SMED30004300

Overview
NameSMED30004300
Smed IDSMED30004300
Length (bp)7432
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004300

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30004300SMESG000027003.1 Contig54405newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004300SMESG000027003.1 Contig54405uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30004300 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000660:87165..96253 +37121
Homology
BLAST of SMED30004300 vs. Planmine SMEST
Match: SMESG000027003.1 (SMESG000027003.1)

HSP 1 Score: 1065.06 bits (2753), Expect = 0.000e+0
Identity = 639/1043 (61.27%), Postives = 751/1043 (72.00%), Query Frame = 2
Query:   47 MAWQCKHSLFMLCTRPSTRKECALDVANKLIDMVVHSYIMKSIARPLTTELAMMDFSHKDLFMSDFMKELCNFKSIEDLLVNMSMKYSSLTPIKQNVEDIKVKDSDRSDETELKLNKFLSGITESELNIPQIEGEQHVSIKEVEFKAGQIIDEPLSRIEEKNEPIIIDDSSKQNKEEAILHVSVDKLKEIKSSCIDSELNVGNLKYPSVSEKIVNQNKDANLDNYLQSLLNSEQKEDNLHDIQEDEVVQKNKTSNVTISQPDEPCVPFTFESDIYHVERTEEISKDFEEQYNSYEVXXXXXXXXXXXXXXXXXXXXCLLNSQRDEETFPDIHDDNQVRMSESSGCIVSESKGEHMSSSEDYMRSVCYINETNLTSDIILERDFFDNETKFKADEITNKNLERIPANEDYPLVIDNLTIKDRNLTMEEKDVISNSSAKKQSFTKESEVKYEVSETKFLALDKKDSCKSFPLDYSSNADIISEKFIDYPLVVGHQSIRDETLIREDKDLIADSSGKKESFTKESQVKYEVSEIASLTLDKKESCKSFPVDYSSNVCIISEKVVDQTFDNKSKSVEIMERNEEALIIDSDLKFDLCQTLVTTSVEKEVSHGSMDLERYLVKDKILDEPEHLNSQQDLKPTGFDQQRDEDNRVINTEVADETKLKFEQEALKNDQISLSIIRENKDFMSSQKEIEFETCQTVDINSIQKQESYSSF-------KAQIQIDAENMSTQQDGQNLNHPLITDLENNENTLIQNTDASMEIYQTPEMSSGKSKESGLYFVLEDP-FMHNESKEKTEDRNIPD-DQLPKKTSEKSNESGLYFVLEDPFLLSKNTMKTDENILPDQVSLSIVQENKDFQNSKNEIEFEACQSTDLLSNQKQESYSSFKLDHEIREDNVPEQLDDQSSLVNPLWISNIDETEKSPIQNTDVNFEICQIPEIQVTLTEKSNLSYVVEDSVIPNQSTLKTEDDNIQNDPMSLMVVQGRQDLLTSHNEVEFEACQTNDLHLNKRNERYSSLKADNNIEEDPFTTRLEERDLETKPL 3148
            MAWQCKHSLFMLCTRPSTRKECALDVANKLIDMVVHSYIMKSIARPLTTELAMMDFSHKDLFMSDFMKELCNFKSIEDLLVNMSMKYSSLTPIKQNVEDIKVKDSDRSDETELKLNKFLSGITESELNIPQIEGEQHVSIKEVEFKAGQIIDEPLSRIEEKNEPIIIDDSSKQNKEEAILHVSVDKLKEIKSSCIDSELNVGNLKYPSVSEKIVNQNKDANLDNYLQSLLNSEQKEDNLHDIQEDEVVQKNKTSNVTISQPDEPCVPFTFESDIYHVERTEEISKDFEEQYNSYEVNDETKLLNKNKDKTLENDLKCLLNSQRDEETFPDIHDDNQVRMSESSGCIVSESKGEHMSSSEDYMRSVCYINETNLTSDIILERDFFDNETKFKADEITNKNLERIPANEDYPLVIDNLTIKDRNLTMEEKDVISNSSAKKQSFTKESEVKYEVSETKFLALDKKDSCKSFPLDYSSNADIISEKFIDYPLVVGHQSIRDETLIREDKDLIADSSGKKESFTKES+++ +V  +   ++  KE       DY  N+  +     +   ++K K +   E  +E+   +S +K+++ +    T                      LD+ E   S        F      +  +I+ +V D+T          N   S+ I+  N++ +    +++F+ CQT+   S++K+ S+ S        K +I  + E++++QQD +    P   D + +E+  + NT+ + E     E  + K+ +  L  + E+  FM ++ + + E     D + + K+ S  S ++ +    E+      +T +  +N+    ++     EN   QN+  +   E  Q+ ++ S + +ES   F L+     +   E+ +D+                         N    Q+P+     + +S L +V+ED  + +++T+KT D+NI  D +SL +VQ  +D   S NE+EFEACQ+ DL  N++ E YSS K D+ I ED    +L+++     PL
Sbjct:    1 MAWQCKHSLFMLCTRPSTRKECALDVANKLIDMVVHSYIMKSIARPLTTELAMMDFSHKDLFMSDFMKELCNFKSIEDLLVNMSMKYSSLTPIKQNVEDIKVKDSDRSDETELKLNKFLSGITESELNIPQIEGEQHVSIKEVEFKAGQIIDEPLSRIEEKNEPIIIDDSSKQNKEEAILHVSVDKLKEIKSSCIDSELNVGNLKYPSVSEKIVNQNKDANLDNYLQSLLNSEQKEDNLHDIQEDEVVQKNKTSNVTISQPDEPCVPFTFESDIYHVERTEEISKDFEEQYNSYEVNDETKLLNKNKDKTLENDLKCLLNSQRDEETFPDIHDDNQVRMSESSGCIVSESKGEHMSSSEDYMRSVCYINETNLTSDIILERDFFDNETKFKADEITNKNLERIPANEDYPLVIDNLTIKDRNLTMEEKDVISNSSAKKQSFTKESEVKYEVSETKFLALDKKDSCKSFPLDYSSNADIISEKFIDYPLVVGHQSIRDETLIREDKDLIADSSGKKESFTKESEIRRKVKSLNPESMSDKE-------DYPLNIDNLPTSGENLIVEDKYK-LSDSEGKKESFTKESQVKYEVSEIASLT----------------------LDKKESCKS--------FPVDYSSNVCIISEKVVDQT--------FDNKSKSVEIMERNEEALIIDSDLKFDLCQTLVTTSVEKEVSHGSMDLERYLVKDKILDEPEHLNSQQDLK----PTGFDQQRDEDNRVINTEVADETKLKFEQEALKNDQISLSIIRENKDFMSSQKEIEFETCQTVDINSIQKQESYSSFKAQIQIDAEN-----MSTQQDGQNLNHPLITDLENNENTLIQNT--DASMEIYQTPEMSSGKSKESGLYFVLEDPFMHNESKEKTEDR-------------------------NIPDDQLPKKTSEKSNESGLYFVLEDPFLLSKNTMKT-DENILPDQVSLSIVQENKDFQNSKNEIEFEACQSTDLLSNQKQESYSSFKLDHEIREDNVPEQLDDQSSLVNPL 960          
BLAST of SMED30004300 vs. Planmine SMEST
Match: SMESG000027003.1 (SMESG000027003.1)

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 629/1033 (60.89%), Postives = 741/1033 (71.73%), Query Frame = 2
Query:   77 MLCTRPSTRKECALDVANKLIDMVVHSYIMKSIARPLTTELAMMDFSHKDLFMSDFMKELCNFKSIEDLLVNMSMKYSSLTPIKQNVEDIKVKDSDRSDETELKLNKFLSGITESELNIPQIEGEQHVSIKEVEFKAGQIIDEPLSRIEEKNEPIIIDDSSKQNKEEAILHVSVDKLKEIKSSCIDSELNVGNLKYPSVSEKIVNQNKDANLDNYLQSLLNSEQKEDNLHDIQEDEVVQKNKTSNVTISQPDEPCVPFTFESDIYHVERTEEISKDFEEQYNSYEVXXXXXXXXXXXXXXXXXXXXCLLNSQRDEETFPDIHDDNQVRMSESSGCIVSESKGEHMSSSEDYMRSVCYINETNLTSDIILERDFFDNETKFKADEITNKNLERIPANEDYPLVIDNLTIKDRNLTMEEKDVISNSSAKKQSFTKESEVKYEVSETKFLALDKKDSCKSFPLDYSSNADIISEKFIDYPLVVGHQSIRDETLIREDKDLIADSSGKKESFTKESQVKYEVSEIASLTLDKKESCKSFPVDYSSNVCIISEKVVDQTFDNKSKSVEIMERNEEALIIDSDLKFDLCQTLVTTSVEKEVSHGSMDLERYLVKDKILDEPEHLNSQQDLKPTGFDQQRDEDNRVINTEVADETKLKFEQEALKNDQISLSIIRENKDFMSSQKEIEFETCQTVDINSIQKQESYSSF-------KAQIQIDAENMSTQQDGQNLNHPLITDLENNENTLIQNTDASMEIYQTPEMSSGKSKESGLYFVLEDP-FMHNESKEKTEDRNIPD-DQLPKKTSEKSNESGLYFVLEDPFLLSKNTMKTDENILPDQVSLSIVQENKDFQNSKNEIEFEACQSTDLLSNQKQESYSSFKLDHEIREDNVPEQLDDQSSLVNPLWISNIDETEKSPIQNTDVNFEICQIPEIQVTLTEKSNLSYVVEDSVIPNQSTLKTEDDNIQNDPMSLMVVQGRQDLLTSHNEVEFEACQTNDLHLNKRNERYSSLKADNNIEEDPFTTRLEERDLETKPL 3148
            MLCTRPSTRKECALDVANKLIDMVVHSYIMKSIARPLTTELAMMDFSHKDLFMSDFMKELCNFKSIEDLLVNMSMKYSSLTPIKQNVEDIKVKDSDRSDETELKLNKFLSGITESELNIPQIEGEQHVSIKEVEFKAGQIIDEPLSRIEEKNEPIIIDDSSKQNKEEAILHVSVDKLKEIKSSCIDSELNVGNLKYPSVSEKIVNQNKDANLDNYLQSLLNSEQKEDNLHDIQEDEVVQKNKTSNVTISQPDEPCVPFTFESDIYHVERTEEISKDFEEQYNSYEVNDETKLLNKNKDKTLENDLKCLLNSQRDEETFPDIHDDNQVRMSESSGCIVSESKGEHMSSSEDYMRSVCYINETNLTSDIILERDFFDNETKFKADEITNKNLERIPANEDYPLVIDNLTIKDRNLTMEEKDVISNSSAKKQSFTKESEVKYEVSETKFLALDKKDSCKSFPLDYSSNADIISEKFIDYPLVVGHQSIRDETLIREDKDLIADSSGKKESFTKES+++ +V  +   ++  KE       DY  N+  +     +   ++K K +   E  +E+   +S +K+++ +    T                      LD+ E   S        F      +  +I+ +V D+T          N   S+ I+  N++ +    +++F+ CQT+   S++K+ S+ S        K +I  + E++++QQD +    P   D + +E+  + NT+ + E     E  + K+ +  L  + E+  FM ++ + + E     D + + K+ S  S ++ +    E+      +T +  +N+    ++     EN   QN+  +   E  Q+ ++ S + +ES   F L+     +   E+ +D+                         N    Q+P+     + +S L +V+ED  + +++T+KT D+NI  D +SL +VQ  +D   S NE+EFEACQ+ DL  N++ E YSS K D+ I ED    +L+++     PL
Sbjct:    1 MLCTRPSTRKECALDVANKLIDMVVHSYIMKSIARPLTTELAMMDFSHKDLFMSDFMKELCNFKSIEDLLVNMSMKYSSLTPIKQNVEDIKVKDSDRSDETELKLNKFLSGITESELNIPQIEGEQHVSIKEVEFKAGQIIDEPLSRIEEKNEPIIIDDSSKQNKEEAILHVSVDKLKEIKSSCIDSELNVGNLKYPSVSEKIVNQNKDANLDNYLQSLLNSEQKEDNLHDIQEDEVVQKNKTSNVTISQPDEPCVPFTFESDIYHVERTEEISKDFEEQYNSYEVNDETKLLNKNKDKTLENDLKCLLNSQRDEETFPDIHDDNQVRMSESSGCIVSESKGEHMSSSEDYMRSVCYINETNLTSDIILERDFFDNETKFKADEITNKNLERIPANEDYPLVIDNLTIKDRNLTMEEKDVISNSSAKKQSFTKESEVKYEVSETKFLALDKKDSCKSFPLDYSSNADIISEKFIDYPLVVGHQSIRDETLIREDKDLIADSSGKKESFTKESEIRRKVKSLNPESMSDKE-------DYPLNIDNLPTSGENLIVEDKYK-LSDSEGKKESFTKESQVKYEVSEIASLT----------------------LDKKESCKS--------FPVDYSSNVCIISEKVVDQT--------FDNKSKSVEIMERNEEALIIDSDLKFDLCQTLVTTSVEKEVSHGSMDLERYLVKDKILDEPEHLNSQQDLK----PTGFDQQRDEDNRVINTEVADETKLKFEQEALKNDQISLSIIRENKDFMSSQKEIEFETCQTVDINSIQKQESYSSFKAQIQIDAEN-----MSTQQDGQNLNHPLITDLENNENTLIQNT--DASMEIYQTPEMSSGKSKESGLYFVLEDPFMHNESKEKTEDR-------------------------NIPDDQLPKKTSEKSNESGLYFVLEDPFLLSKNTMKT-DENILPDQVSLSIVQENKDFQNSKNEIEFEACQSTDLLSNQKQESYSSFKLDHEIREDNVPEQLDDQSSLVNPL 950          
The following BLAST results are available for this feature:
BLAST of SMED30004300 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004300 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000027003.10.000e+061.27SMESG000027003.1[more]
SMESG000027003.10.000e+060.89SMESG000027003.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004300 ID=SMED30004300|Name=SMED30004300|organism=Schmidtea mediterranea sexual|type=transcript|length=7432bp
ATTTTTTAATTTTTTATTATTAAGTTAAGAATTATTTCTTTCTTTCATGG
CGTGGCAATGCAAACATAGCCTTTTTATGTTATGTACTCGTCCATCGACT
AGAAAAGAATGCGCTCTAGATGTAGCAAATAAATTAATTGATATGGTGGT
TCACTCGTATATAATGAAATCCATTGCTCGACCCTTAACAACAGAATTAG
CAATGATGGACTTTAGTCATAAGGATCTCTTTATGTCGGACTTTATGAAA
GAGTTATGTAACTTTAAATCTATCGAAGACCTCTTGGTTAATATGTCAAT
GAAGTATTCATCCTTGACTCCTATTAAACAAAATGTTGAGGACATCAAAG
TCAAAGACTCTGACAGATCAGACGAAACTGAATTGAAACTTAATAAATTT
CTATCAGGAATTACTGAGTCTGAGTTAAATATACCTCAAATAGAAGGTGA
GCAACATGTCAGTATTAAAGAAGTTGAATTCAAGGCAGGACAAATTATTG
ATGAACCTTTAAGTCGAATTGAAGAGAAGAATGAGCCTATTATAATTGAT
GATTCGAGTAAACAGAATAAGGAAGAAGCTATTCTACATGTGTCAGTTGA
CAAACTAAAAGAAATTAAAAGTTCATGTATTGACAGCGAACTAAATGTTG
GCAACCTCAAATACCCTTCCGTTTCAGAGAAAATTGTCAATCAAAATAAA
GATGCAAACTTAGATAATTATTTACAATCTCTTTTAAACTCGGAACAGAA
AGAGGATAACCTTCATGATATACAAGAAGACGAAGTAGTGCAAAAGAATA
AAACCTCCAATGTCACTATATCGCAACCAGATGAACCGTGTGTGCCCTTT
ACTTTTGAGTCAGACATATACCATGTAGAAAGGACAGAAGAAATATCAAA
AGATTTCGAAGAACAGTATAATTCTTATGAAGTCAATGATGAAACAAAAC
TTTTAAACAAGAATAAAGACAAAACCTTAGAAAATGATTTAAAATGTCTA
TTAAATTCTCAGCGGGATGAAGAGACTTTTCCTGATATTCACGATGACAA
CCAAGTGCGAATGAGTGAGTCTTCTGGCTGTATCGTATCCGAATCGAAGG
GAGAACACATGTCTTCTTCGGAGGATTATATGCGAAGCGTGTGCTATATA
AATGAGACAAATCTGACCTCCGATATTATATTAGAAAGGGATTTTTTTGA
CAATGAAACAAAATTCAAAGCTGACGAAATCACGAATAAGAATCTAGAAC
GTATACCTGCTAATGAAGATTATCCTTTAGTTATAGATAATTTGACTATT
AAAGATAGAAATTTGACCATGGAAGAAAAAGACGTGATATCTAATTCTTC
AGCAAAAAAACAGAGTTTTACTAAAGAAAGTGAAGTAAAATATGAAGTCT
CAGAAACTAAGTTTTTGGCATTAGATAAAAAGGATAGTTGTAAATCTTTT
CCTCTTGATTATTCATCAAACGCAGATATAATTTCAGAAAAGTTTATAGA
CTATCCATTAGTTGTAGGTCATCAGTCGATAAGGGATGAAACCTTAATCA
GGGAAGATAAAGATTTGATAGCTGATTCTTCGGGAAAGAAAGAGAGTTTT
ACTAAAGAAAGTCAAGTAAAATACGAAGTCTCAGAAATTGCCTCTTTGAC
ATTAGATAAAAAAGAAAGTTGTAAATCTTTTCCCGTTGACTATTCCTCAA
ACGTATGTATCATTTCAGAAAAGGTAGTTGACCAGACCTTTGATAATAAA
TCAAAATCCGTAGAGATAATGGAAAGAAATGAGGAAGCGCTTATTATTGA
TAGTGATTTGAAATTTGATTTATGTCAGACTTTGGTAACGACTTCCGTTG
AAAAGGAAGTAAGTCATGGATCAATGGATCTAGAAAGGTATTTGGTCAAG
GATAAAATATTAGATGAGCCCGAACATTTAAACTCACAGCAAGATTTAAA
ACCAACTGGTTTTGACCAACAAAGGGATGAAGATAATCGTGTCATTAACA
CTGAAGTTGCGGATGAAACCAAACTGAAATTCGAACAGGAAGCTCTCAAA
AACGATCAAATATCTTTATCTATTATCCGAGAGAATAAAGATTTTATGAG
TTCACAAAAGGAGATTGAGTTTGAAACATGTCAGACCGTGGATATTAATT
CAATTCAGAAACAAGAAAGTTATTCCTCATTTAAGGCTCAAATTCAAATT
GACGCAGAAAATATGTCAACGCAGCAAGATGGCCAGAACCTCAACCATCC
TTTGATTACTGATCTAGAAAACAATGAAAATACTTTAATTCAAAATACTG
ATGCAAGTATGGAGATATACCAAACACCGGAAATGTCGTCAGGCAAATCA
AAAGAAAGTGGATTGTATTTTGTACTTGAAGATCCATTTATGCACAATGA
AAGTAAGGAAAAAACTGAGGATAGAAACATTCCAGATGATCAACTACCGA
AGAAGACATCAGAAAAATCAAATGAGAGTGGATTGTATTTTGTACTCGAA
GATCCATTTTTACTTAGTAAAAATACTATGAAAACCGATGAAAACATTCT
ACCAGATCAAGTGTCTTTATCCATAGTTCAAGAGAACAAAGACTTTCAAA
ACTCAAAGAATGAGATTGAGTTTGAAGCATGTCAGTCTACTGATCTACTT
TCTAATCAAAAACAAGAAAGTTATTCATCATTCAAACTTGATCACGAAAT
TAGAGAGGATAACGTACCTGAACAGTTAGATGACCAAAGTTCGTTAGTTA
ATCCTCTTTGGATTTCTAATATAGATGAAACCGAAAAATCTCCAATTCAA
AATACTGATGTAAATTTTGAAATATGTCAAATACCAGAGATTCAAGTGAC
ACTTACAGAGAAGAGCAATTTATCTTATGTAGTCGAAGATTCAGTCATAC
CTAACCAAAGCACACTAAAAACGGAAGATGATAACATTCAAAATGATCCA
ATGTCCTTGATGGTTGTTCAGGGGCGTCAAGATCTTCTAACGTCGCATAA
CGAGGTTGAGTTTGAAGCCTGTCAGACAAATGATTTGCATTTGAACAAAC
GAAATGAGAGATACTCATCCTTGAAGGCGGATAATAATATTGAAGAAGAT
CCTTTTACGACACGATTGGAAGAAAGGGATTTAGAAACTAAACCTTTGGT
TCATTATTTCGAAAAGAACAAAGATTTAAAACAAATGCCCAGCAATATAC
AACAGGAAATTTGTCATTTATCAGACAAAGTCTCAATTATAAACGAAGAA
AGTTTCTCATCTTTTAACTGTGAAAACGTTCAAACTAGTGAAAATCTTTC
GGAAAACAAAGAAGATATATCATGCAATTTGGAACAAAAAGATTCGAAGG
CATTGGATAATGAAATCGATATAGAAGCAGGCCAACCAGCTGAATGGAAT
GACACAGAAAAGGAAAGTTCACCATCTCTCAATCCAGACCTTCTGATTAG
AGATGACGAGGCATCTATAAGAAGAGAATTGTATAATCTAGAACTGAATG
AAGATGAAATATCTGGAATTAAACTGGAACACGGTTCAACTTTAGATAGT
GTTAAAAAGAATAATACTGAAAAGCATATTGAAATAAGTCAAACAAATCC
TGAGATATCTGGATCAGACAAACCAGGTCTTACGGATAAAAAAAATAGTG
CCAACTTTACATTGGATTACCCTTTGGTCACAAGTAATCATGATACCAAT
GCTGCAAAACTTGATATTTCAGATCTTCAAGTACAGGAAAATGAAGTAAT
GGTAAACAACTTTAAATATGAAGAGTCTCAAACTCCAGATTTGATGTTGA
AACAGAGACAAACAAGTTGTATGTCCTTTTCTGTAGATTATCTTCCATCA
GTTGAAGGAGCGTCAGTGAAGGCTGAAGACAAAGATATAGACGTTCTGTT
ATCTCAACTGATACAAAACCTGTCAGAAAACTTTGAAAATGAAAATAAGA
TAGAACCTGATATATCAAATTCGGTTGACTGTAACTTTTGTAGCACTGAT
GACAATGTCAAGGATAGTTCTTGTGTTGATGATCCATGCAACGAATGCTC
GGATCATGGTGAAGGCTTTAAACAGTCAAGTATTGGAGACTTTATTGTAC
TAATTTGTTCAGAAGATTCTGATGAAATAGATCGGCAGAAAAAGAATATA
CACTTAGATGAGCCATTTCGGATTTCAATTACATTCGACAACCGAGAAAT
TTATACAAATCAAACAAATCTAGAACTAGACTCGTTAATTCCCGGGCACA
AATCCAAGGATAGAGAAAGAGATGAGCAGGGTTTCAGTCCAGGAATGGCA
ATTCAAGAATTAATTACAAAAGATAAAGATGAGTACGAAATAAACGATAT
GCATAACGAAAACAAAATATCTGAAAAAAACAATATCACTGAATCGGTTA
TTGAAAAGGTAGACAACTTTCAAGAGGTCGTGTACAGGAAGCCAGTAAAT
TATCAAAACCAACCAAAATATTTAGACAGGAAAGATTCTCAAGTGCATGC
CATGAAAATAAGCAACTTCTGCGATATTTCAGACATTTTTGATGAAAGTG
AAAATCTAAACACAACGACTGGTTTCCATATGCCAAACACTGTTTCAGAA
TTCCACCATCGGGATTTGAATTCTATTGAACATAGTCTTGCAGAAGACGA
GTTCAAATCCATTTCACAGCTACAAATGAAAGATATAATTCCCAAAACCT
TTGATGACAATGAACAAACCCTTGAACAAATCTTTATAAGTTGTTCTCAC
TTTATTTTGGAATTTACGATAGAAAAGTATATCTTTGAATCCATTTATTC
AATAGTCGAGTCTGCCGGAAAGAGTGAGATACATCAAAAATACAAGAAAG
AAGAAATTCATAAATCTTGGGAAAATTTAAATGTAACTCACAACGAATTT
TCAACAAAGGCCTGGATCGGTTCGCTTAATACTCCTGAACAAACCCTAGA
AACAAACTTTGTACAATTCAATGAACTCTCAAACGTTACTTTATCTGGTG
TCAACTTTGAGTCTCAACTACACATTGCAACTTTGGATTCAAATACCTTG
GTATATGCCCAAGTTACAAGCGACATGTCGGAAAATGTGCTGGACGAAAC
CATCATATCTTGGATATTGAAAAAGCAAGCTCTGAATGAAATAGTAGACG
AATTTCTCAACGAAAGGTTATCTTCAATCTGGTCGGACATACGGATATAT
TTGAAATTAGTTATCTCTATAGACTTGAAGGAATTACAAACCGCTTCCAA
TGATTGTATAAAGTTCAATGATGATTCTTTGGGTATGATTGAGCTTTCTG
AAAGTAGAATAAATGCACTAAACTTTGAGAATCTCAAAAAAGAGGCACAG
GAAATCTCATTGAAGTTAGAATCGTCAATTCGCCAAAGTATGCATAAAAA
GACTGAATTGGGAGATAGAAATTTAAAAAACCAGTTCGATGAGGCGTGTC
CAAGAATCAAATGTCTAGGGACAAGTTTCTCCACCAGTAAAAGTGTCAAA
AAAATTACCGACGAATATCACGATATAAAGTTGCTTGACATAAGAATCAA
ATCCGAATGTGAAATAATAAAAACGATTTCCAAGCATATTTCTTCATCGG
AAGTCCACAATATTGATCTGATCAACAGTTCAATCAATACTATTGTGGAC
GATGAAATCAATGAACCGGAACTCTTTCATCCAACCAAATCGATGAATCG
AATTAATATAAAGCCTTTGAACGTTACCGAAGAAACCTCAATTAAAGAAA
AGGTATTACTCGAAACGCCAAATGAAGAGACAAGCAACATATACAGATTA
TCAGAAAACACACCAGTGAACAATCCATCATTCTCGTCATTGTCTACGTA
TGGTCTTGCGGACGTTTCGTCGACAAAACCCTATACGAATGAAACGCTCA
TTAATGTATATGTTGAAAATATTCAAGTTTTCAAGAAAACAATCCTGGAA
AATAGAGATCAACATAAAATCGAATCCGAAAATATTTCAATCCTCACATC
AATACCAAAGAAGACTGGAATACCTAATTCTGAACCTTTTCTCGAGGAAG
CGCTGGAAAAGAATCCCAATTCAAAACCGGATTACTTTTTTTATTCTTCA
GAATCTCAAATCAACTTAAACCTTTCCATGACGACGATTGAGAAACCCGA
AAACATCGCCGAACGTGAAATTTTTATTTATAACTTCTACGAAAACGAAA
GTCTAGAAATCATTTCAGAAAACGAAAGAATCAATATTTTAGCATTTATA
GAAACTATAATAATAGAAAACGTCTTCGAAAAATACCAAATGGAAAATCA
GAGTGTCTTTCAGATTCTAGTCGCAATAGTCAACGATTTGGAATCTGAAT
TGTGGTACTTGGATTCTTTCTTGGTCGTGAAAGCGAAATATTCAGAAAAA
AAAGAGAAAGAAAAGAAATTTAAATCACCGGAAAACGAATCGGATCTTGG
AAATGAAATTTTAGAAATTGACAATTATCGGAATTGCGTAACGGAAGAAG
AAGAATACGGAAAAGATTCTCGAAGCATCGAGGAGGATAAAGACAACTCC
AGCAGTTACAAGACCATTGAGATTTGTTCTCTGACCAGCAGTTCTACAAA
TAATCAAAATCTTTTTCAAAACTTGTCAAATAAATATAATATTTTCGACA
TTTTCTCCATAGACATTCTCAGAAATTCCAAGTCGATTATTCTCTCGTTG
AATTCCAGAGAAAAGGCAAACTCGTTTCTCATAAACCGGAAACCCGGCAA
CAATTTCAATGGAGACAATTCTTTTAGAATCACACAGAACTTGATTCGGC
ATTTGTGCTTGGAGTTGAATAGGAATCTCCGAGCGCAATATCCGGTTTTG
ACATCCTTTAAATTTGCCGGCTATGAAAATCATTCGAATGGAAAATTTAC
TTTGAAATTCTCGAATAAATTTTCACCATTCGACATGAAATTGAGAGAAA
ATTCTGGGAAATATTTGTTGAGTGGAGAAAACGATTTGTCAATTGTGGAA
ACTGATTCTAGCCGTTTGCAGACGGTTCGTAGAGAAAACAGTCGGAATCA
GATCACCATATTATGCTTATGGTGGCTGTCGGGTGGAATTTGTTTATTGA
GTTTTATCTACACGATTTTGCTTTTATTTGACTCGAATAATCTCGACGGA
AATTGGACTTGATAAGTGTTTTCTTTATTTTCGACGTTCACTACCCCCCG
CCCTTCCTGCCAGTTCCTTCCTCCTATCCAGTTTCATCCAAACAAATTTC
GTATTAGAATATTTGAGAAAAAATTTCCCCGAGAAACTTATCGATTCTAT
TAAAATCTTCCGTTGAGATATTCTGTAAAAATAAATTGCTTATTTTAACC
GGGAGTTGTTTTAATTGACAAATATTTCTGTAAAAATCTGGATGGGTAGG
GCTCTCAGACGTCCGGAAAACCAGGATCGTCC
back to top

protein sequence of SMED30004300-orf-1

>SMED30004300-orf-1 ID=SMED30004300-orf-1|Name=SMED30004300-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2372bp
MAWQCKHSLFMLCTRPSTRKECALDVANKLIDMVVHSYIMKSIARPLTTE
LAMMDFSHKDLFMSDFMKELCNFKSIEDLLVNMSMKYSSLTPIKQNVEDI
KVKDSDRSDETELKLNKFLSGITESELNIPQIEGEQHVSIKEVEFKAGQI
IDEPLSRIEEKNEPIIIDDSSKQNKEEAILHVSVDKLKEIKSSCIDSELN
VGNLKYPSVSEKIVNQNKDANLDNYLQSLLNSEQKEDNLHDIQEDEVVQK
NKTSNVTISQPDEPCVPFTFESDIYHVERTEEISKDFEEQYNSYEVNDET
KLLNKNKDKTLENDLKCLLNSQRDEETFPDIHDDNQVRMSESSGCIVSES
KGEHMSSSEDYMRSVCYINETNLTSDIILERDFFDNETKFKADEITNKNL
ERIPANEDYPLVIDNLTIKDRNLTMEEKDVISNSSAKKQSFTKESEVKYE
VSETKFLALDKKDSCKSFPLDYSSNADIISEKFIDYPLVVGHQSIRDETL
IREDKDLIADSSGKKESFTKESQVKYEVSEIASLTLDKKESCKSFPVDYS
SNVCIISEKVVDQTFDNKSKSVEIMERNEEALIIDSDLKFDLCQTLVTTS
VEKEVSHGSMDLERYLVKDKILDEPEHLNSQQDLKPTGFDQQRDEDNRVI
NTEVADETKLKFEQEALKNDQISLSIIRENKDFMSSQKEIEFETCQTVDI
NSIQKQESYSSFKAQIQIDAENMSTQQDGQNLNHPLITDLENNENTLIQN
TDASMEIYQTPEMSSGKSKESGLYFVLEDPFMHNESKEKTEDRNIPDDQL
PKKTSEKSNESGLYFVLEDPFLLSKNTMKTDENILPDQVSLSIVQENKDF
QNSKNEIEFEACQSTDLLSNQKQESYSSFKLDHEIREDNVPEQLDDQSSL
VNPLWISNIDETEKSPIQNTDVNFEICQIPEIQVTLTEKSNLSYVVEDSV
IPNQSTLKTEDDNIQNDPMSLMVVQGRQDLLTSHNEVEFEACQTNDLHLN
KRNERYSSLKADNNIEEDPFTTRLEERDLETKPLVHYFEKNKDLKQMPSN
IQQEICHLSDKVSIINEESFSSFNCENVQTSENLSENKEDISCNLEQKDS
KALDNEIDIEAGQPAEWNDTEKESSPSLNPDLLIRDDEASIRRELYNLEL
NEDEISGIKLEHGSTLDSVKKNNTEKHIEISQTNPEISGSDKPGLTDKKN
SANFTLDYPLVTSNHDTNAAKLDISDLQVQENEVMVNNFKYEESQTPDLM
LKQRQTSCMSFSVDYLPSVEGASVKAEDKDIDVLLSQLIQNLSENFENEN
KIEPDISNSVDCNFCSTDDNVKDSSCVDDPCNECSDHGEGFKQSSIGDFI
VLICSEDSDEIDRQKKNIHLDEPFRISITFDNREIYTNQTNLELDSLIPG
HKSKDRERDEQGFSPGMAIQELITKDKDEYEINDMHNENKISEKNNITES
VIEKVDNFQEVVYRKPVNYQNQPKYLDRKDSQVHAMKISNFCDISDIFDE
SENLNTTTGFHMPNTVSEFHHRDLNSIEHSLAEDEFKSISQLQMKDIIPK
TFDDNEQTLEQIFISCSHFILEFTIEKYIFESIYSIVESAGKSEIHQKYK
KEEIHKSWENLNVTHNEFSTKAWIGSLNTPEQTLETNFVQFNELSNVTLS
GVNFESQLHIATLDSNTLVYAQVTSDMSENVLDETIISWILKKQALNEIV
DEFLNERLSSIWSDIRIYLKLVISIDLKELQTASNDCIKFNDDSLGMIEL
SESRINALNFENLKKEAQEISLKLESSIRQSMHKKTELGDRNLKNQFDEA
CPRIKCLGTSFSTSKSVKKITDEYHDIKLLDIRIKSECEIIKTISKHISS
SEVHNIDLINSSINTIVDDEINEPELFHPTKSMNRINIKPLNVTEETSIK
EKVLLETPNEETSNIYRLSENTPVNNPSFSSLSTYGLADVSSTKPYTNET
LINVYVENIQVFKKTILENRDQHKIESENISILTSIPKKTGIPNSEPFLE
EALEKNPNSKPDYFFYSSESQINLNLSMTTIEKPENIAEREIFIYNFYEN
ESLEIISENERINILAFIETIIIENVFEKYQMENQSVFQILVAIVNDLES
ELWYLDSFLVVKAKYSEKKEKEKKFKSPENESDLGNEILEIDNYRNCVTE
EEEYGKDSRSIEEDKDNSSSYKTIEICSLTSSSTNNQNLFQNLSNKYNIF
DIFSIDILRNSKSIILSLNSREKANSFLINRKPGNNFNGDNSFRITQNLI
RHLCLELNRNLRAQYPVLTSFKFAGYENHSNGKFTLKFSNKFSPFDMKLR
ENSGKYLLSGENDLSIVETDSSRLQTVRRENSRNQITILCLWWLSGGICL
LSFIYTILLLFDSNNLDGNWT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1186..1206
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 537..559
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 210..231
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 603..622
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 604..622
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 210..235
NoneNo IPR availableTMHMMTMhelixcoord: 1765..1787