  RT+ + ++  L+  R + W   LP+V F  N+T  +T  ++P   +FG++
Sbjct:  143 LPAGITEVPRPAATVNIQAASDVILEQIDALPLETLPAEDRGKAQALLQKYANVFAAHEGDLGCTTLMTHEIPLLDDAPVRQRHRRIPPSEYEAVKDHINQLLASGVIRESNSPYASPIVLARKKDGS-LRMCVDYRQLNSKTRRDAFPLPRIDESLDALSGARWFTTLDLASGYNQVPVTEGDRAKTAFCTPFGLFEWNRMPFGLCNAPGTFQRLMQRIFGDQQCQSVLLYLDDIVVFSSTIDEHLERLELVLGRLQQEKLRVKLPKCAFFQQEVRYLGHVISDQGVSTDPHKIEAVAGWQPPSTVSELRTFLGFASYYRRFVEGFARLAAPLHRLVGELDGTKSRRRKASSLQGHWTTECQQNFDALKQKLTSAPVLAYADFTLPFFLEVDASHNGLGAVFPQEQGGSVRPIAYASRGLKATERNMQNYSSMKLEFLALKWAMTEKFREYLLGHHCVVFTDNNPLSYLSTAK--LGEMEQRWVAQLAAFDYEIKYRSGRVNRNADALSRHPNHSSAEVGNMAPGSSLPRDLQQVQVQPVLAHCEMEQLMPVFPQRTTAEVQDLQVSDPVLASVLPFWRDQRYPNYSEREGLSKVALTLLRQWKNLAEVDGLVYRRVLMPDSGQEVFQLLLPEILIPEVLEQVHQHHGHQGIERTLALLRARCYWPGMSKDVAHWCQACERCQLAKDNSRSHSAPLGHLIASRPNELVAMDFTI-LEPSRTGVENVLVLTDVFSKYTVAIPTRDQRAATVAKVLVAEWFSKFGVPARLHSDQGRSFESQLIQQLCGLYGIEKSRTTPYHPAGNGQCERFNRTLHNLLR-ALQVTRKRDWHSCLPQVTFCYNTTPHQTTGESPFFFMFGQQ 998          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000036827.1 (pep primary_assembly:ASM223467v1:16:28613823:28617539:1 gene:ENSORLG00000023550.1 transcript:ENSORLT00000036827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 453.751 bits (1166), Expect = 7.984e-137
Identity = 279/903 (30.90%), Postives = 448/903 (49.61%), Query Frame = 1
Query:  625 IFMKHKWDVGKTELLKHEILTKGS-PIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKEC--ETCVQCQ---------MIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKENISLM-----PD-----------KTFYKYVNGVIMTNN--NKIWI-PEENKSEFIIEYHKKL-------CHAGANKVKMYVS-------NNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTI------------RKTPAEMVFGKKIYS-------EWFSEI--------------VEEEKTNQPTN-------REFQIGDCVLIKVNVRNKG-----DNRYMGPGVITKKIHDRSYEIKLENGS 3063
            IF   + +VG T L+ HEI T  + PI   PRR P+      +  I+EML+ GII    SPW S +V VKKK    +R C+DYR LN +T++  +P+P  DE LD++ G+ +FS++DL + Y+QV L  A++ KTAF T    + F  + FG+  APATF+RLM  VL  +     +VYLDDIL+   +      ++ KV Q+I  A LK+ P KC F R+E++FLGH IG +GI T E K++ ++++  P  ++ L+ FLGLA+YYR+F+  ++  +  L  L   K    +WT ECE +F +LK  LT++P+L  PD   PFILDTDAS   +GAVLSQ     ERV+AY S+ ++K E  YC+TR+ELL++    GHF++YL G  F +RTDH A+ ++M T K    Q   W+  L+     +++R G  H NADA+SR+ C    C  C+            E    G+    +  L+       W+ + ++  +++  +  +     P+           K  ++  + + + +    + W  P   +  + +   + L       CH  A      VS         F    L + + +  + C+ C   K    +++ E+   +     E + VD  GP     +G R++L  +D+ +K+   +A+  Q+  TV   L E    ++GA  +I+ D+G++FES +     E   +    ++P H  ++G +ER  RT+   + I L       W + LP V     S  Q +              +TPAEM FGK   +       E+  ++              +E+    Q  N       ++F+ GD V +    R KG     D +++GP  + +K+ +  Y ++L  G 
Sbjct:  247 IFALSEDEVGLTHLVHHEIDTGDARPIKTRPRRLPLAHQVAADSAIEEMLRGGIIEPSDSPWASGVVMVKKKKGPKMRFCVDYRPLNGVTKKDSYPLPRIDESLDLVSGSSWFSSLDLRSGYWQVPLSPAARPKTAFCTGRGLWQFRVLSFGLCNAPATFERLMEKVLASIPRQECLVYLDDILVHGGSFKAALESLRKVLQRIAAAGLKLHPDKCCFMRRELEFLGHKIGGEGISTLEEKVQAVRDWPTPTTLRDLKSFLGLASYYRRFVRGFSCIAAPLFHL-QRKDCDFVWTQECEQAFSSLKKALTNSPILTPPDPKLPFILDTDASDVGMGAVLSQMGSAGERVVAYFSKTLSKAERRYCVTRRELLAVVKAIGHFRYYLCGLPFTVRTDHSALQWLM-TFKEPEGQIARWLEELASFSFTVEHRPGSRHANADAMSRRPCALAGCQYCEKREAREAVISREEQSHTGESSWPVCRLVQGVDSTEWRAHQEQDVDLQPVLQWVEAGRKPEWGEVAGCSPGSKGLFEKFDALRLKDGVLQRAWKEPATGEERWQVVVPRTLRNSVLQGCHGAAGSGHFGVSKTLRRIRQGFYWGQLRRDVEDFCRRCDICTAHKGPPDRSRAELQQLAAGAPMERVAVDIMGPFPRTNRGNRFVLVAMDYFTKWPEAYAIPDQEAVTVADALVEGMFSRFGAAEVIHSDQGRNFESAVFSAMCERLGMRKTRTTPLHPQSDGLVERFNRTLVKQLAI-LTSAHQSDWDEHLPLVLMAYRSAVQDSTLCTPALLMLGRELRTPAEMSFGKPPDALGAPPGPEYARKLQDRMDTAHAFARNQLEKAGIRQKRNYDLRAKGKDFKAGDLVWVYNPKRKKGRCPKLDCQWVGPCEVLEKLGEVVYRVELPPGG 1146          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000041674.1 (pep primary_assembly:ASM223467v1:5:30088905:30092924:1 gene:ENSORLG00000022054.1 transcript:ENSORLT00000041674.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 453.751 bits (1166), Expect = 6.810e-136
Identity = 274/861 (31.82%), Postives = 447/861 (51.92%), Query Frame = 1
Query:  472 LIGGIDFLERFGMQLQIENRTDEI-NTIMENSFKNHISEDKI-INNLISTFDGIFMKHKWDVGKTELLKHEI-LTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCG------SKQKKLM-----WTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHE---LGYCITRKELLSI-FYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETC------------------VQCQMIHENPKMGKLKTRLLTLMTDNIENI-------------WQ----KNSKEIENI-KENISLMPDKTFYKYVNG-----VIMTNNN----KIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKK 2865
            L  GI  + R    + I+  +D I   I     +   +ED+     L+  +  +F  H+ D+G T L+ HEI L   +P+    RR P    E ++++I ++L  G+I E  SP+ SP+V  +KK+ S +R+C+DYR LN+ T R  FP+P  DE LD L GA++F+T+DL + Y QV + +  + KTAF      + +NRMPFG+  AP TFQRLM  + G+      ++YLDDI++FS T++EH   +E V  +++   L++   KC F ++EV++LGH+I + G+ TD  KIE +  ++ P  V  LR FLG A+YYR+F+E + + +  L  L G      S+++K       WT EC+ +F  LK KLTS PVL + DF+ PFIL+ DAS + +GAVLSQ+ GG  R IAY SR +   E     Y   + E L++ +  T  F+ YL G   ++ TD+  ++++   K  +    Q W+  L+  D EI+YR G  + NADALSR    +                   VQ Q +  + +M +L        T  ++++             W+     N  E E + K  ++L+        V+G     V+M ++     ++ +PE    E + + H+   H G  +    +        + + + +  Q+CE CQ  K ++      +     S+  E + +DF   L+ +  G   +L + D  SK+      + Q   TV ++L  EW  K+G P  ++ D+G+SFES+L++     + IE + ++PYH + NGQ ER  RT+ + ++  L   R + W   LP+V F  N+T  +T  ++P  ++FG++
Sbjct:  235 LPAGITEVPRPAATVNIQAASDVILEQIDALPLETLPAEDRGKAQALLQKYANVFAAHEGDLGCTTLMTHEIPLLDDAPVRQRHRRIPPSEYEAVKDHINQLLASGVIRESNSPYASPIVLARKKDGS-LRMCVDYRQLNSKTRRDAFPLPRIDESLDALSGARWFTTLDLASGYNQVPVTEGDRAKTAFCIPFGLFEWNRMPFGLCNAPGTFQRLMQRIFGDQQCQSVLLYLDDIVVFSSTIDEHLERLELVLGRLQQEKLRVKLPKCAFFQQEVRYLGHVISDQGVSTDPHKIEAVAGWQPPSTVSELRTFLGFASYYRRFVEGFARLAAPLHRLVGELDGTKSRRRKASSLQGHWTTECQQNFDALKQKLTSAPVLAYADFTLPFILEVDASHNGLGAVLSQEQGGSVRPIAYASRGLKATERNMQNYSSMKLEFLALKWAMTEKFREYLLGHHCVVFTDNNPLSYLSTAK--LGAMEQRWVAQLAAFDYEIKYRSGRVNRNADALSRHPNHSSAEVGNMAPGSSLPRDLQQVQVQPVLAHCEMEQLMPVFPQRTTAEVQDLQVSDPVLASVLPFWRDQRYPNYSEREGLSKVALTLLRQWKNLAEVDGLVYRRVLMPDSGQEVFQLLLPEILIPEVLEQVHQHHGHQGIERTLALLRARCYWPGMSKDVAHWCQACERCQLAKDNSRSHSAPLGHLIASRPNELVAMDFTI-LEPSRTGVENVLVLTDVFSKYTVAIPTRDQRAATVAKVLVAEWFSKFGVPARLHSDQGRSFESQLIQQLCGLYGIEKSRTTPYHPAGNGQCERFNRTLHNLLR-ALPVTRKRDWHSCLPQVTFCYNTTPHQTTGESPFFLMFGQQ 1090          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 1024.62 bits (2648), Expect = 0.000e+0
Identity = 534/1036 (51.54%), Postives = 720/1036 (69.50%), Query Frame = 1
Query:  109 CMDEVFKDPPLTSNELNVLN-RDKRNDIIVYDKMQGRPSVTVMINNVKLVCLLDTGAKISVIDYNIFKKLGNLNMTTSNLKLRCANDSPIEICGKTLLNXXXXXXXXXXXXEFVVAKDINPKLIGGIDFLERFGMQLQI-----ENRTDEINTIM---------ENSFKNHISEDKIINN--LISTFDG---IFMKHKWDVGKTELLKHEILTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKD-GGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKENISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQIERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEMVFGKKI-YSEWFS------EIVE---EEKTNQP----TNREFQIGDCVLIKVNVRNKGDNRYMGPGVITKKIHDRSYEIKLENGSSVTRNIEWLKVFKKGG 3111
            C++E+ +D    + E N+L+  ++++  I Y+ MQGRPS T+ I   K+ CLLDTGA+I+V+  ++  +L N+ +  +   LRCAN+S +E  GK  LN+ V   S  + V F++ K++ P++IGG++    FG++L+      E R+D I  I          E   ++ I   K+  N  L+  F     +FM  KWD+G T L+KH+I+TKG PI+I PRRQPI+L +KIEE I+ +   GII +C SPWN+PLVCV KK   DIR+CLD+R LN ITER  FP+PN DE+LDIL G+++FS+IDLGNAYYQV+LD  S+ KTAFSTK  Q+ FNRMPFGIAAAP TFQ LM  VL +L  +G +VYLDDILIF+KT  +HY+   KV  KI  A L+++P KCQ  RKEVKFLGHII +DGI+TD +KIE I++F++PKCVK+LR FLG+ NYYR+FI++Y K ++ LE++CG   +K+ WT+ CE +F  +K  L + PVL FPDF K FILDTDASFD IGAVLSQKD  G E VIAYGS AM+ HE GYCITRKELL+I+YF  HF HYLYGK+F+LRTDHKAITFM+ TKK IT QFQTWIN+LS LD++++YRKG +H NAD LSRK C TCVQC M HE+ K GK+KTR+LT+  +   N WQ ++ E++ IK  +     K   +  N  ++T   KIWIP +N+   I E H  LCHAGA KV  Y+ NN DM++L   ++ V+++CE CQK K  TTKTKEE      ++ FE IY+D CGPL+     ++YI GIIDH+SK+ISL A+  QDE+T+   L  +WI+K+GAP+ ++ D GK+FE++ +K+ A+   IE+ +SSPYHH+ NG IERQFRTIR+ I  +L +   K+W DI+PE+++ LN+T QKT   +PAE++FG+KI   +W+S      E +E   E+KT +P    T R F++ D VLIK  +RNK D R+ GP  + KKIH+RSY +K +NG  V RN+E +K FKKGG
Sbjct: 2517 CINEIVED----TREQNILSVEEQKSPAITYNIMQGRPSTTLDIQGRKVDCLLDTGARINVMAKSVIDRLENIEILETRESLRCANNSRLETMGK--LNINVKMGSMERNVTFIIVKNLIPEIIGGVELQRLFGIELKCILEEHEKRSDFICEIEARFGRIITDEERLRHAIDVLKVTGNKRLLEIFQANKNVFMADKWDIGCTNLIKHKIITKGEPIMIKPRRQPINLEDKIEEAIKNLENNGIIRKCNSPWNTPLVCVWKKEKKDIRLCLDFRQLNKITERQAFPMPNVDEILDILHGSRYFSSIDLGNAYYQVKLDKESQEKTAFSTKEGQFCFNRMPFGIAAAPGTFQELMTKVLKDLWKDGVMVYLDDILIFTKTEEDHYNIFGKVLGKIATAGLRLNPEKCQIFRKEVKFLGHIINKDGIQTDNTKIEAIQSFQKPKCVKNLRSFLGICNYYRRFIKDYAKKARALESICGKNNEKIRWTEMCEKAFGEMKEALITAPVLVFPDFRKEFILDTDASFDTIGAVLSQKDEKGHEHVIAYGSHAMSSHEKGYCITRKELLAIYYFCKHFNHYLYGKRFVLRTDHKAITFMVTTKKPITAQFQTWINYLSSLDIKMEYRKGTSHTNADMLSRKTCGTCVQCMMEHEDAKTGKIKTRILTVTAEGGYNKWQNDNMEVQEIKNKLENKDCKFIME--NNTVLTKQGKIWIPSDNRQRMIKEVHVLLCHAGAQKVTKYIQNNCDMENLATEVKKVIENCERCQKMKTITTKTKEETQTIKSTEPFEKIYMDICGPLKETFNKKKYICGIIDHYSKYISLTAINKQDERTISETLLNKWILKFGAPKELHVDCGKNFEARSIKELAKTAGIELIFSSPYHHNTNGIIERQFRTIREYINASLNEGGRKNWADIVPEIKYTLNATVQKTTGVSPAEIIFGRKIDRMKWYSNKEINREDMEKRIEDKTLKPKISKTVRNFEMEDVVLIKQEIRNKDDARWEGPYKVIKKIHERSYLLKDQNGKMVVRNVEKIKHFKKGG 3544          

HSP 2 Score: 85.5001 bits (210), Expect = 3.404e-16
Identity = 84/325 (25.85%), Postives = 128/325 (39.38%), Query Frame = 3
Query: 3264 FDNKRVLVMDSINTRSSVANMATTIANFIKP---PETYDMDSDVEDFILETERFFEMTNIVDEYRSKFVKAFLSINSTKKYELTNETLHYTERLRNAFSKNRSLIDDLNEALNYRQGNEAAEEFCSKIEKLAKNIXXXXXXXXXXXXXXXXXXXXDKEVKKDLKMQDLKSFDEMKERLKRHDQVSKEINVFHADVASMNKTQRYADAVKKSLPRYNYDNRSIREREANPRFKDEYTREPQHNPRFKGDLTREHRYAISNGWRPMNRSKPYNT----REFHSRDHIRTNQILRCWACHEEGHRRSECSNIQCAHCKRSGHFKHQCH 4217
              +K  +V  +I   ++ +NMAT   + +     PE +    D+E FI E +RFFE+T    + +   V   L     ++YE   E     ++LR AF +  SLIDDL EALNY Q                                         EV+K+++M+DLK+ +++KE +K+ ++V              NK     + V           RSIR       ++D             G   RE      N W+P  R K        +  HS       +  +C+AC  EGH R EC  I+C  C   GH + +C+
Sbjct: 2131 IGDKLWVVSVNILAYTAASNMATIPTDLLIGRLLPEKFHRGDDLELFIKECQRFFEITKTPVKTQMVLVITLLDRTLIEEYEAA-EGKTVEQKLRAAFHRPTSLIDDLREALNYEQ-----------------------------------------EVRKEIEMKDLKTAEQIKETIKKIEKV--------------NKVIEQVNTV-----------RSIRPTTGGRTYRDVVQV---------GATKRE-----INEWKPETRVKMIECWTCQKPGHSSRECNIKRRFQCYACGVEGHIRRECPTIKCHRCNARGHKERECY 2374          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000023258.1 (SMESG000023258.1)

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 347/352 (98.58%), Postives = 348/352 (98.86%), Query Frame = 3
Query: 3282 LVMDSINTRSSVANMATTIANFIKPPETYDMDSDVEDFILETERFFEMTNIVDEYRSKFVKAFLSINSTKKYELTNETLHYTERLRNAFSKNRSLIDDLNEALNYRQGNEAAEEFCSKIEKLAKNIXXXXXXXXXXXXXXXXXXXXDKEVKKDLKMQDLKSFDEMKERLKRHDQVSKEINVFHADVASMNKTQRYADAVKKSLPRYNYDNRSIREREANPRFKDEYTREPQHNPRFKGDLTREHRYAISNGWRPMNRSKPYNTREFHSRDHIRTNQILRCWACHEEGHRRSECSNIQCAHCKRSGHFKHQCHELFPGRRRKFHKSVAAFGDEDPEADFEYPNGNAPQHEEVI 4337
            LVMDSINTRSSVANMATTIANFIKPPETYDMDSDVEDFILETERFFEMTNIVDEYRSKFVKAFLSINSTKKYELTNETLHYTERLRNAFSKNRSLIDDLNEALNYRQGNEAAEEFCSKIEKLAKNILKHKLDEEELKKFLLFNSLEDKEVKKDLKMQDLKSFDEMKERLKRHDQVSKEINVFHADVASMNKTQRYADAVKKSLPRYNYDNRSIREREANPRFKDEYTREPQHNPRFKGDLTREHRYAISNGWRPMNRSKPYNTRE HSRDH+RTNQILRCWACHEEGHRRSECSNIQCAHCKRSGHFKHQCHELFPGR RKFHKSVAAFGDEDPEAD EYPNGNAP HEEVI
Sbjct: 1035 LVMDSINTRSSVANMATTIANFIKPPETYDMDSDVEDFILETERFFEMTNIVDEYRSKFVKAFLSINSTKKYELTNETLHYTERLRNAFSKNRSLIDDLNEALNYRQGNEAAEEFCSKIEKLAKNILKHKLDEEELKKFLLFNSLEDKEVKKDLKMQDLKSFDEMKERLKRHDQVSKEINVFHADVASMNKTQRYADAVKKSLPRYNYDNRSIREREANPRFKDEYTREPQHNPRFKGDLTREHRYAISNGWRPMNRSKPYNTRESHSRDHVRTNQILRCWACHEEGHRRSECSNIQCAHCKRSGHFKHQCHELFPGRSRKFHKSVAAFGDEDPEADCEYPNGNAPPHEEVI 1386          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000023258.1 (SMESG000023258.1)

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 347/352 (98.58%), Postives = 348/352 (98.86%), Query Frame = 3
Query: 3282 LVMDSINTRSSVANMATTIANFIKPPETYDMDSDVEDFILETERFFEMTNIVDEYRSKFVKAFLSINSTKKYELTNETLHYTERLRNAFSKNRSLIDDLNEALNYRQGNEAAEEFCSKIEKLAKNIXXXXXXXXXXXXXXXXXXXXDKEVKKDLKMQDLKSFDEMKERLKRHDQVSKEINVFHADVASMNKTQRYADAVKKSLPRYNYDNRSIREREANPRFKDEYTREPQHNPRFKGDLTREHRYAISNGWRPMNRSKPYNTREFHSRDHIRTNQILRCWACHEEGHRRSECSNIQCAHCKRSGHFKHQCHELFPGRRRKFHKSVAAFGDEDPEADFEYPNGNAPQHEEVI 4337
            LVMDSINTRSSVANMATTIANFIKPPETYDMDSDVEDFILETERFFEMTNIVDEYRSKFVKAFLSINSTKKYELTNETLHYTERLRNAFSKNRSLIDDLNEALNYRQGNEAAEEFCSKIEKLAKNILKHKLDEEELKKFLLFNSLEDKEVKKDLKMQDLKSFDEMKERLKRHDQVSKEINVFHADVASMNKTQRYADAVKKSLPRYNYDNRSIREREANPRFKDEYTREPQHNPRFKGDLTREHRYAISNGWRPMNRSKPYNTRE HSRDH+RTNQILRCWACHEEGHRRSECSNIQCAHCKRSGHFKHQCHELFPGR RKFHKSVAAFGDEDPEAD EYPNGNAP HEEVI
Sbjct: 1043 LVMDSINTRSSVANMATTIANFIKPPETYDMDSDVEDFILETERFFEMTNIVDEYRSKFVKAFLSINSTKKYELTNETLHYTERLRNAFSKNRSLIDDLNEALNYRQGNEAAEEFCSKIEKLAKNILKHKLDEEELKKFLLFNSLEDKEVKKDLKMQDLKSFDEMKERLKRHDQVSKEINVFHADVASMNKTQRYADAVKKSLPRYNYDNRSIREREANPRFKDEYTREPQHNPRFKGDLTREHRYAISNGWRPMNRSKPYNTRESHSRDHVRTNQILRCWACHEEGHRRSECSNIQCAHCKRSGHFKHQCHELFPGRSRKFHKSVAAFGDEDPEADCEYPNGNAPPHEEVI 1394          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000081257.1 (SMESG000081257.1)

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 321/871 (36.85%), Postives = 496/871 (56.95%), Query Frame = 1
Query:  190 IVYDKMQGRPSVTVMINNVKLVCLLDTGAKISVIDYNIFKKLGNLNMTTSNLKLR--CANDSPIEICGKTLLNXXXXXXXXXXXXEF--VVAKDINPKLIGGIDFLERFGMQLQ---------IENRTDEINTIMENSFKNHISEDKIINNLISTFDGIFMKHKWDVGKTELLKHEILTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKDGGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSRKECETCVQCQMIHENPKMGKLKTRLLTLM--TDNIENIWQKNSKE-------IENIKENISLMPDKT----FYKYV------NGVIMTNNN---KIWIPEENKSEFIIEYHKKLCHAGANKVKMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLFETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLKEEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANG 2697
            +++ K   R    + IN   +  L ++GA ISV+    ++ +G+  +  S + L    +N+       K L +VK+    + K  E   ++ + I+P  IGG+D ++ FGM+L+         +  R  + + +        + ++  +  LIS F  IFM  ++D+G T+++ HE+ T G PI+ NPR QP+HL  K+EE +Q +L+ G++ +C SPWN+PLV V K + S +RICLD+R LN++TE+  FP+P+   LLD L  +K F +IDLG AYY VEL++ S++KTAFSTK  Q+ FNR+PFG++ APATFQ+LM+ +L  L + G +VYLDDILI+ +    H   + +VF +I+ + LK++P KC F +  + F+GH + E GI+T++ KI  I+N   PK    LR FLGL  YYR+FI+NY+  +  L A      K ++WT+EC   F NLK  L   P+L++P   + FI+DTD SF+ IG                    + KHE+GYC+TRKELL +  F  HF+ YLYG++F+ RTDHKA+TFM  TKK I+PQFQTW+ + S  D  +QYRKG+ H NA   SR     C   QM H++ K  K +TR +  +  + NI  I ++   E       I ++  N + +  KT     +KY+      + V+M N +    + +P+      +  +H +LCH G NK   Y+ + F +  + Q I   +  C+ C  RK+D  +TKE ++ ++  +  E I VD         + ++Y++ IID  SK +SL     QDE T++ ++   WI ++G P  I  DR + FE  + +D+ E   I+  +SSPY H +NG
Sbjct:  275 VMFKKDDDRKWSIMEINGFHVEMLWNSGASISVMSEKCWRLIGSPILMDSRILLSEVFSNEDK-----KPLGSVKIVAKWNKKFRELNVIIVRKIHPNFIGGVDTMKIFGMELKEVNNIESSLVNKRFTDSDRLKNTLLTLKLDKNSELGTLISQFSNIFMASRFDLGHTKVITHELKTSGPPILQNPRGQPMHLEAKVEELVQNLLEAGVVRKCQSPWNTPLVIVGKPDGS-VRICLDFRLLNSVTEKFSFPMPDMQLLLDCLGKSKIFYSIDLGQAYYLVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDDILIYGENQETHDKLLFEVFTRIRDSGLKVNPEKCAFNKSVLNFIGHTVSEKGIQTNKRKISEIENATEPKSTTELRSFLGLTTYYRRFIKNYSMIAAPLYAATTGCDKMIVWTEECRKRFINLKKLLCEAPILEYPRADRLFIIDTDDSFEAIG-------------------HLTKHEIGYCVTRKELLVLHEFIVHFRQYLYGRRFVARTDHKALTFMNTTKKPISPQFQTWMANFSEYDFALQYRKGNEHGNAGGWSRLNNTICSHYQMEHKDAKKAKCRTRCINSLQGSSNIMKIIKQKQNEDKVTSQIISHLNGNEAHISYKTISSSIFKYLKILQIQDNVLMINTDGKLAVVVPDSYVKSLVNYFHIELCHLGINKTLFYLKDFFFLPSMNQIITECINKCKICASRKIDQGRTKEILLPRTGERFLEQIVVDI--DYMETKESKKYMIVIIDCFSKLVSL----PQDEATILNVILNNWIYRFGRPESILTDRERIFEGSMFRDWMEKFGIKQEFSSPYQHQSNG 1114          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000016546.1 (SMESG000016546.1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.576e-129
Identity = 211/431 (48.96%), Postives = 277/431 (64.27%), Query Frame = 1
Query:  592 IINNLISTFDGIFMKHKWDVGKTELLKHEILTKGSPIVINPRRQPIHLIEKIEENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERPIFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQYYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEHYSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIETIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLMWTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKD-GGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILRTDHKAITFMMKTKKAITPQFQTWINHL 1881
            ++  +I     +FM +KW++G T LLKH+I+T+GS I I PRRQPIHL  KIEE IQ + K GII                            + LN +T+R  +P+ N  E+LD  +G K F++IDLGNAYYQVEL++ SK KTAFST + QY FNRMPFGIA  P T Q LM  VLG  N NGT+VYL+DILIF+ T  ++Y+ +  V ++I                                    + E IK+F++P+C+K+L+ F G+ NYYR+FI++Y K ++ LE LCG    KL+W + CE +F+++K  LT +PVL +PDF++ FI+DTD+SFD IG VLSQKD  G E+VIAYGS AM+ HE GYCI RKELL+I+YF  HF H+LYGK+F LRTD KAITFM+ TKK IT QF+TWINHL
Sbjct:  143 VLAEIIKNNQNVFMANKWEIGCTALLKHKIVTRGSLINIKPRRQPIHLEPKIEEAIQNLFKNGII----------------------------KNLNLVTDRQAYPMQNIAEILDRFEGEKHFNSIDLGNAYYQVELEEKSKEKTAFSTTTGQYCFNRMPFGIATGPGTSQELMRKVLG--NINGTVVYLNDILIFTATKEQYYAVLNDVIERI-----------------------------------GRPEAIKSFQKPECIKNLKSFPGICNYYRRFIKDYAKKTRTLEELCGKYNVKLIWAENCEKAFEDMKKALTESPVLGYPDFTRDFIIDTDSSFDTIGDVLSQKDNNGYEKVIAYGSHAMSTHEKGYCIKRKELLAIYYFCQHFNHHLYGKRFTLRTDLKAITFMLSTKKPITAQFKTWINHL 508          
The following BLAST results are available for this feature:
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RTL19.161e-2125.84retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
RTL19.161e-2125.84retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
KRBA23.257e-725.17KRAB-A domain containing 2 [Source:HGNC Symbol;Acc... [more]
KRBA23.257e-725.17KRAB-A domain containing 2 [Source:HGNC Symbol;Acc... [more]
KRBA23.623e-725.17KRAB-A domain containing 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX511224.11.040e-9031.67pep chromosome:GRCz11:2:18017000:18022765:1 gene:E... [more]
BX511082.11.260e-9030.74pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
BX546500.12.270e-9029.49pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
CR855320.14.970e-9030.16pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENS... [more]
CR925755.29.152e-8829.94pep chromosome:GRCz11:17:42486740:42492668:-1 gene... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa65.841e-9938.68annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
ENSXETT00000006041.11.417e-8533.94pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
ENSXETT00000035398.15.006e-8028.47pep primary_assembly:Xenopus_tropicalis_v9.1:3:986... [more]
ENSXETT00000034712.16.609e-7726.06pep primary_assembly:Xenopus_tropicalis_v9.1:9:335... [more]
ENSXETT00000042189.18.627e-7725.95pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rtl11.084e-1523.76retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
Rtl11.084e-1523.76retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04323|POL3_DROME8.864e-10032.12Retrovirus-related Pol polyprotein from transposon... [more]
sp|P20825|POL2_DROME3.378e-9340.53Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q7LHG5|YI31B_YEAST1.433e-8728.52Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomy... [more]
sp|Q99315|YG31B_YEAST1.974e-8728.57Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomy... [more]
sp|P0CT39|TF26_SCHPO6.617e-8729.31Transposon Tf2-6 polyprotein OS=Schizosaccharomyce... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5S6QWV21.291e-16632.62Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5J4NFG72.598e-16234.12Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A5S6PYL22.972e-16231.68Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5J4NKR96.010e-16234.12Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4Y2TRM51.824e-16134.20Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ve... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000045469.14.865e-13933.01pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000041682.14.224e-13833.09pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000054230.11.203e-13532.56pep primary_assembly:Astyanax_mexicanus-2.0:14:194... [more]
ENSAMXT00000041754.11.432e-13132.51pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037150.18.056e-12531.10pep primary_assembly:Astyanax_mexicanus-2.0:10:222... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000009777.11.368e-1019.76pep scaffold:Pmarinus_7.0:GL476990:135790:139231:-... [more]
ENSPMAT00000004123.16.227e-622.67pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 ... [more]
ENSPMAT00000004121.18.108e-622.52pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 ... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO338753.504e-1234.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330902.333e-726.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432565.385e-632.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039099.12.338e-13832.24pep primary_assembly:ASM223467v1:16:31928608:31932... [more]
ENSORLT00000029819.13.420e-13832.24pep primary_assembly:ASM223467v1:24:6358775:636291... [more]
ENSORLT00000032171.11.245e-13731.59pep primary_assembly:ASM223467v1:18:2114932:211795... [more]
ENSORLT00000036827.17.984e-13730.90pep primary_assembly:ASM223467v1:16:28613823:28617... [more]
ENSORLT00000041674.16.810e-13631.82pep primary_assembly:ASM223467v1:5:30088905:300929... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029259.13.404e-1651.54SMESG000029259.1[more]
SMESG000023258.10.000e+098.58SMESG000023258.1[more]
SMESG000023258.10.000e+098.58SMESG000023258.1[more]
SMESG000081257.10.000e+036.85SMESG000081257.1[more]
SMESG000016546.11.576e-12948.96SMESG000016546.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004301 ID=SMED30004301|Name=Transposon Ty3-I Gag-Pol polyprotein|organism=Schmidtea mediterranea sexual|type=transcript|length=4339bp
ATGAGTAAGGGTTGTATGATTTTGAATGATTGTGATAGTTTGAATGATAA
CTGTTGTGATGGTATTTTTGATTATAGAAATTATATTAATATATACATTA
ATAAATTTTGTATGGATGAAGTTTTTAAAGACCCACCCCTAACGTCTAAT
GAACTAAATGTTCTTAATCGTGATAAACGGAATGATATAATAGTATACGA
TAAAATGCAGGGAAGACCCAGTGTTACCGTAATGATTAATAATGTAAAAT
TAGTATGCCTATTAGATACTGGAGCTAAAATAAGTGTGATTGATTATAAT
ATTTTTAAAAAACTTGGAAATTTGAATATGACTACAAGTAATTTAAAATT
AAGATGTGCGAATGATAGCCCGATTGAAATTTGCGGTAAAACTTTATTAA
ATGTAAAAGTTGATAAAATTTCTGATATTAAAAAAGTAGAATTCGTTGTA
GCCAAAGATATAAACCCAAAGTTAATAGGAGGTATAGATTTTCTCGAAAG
ATTTGGAATGCAATTGCAAATAGAAAACCGTACAGACGAAATAAATACAA
TTATGGAAAATTCATTTAAGAACCACATAAGTGAAGATAAGATTATAAAT
AATTTAATTTCCACGTTTGACGGTATTTTTATGAAACATAAATGGGATGT
TGGGAAAACCGAACTATTAAAGCATGAAATACTTACTAAAGGTAGTCCGA
TTGTAATAAACCCAAGACGACAACCTATACATTTAATAGAAAAAATTGAA
GAAAATATTCAAGAAATGTTGAAATATGGCATTATATCAGAATGTACATC
CCCTTGGAATTCTCCGTTAGTATGTGTTAAAAAGAAAAACAGTAGTGATA
TAAGAATATGCTTGGACTACCGTGCATTAAATAATATAACCGAAAGACCG
ATTTTTCCCATTCCAAATACTGATGAATTATTAGATATTCTTGACGGAGC
AAAGTTTTTCTCGACAATTGATTTAGGCAATGCTTATTATCAAGTAGAAC
TCGATGATGCATCAAAATTGAAAACAGCATTTTCGACAAAAAGCAAGCAA
TATTACTTTAACAGAATGCCATTTGGAATAGCAGCCGCACCAGCTACATT
TCAAAGACTTATGAATTTGGTTCTTGGAGAATTAAATTGGAATGGAACAA
TTGTATATCTGGATGATATCCTTATATTTTCAAAGACATTGAATGAACAT
TATAGTACCATTGAAAAGGTTTTTCAAAAGATTAAATTAGCAAATCTTAA
AATAAGTCCAGCAAAATGTCAATTCAAAAGGAAAGAAGTAAAATTTTTGG
GTCATATCATTGGTGAAGATGGAATACGTACGGATGAAAGCAAGATTGAA
ACTATTAAAAATTTTGAAAGACCTAAATGCGTAAAAAGTTTGAGAGGATT
TTTAGGCTTGGCAAATTACTATCGCAAATTTATAGAAAATTACACCAAAG
ATTCCAAAGTATTAGAAGCGTTATGTGGAAGTAAACAAAAGAAGCTTATG
TGGACTGATGAGTGTGAAACTTCATTTAAAAATTTAAAACTGAAATTGAC
GTCTACACCTGTATTGAAGTTCCCAGATTTTTCTAAGCCATTCATTTTGG
ATACAGATGCAAGTTTTGACCGCATTGGTGCTGTTCTGTCTCAAAAAGAT
GGAGGTAAAGAAAGAGTAATCGCATATGGATCCCGAGCTATGAATAAACA
CGAGTTGGGTTATTGTATAACAAGAAAGGAATTACTATCTATATTTTATT
TTACTGGTCATTTTAAGCATTATCTATATGGTAAAAAGTTTATTTTGAGG
ACGGATCACAAAGCCATTACATTTATGATGAAGACAAAGAAAGCTATTAC
CCCACAATTTCAAACTTGGATTAACCATCTTAGTGGTCTGGACATGGAGA
TTCAATACAGAAAAGGTGATAACCACAATAATGCCGACGCTTTATCTAGA
AAAGAATGTGAAACATGTGTTCAATGTCAAATGATTCATGAAAATCCTAA
AATGGGTAAATTAAAAACAAGATTGTTGACACTGATGACTGATAATATTG
AAAATATATGGCAAAAGAACTCGAAAGAAATTGAAAATATAAAAGAAAAT
ATTAGTTTGATGCCAGATAAAACATTTTATAAATATGTCAACGGAGTGAT
TATGACAAATAATAATAAAATTTGGATTCCAGAAGAAAACAAGTCTGAAT
TCATCATAGAATATCATAAAAAGCTCTGTCACGCGGGTGCTAATAAAGTA
AAAATGTATGTATCAAACAATTTTGATATGAAAGATTTGGAGCAATCTAT
TCGTAATGTTGTACAATCCTGTGAAAACTGTCAGAAAAGAAAGGTTGATA
CAACTAAAACAAAAGAAGAAATAATTTGCAAAAGTGATTCGAAATTATTT
GAAACAATATATGTAGATTTCTGTGGTCCATTACAACTTGCAATGAAAGG
AGAAAGATATATTCTTGGGATTATAGATCATCATAGTAAGTTTATTTCTT
TACATGCAGTGAAATCACAAGATGAAAAAACAGTGGTAAGATTACTGAAA
GAAGAGTGGATAATGAAGTATGGAGCACCAAGGATAATAAACTGTGACAG
AGGTAAATCATTTGAATCAAAGCTAATGAAAGATTTTGCAGAATTCCACA
ATATTGAAATTAATTATTCAAGTCCATATCATCACTCAGCAAATGGACAG
ATTGAGAGACAATTCCGTACAATCAGAGATGCAATACAGATAACACTCAA
AGATAAAAGACATAAATCATGGGTAGATATTCTTCCCGAAGTTCAGTTTA
TGTTGAATTCAACTTTTCAAAAAACTATTAGGAAGACTCCAGCTGAAATG
GTGTTTGGGAAAAAGATTTATAGTGAATGGTTCTCAGAGATTGTGGAAGA
AGAAAAAACCAATCAGCCGACAAATCGCGAATTTCAAATTGGAGATTGCG
TATTGATCAAAGTAAATGTTCGAAATAAAGGTGATAACAGATACATGGGT
CCAGGTGTGATTACTAAAAAGATTCATGATCGAAGTTATGAAATAAAATT
GGAAAATGGAAGTTCCGTCACGAGAAATATTGAGTGGTTAAAGGTTTTCA
AAAAGGGGGGGATGTGAGGCGTTTTATAATTTGTATTTAAATAATGGTAT
GATGTTGGGCATGTTTGATTGTATGTTGAAATCCTTACTTATTCATTAAT
TATTATTTTTTAGAAACTCCTCAAACAAATTAACGATATAATTTGTTTTA
ATAATATTTGTGTTTTGATAATAAACGTGTTTTAGTTATGGATTCTATTA
ATACCCGTAGCTCTGTGGCTAATATGGCGACCACGATTGCAAATTTTATC
AAGCCACCAGAAACATATGACATGGATTCAGACGTGGAAGATTTTATCTT
AGAAACGGAACGATTCTTCGAGATGACAAATATTGTCGATGAATACAGAA
GCAAATTCGTCAAAGCTTTTCTATCAATCAATTCAACGAAGAAATATGAG
TTGACTAATGAAACTCTGCATTATACAGAAAGATTAAGAAACGCTTTTTC
TAAGAACAGAAGTCTTATCGATGATCTCAACGAAGCGCTAAATTATCGTC
AAGGAAATGAGGCTGCCGAAGAATTCTGCTCAAAAATTGAGAAACTTGCA
AAAAATATTTTGAAGCATAAACTTGATGAAGAAGAACTAAAGAAATTTTT
GCTATTCAATTCGCTTGAAGATAAAGAAGTTAAAAAAGATCTCAAAATGC
AAGATTTAAAATCATTTGATGAAATGAAAGAAAGATTAAAGAGACACGAT
CAAGTTTCAAAAGAAATTAATGTATTTCATGCTGATGTAGCTTCAATGAA
TAAAACACAACGCTATGCTGATGCTGTTAAGAAGAGCTTACCAAGATATA
ATTATGATAACAGATCAATTCGAGAACGAGAAGCTAACCCCAGATTCAAA
GATGAATATACAAGAGAACCTCAACATAATCCAAGATTCAAAGGCGATCT
TACCAGAGAACATCGATATGCTATTTCAAATGGATGGAGACCTATGAATA
GGAGTAAGCCTTATAATACCAGGGAATTTCATTCGCGAGATCATATCCGA
ACAAATCAAATTTTGCGATGTTGGGCGTGCCACGAAGAAGGTCATAGAAG
ATCTGAATGCTCCAATATTCAATGTGCCCATTGTAAAAGATCTGGACATT
TCAAACATCAGTGCCATGAGTTATTTCCAGGCAGACGTCGAAAATTCCAT
AAATCAGTGGCTGCATTCGGTGACGAGGATCCAGAGGCTGATTTTGAGTA
CCCAAATGGGAATGCTCCACAACACGAGGAGGTGATCGG
back to top

protein sequence of SMED30004301-orf-1

>SMED30004301-orf-1 ID=SMED30004301-orf-1|Name=SMED30004301-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1039bp
MSKGCMILNDCDSLNDNCCDGIFDYRNYINIYINKFCMDEVFKDPPLTSN
ELNVLNRDKRNDIIVYDKMQGRPSVTVMINNVKLVCLLDTGAKISVIDYN
IFKKLGNLNMTTSNLKLRCANDSPIEICGKTLLNVKVDKISDIKKVEFVV
AKDINPKLIGGIDFLERFGMQLQIENRTDEINTIMENSFKNHISEDKIIN
NLISTFDGIFMKHKWDVGKTELLKHEILTKGSPIVINPRRQPIHLIEKIE
ENIQEMLKYGIISECTSPWNSPLVCVKKKNSSDIRICLDYRALNNITERP
IFPIPNTDELLDILDGAKFFSTIDLGNAYYQVELDDASKLKTAFSTKSKQ
YYFNRMPFGIAAAPATFQRLMNLVLGELNWNGTIVYLDDILIFSKTLNEH
YSTIEKVFQKIKLANLKISPAKCQFKRKEVKFLGHIIGEDGIRTDESKIE
TIKNFERPKCVKSLRGFLGLANYYRKFIENYTKDSKVLEALCGSKQKKLM
WTDECETSFKNLKLKLTSTPVLKFPDFSKPFILDTDASFDRIGAVLSQKD
GGKERVIAYGSRAMNKHELGYCITRKELLSIFYFTGHFKHYLYGKKFILR
TDHKAITFMMKTKKAITPQFQTWINHLSGLDMEIQYRKGDNHNNADALSR
KECETCVQCQMIHENPKMGKLKTRLLTLMTDNIENIWQKNSKEIENIKEN
ISLMPDKTFYKYVNGVIMTNNNKIWIPEENKSEFIIEYHKKLCHAGANKV
KMYVSNNFDMKDLEQSIRNVVQSCENCQKRKVDTTKTKEEIICKSDSKLF
ETIYVDFCGPLQLAMKGERYILGIIDHHSKFISLHAVKSQDEKTVVRLLK
EEWIMKYGAPRIINCDRGKSFESKLMKDFAEFHNIEINYSSPYHHSANGQ
IERQFRTIRDAIQITLKDKRHKSWVDILPEVQFMLNSTFQKTIRKTPAEM
VFGKKIYSEWFSEIVEEEKTNQPTNREFQIGDCVLIKVNVRNKGDNRYMG
PGVITKKIHDRSYEIKLENGSSVTRNIEWLKVFKKGGM*
back to top

protein sequence of SMED30004301-orf-2

>SMED30004301-orf-2 ID=SMED30004301-orf-2|Name=SMED30004301-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=350bp
MDSINTRSSVANMATTIANFIKPPETYDMDSDVEDFILETERFFEMTNIV
DEYRSKFVKAFLSINSTKKYELTNETLHYTERLRNAFSKNRSLIDDLNEA
LNYRQGNEAAEEFCSKIEKLAKNILKHKLDEEELKKFLLFNSLEDKEVKK
DLKMQDLKSFDEMKERLKRHDQVSKEINVFHADVASMNKTQRYADAVKKS
LPRYNYDNRSIREREANPRFKDEYTREPQHNPRFKGDLTREHRYAISNGW
RPMNRSKPYNTREFHSRDHIRTNQILRCWACHEEGHRRSECSNIQCAHCK
RSGHFKHQCHELFPGRRRKFHKSVAAFGDEDPEADFEYPNGNAPQHEEVI
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001878Znf_CCHC
IPR000477RT_dom
IPR001584Integrase_cat-core
IPR012337RNaseH-like_sf
IPR021109Peptidase_aspartic_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.506