Eukaryotic translation initiation factor 3 subunit K

Overview
NameEukaryotic translation initiation factor 3 subunit K
Smed IDSMED30004297
Length (bp)776
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 3 subunit K (SMED30004297) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 3 subunit K (SMED30004297) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 3 subunit K (SMED30004297) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 3 subunit K (SMED30004297) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004297

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004297h1SMcG0020726 dd_Smed_v4_621_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004297h1SMcG0020726 dd_Smed_v4_621_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004297h1SMcG0020726 dd_Smed_v4_621_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004297h1SMcG0020726 dd_Smed_v4_621_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004297h1SMcG0020726 dd_Smed_v4_621_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004297h1SMcG0020726 dd_Smed_v4_621_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Human
Match: EIF3K (eukaryotic translation initiation factor 3 subunit K [Source:HGNC Symbol;Acc:HGNC:24656])

HSP 1 Score: 194.897 bits (494), Expect = 1.173e-61
Identity = 94/204 (46.08%), Postives = 129/204 (63.24%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G  ++ + + W++K GW     G +FICS E++++     + I  DS+ SI
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSI 213          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Human
Match: EIF3K (eukaryotic translation initiation factor 3 subunit K [Source:HGNC Symbol;Acc:HGNC:24656])

HSP 1 Score: 194.897 bits (494), Expect = 1.173e-61
Identity = 94/204 (46.08%), Postives = 129/204 (63.24%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G  ++ + + W++K GW     G +FICS E++++     + I  DS+ SI
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSI 213          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Human
Match: EIF3K (eukaryotic translation initiation factor 3 subunit K [Source:HGNC Symbol;Acc:HGNC:24656])

HSP 1 Score: 189.889 bits (481), Expect = 6.311e-60
Identity = 92/200 (46.00%), Postives = 126/200 (63.00%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDS 693
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G  ++ + + W++K GW     G +FICS E++++     + I  DS
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDS 209          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Human
Match: EIF3K (eukaryotic translation initiation factor 3 subunit K [Source:HGNC Symbol;Acc:HGNC:24656])

HSP 1 Score: 189.889 bits (481), Expect = 6.311e-60
Identity = 92/200 (46.00%), Postives = 126/200 (63.00%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDS 693
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G  ++ + + W++K GW     G +FICS E++++     + I  DS
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDS 209          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Human
Match: EIF3K (eukaryotic translation initiation factor 3 subunit K [Source:HGNC Symbol;Acc:HGNC:24656])

HSP 1 Score: 160.999 bits (406), Expect = 7.797e-49
Identity = 84/204 (41.18%), Postives = 112/204 (54.90%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R Y                           + + W++K GW     G +FICS E++++     + I  DS+ SI
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKY--------------------------SQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSI 187          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Celegans
Match: eif-3.K (Eukaryotic translation initiation factor 3 subunit K [Source:UniProtKB/Swiss-Prot;Acc:Q9XUP3])

HSP 1 Score: 125.946 bits (315), Expect = 4.148e-35
Identity = 66/229 (28.82%), Postives = 117/229 (51.09%), Query Frame = 1
Query:   88 KLIADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDK----------------IEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYV-FICSHEKNLRNNTEEDPITLDSIISIADVFRP 723
            K + + + G++R+NPE++  L   V   V    YD++  LT+LKLYQ  P  Y   +V  +++K +  LP +D AL+K L+D  ++  + LR I  LG +LE CNF  FW  +   Y+                  I+  +GFED++++Y   ++ +T+Q+I + +L   +G A++ E        GW  K +G V F+ +HE  ++    ++ I    +  +    +P
Sbjct:    8 KELHEAIEGVNRYNPENVADLAACVQAMVNENKYDKDIVLTILKLYQLNPEKYDEAVVRQVLLKTLMVLPSSDFALAKCLIDTNRLGSQELRRIFDLGAVLESCNFAVFWKLVKGAYKPTTNPNEPFKVPGEVPKMIKPMVGFEDAVKHYACRVISVTFQKIEKKMLSRLLGGASDKEVTALAQSFGWEAKENGDVFFVANHEGTIKTRNIDEKIQFPHVADLLTSIQP 236          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Fly
Match: eIF3k (gene:FBgn0034654 transcript:FBtr0071670)

HSP 1 Score: 165.236 bits (417), Expect = 2.339e-50
Identity = 78/204 (38.24%), Postives = 124/204 (60.78%), Query Frame = 1
Query:   85 PKLIADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSI 696
             + I ++L  I+R+NP+HL  LE YV +Q  N TYD EANL VLKLYQF PH+   +I   I++K++T LP TD  ++K LL  ++M++E+++ I+ L D+LER +F  FW     N  +      GF DSIR ++S++VG T+Q I +DLLK  +G   +   + W+ +NGW ++  G V +   +  ++     + I  D++
Sbjct:   12 SQTIQEMLGCIERYNPDHLKTLESYVQDQAKNNTYDLEANLAVLKLYQFNPHMLNFDITYTILLKSLTSLPHTDFVMAKCLLLPQQMKDENVQTIIDLADILERADFTLFWQRAEVN-RNMFRHITGFHDSIRKFVSHVVGTTFQTIRKDLLKELLGGIEDSTLESWIKRNGWKNQGQGLVIVAMQDDKIKTKNITEKIEFDNV 214          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Zebrafish
Match: eif3k (eukaryotic translation initiation factor 3, subunit K [Source:NCBI gene;Acc:550245])

HSP 1 Score: 182.956 bits (463), Expect = 3.316e-57
Identity = 89/204 (43.63%), Postives = 128/204 (62.75%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV+ Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLG+LLE C+F+ FW  L +N  D I+G  GFE+S+R +I ++VG+TYQ I   LL   +G   + + + W+ K GW +  DG +FI + E++++     + I  +S+ SI
Sbjct:   12 VGKLLRGIDRYNPENLATLERYVDTQARENAYDLEANLAVLKLYQFNPAYFQTTVTAQILLKALTNLPHTDFTLCKCMIDQTHQEERPIRQILYLGNLLETCHFQSFWASLEEN-RDLIDGITGFEESVRKFICHVVGITYQNIEYRLLAEMLGDPLDTQVKVWMNKYGWTENEDGQIFIHNQEESVKPKNIVEKIDFESVSSI 214          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Xenopus
Match: eif3k (eukaryotic translation initiation factor 3 subunit K [Source:NCBI gene;Acc:548352])

HSP 1 Score: 195.282 bits (495), Expect = 5.704e-62
Identity = 93/204 (45.59%), Postives = 131/204 (64.22%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D I+G  GFEDS+R +I ++VG+TYQ I R LL   +G  +E + + W++K GW++  +G +F+C+ E+N++     + I  DS+  I
Sbjct:    5 VGKLLRGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQSFWQALDENL-DLIDGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSEPQLRVWMSKYGWMESENGKIFVCNQEENIKPKNIVEKIDFDSVSGI 207          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Mouse
Match: Eif3k (eukaryotic translation initiation factor 3, subunit K [Source:MGI Symbol;Acc:MGI:1921080])

HSP 1 Score: 194.126 bits (492), Expect = 1.257e-61
Identity = 95/204 (46.57%), Postives = 128/204 (62.75%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G   + + + W++K GW     G VFICS E++++     + I  DS+ SI
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLKVWMSKYGWSADESGQVFICSQEESIKPKNIVEKIDFDSVSSI 213          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Mouse
Match: Eif3k (eukaryotic translation initiation factor 3, subunit K [Source:MGI Symbol;Acc:MGI:1921080])

HSP 1 Score: 145.206 bits (365), Expect = 7.671e-43
Identity = 70/161 (43.48%), Postives = 99/161 (61.49%), Query Frame = 1
Query:  223 YQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            YQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G   + + + W++K GW     G VFICS E++++     + I  DS+ SI
Sbjct:   21 YQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLKVWMSKYGWSADESGQVFICSQEESIKPKNIVEKIDFDSVSSI 180          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Mouse
Match: Eif3k (eukaryotic translation initiation factor 3, subunit K [Source:MGI Symbol;Acc:MGI:1921080])

HSP 1 Score: 139.043 bits (349), Expect = 2.126e-40
Identity = 67/157 (42.68%), Postives = 96/157 (61.15%), Query Frame = 1
Query:  223 YQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDS 693
            YQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G   + + + W++K GW     G VFICS E++++     + I  D+
Sbjct:   21 YQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLKVWMSKYGWSADESGQVFICSQEESIKPKNIVEKIDFDN 176          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Mouse
Match: Eif3k (eukaryotic translation initiation factor 3, subunit K [Source:MGI Symbol;Acc:MGI:1921080])

HSP 1 Score: 53.1434 bits (126), Expect = 2.241e-9
Identity = 25/43 (58.14%), Postives = 29/43 (67.44%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKL 222
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKL
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKL 53          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. UniProt/SwissProt
Match: sp|Q28C65|EIF3K_XENTR (Eukaryotic translation initiation factor 3 subunit K OS=Xenopus tropicalis OX=8364 GN=eif3k PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.632e-61
Identity = 93/204 (45.59%), Postives = 131/204 (64.22%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D I+G  GFEDS+R +I ++VG+TYQ I R LL   +G  +E + + W++K GW++  +G +F+C+ E+N++     + I  DS+  I
Sbjct:   11 VGKLLRGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQSFWQALDENL-DLIDGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSEPQLRVWMSKYGWMESENGKIFVCNQEENIKPKNIVEKIDFDSVSGI 213          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. UniProt/SwissProt
Match: sp|Q6GNI4|EIF3K_XENLA (Eukaryotic translation initiation factor 3 subunit K OS=Xenopus laevis OX=8355 GN=eif3k PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 5.632e-61
Identity = 92/204 (45.10%), Postives = 131/204 (64.22%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   +++KA+T LP TD  L K ++D    E+  +R ILYLGDLLE C+F+ FW  L +N  D I+G  GFEDS+R +I ++VG+TYQ I R LL   +G  +E + + W++K GWI+  +G +F+C+ E+N++     + I  DS+  I
Sbjct:   11 VGKLLRGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQVLLKALTNLPHTDFTLCKCMIDQAHQEDRPIRQILYLGDLLETCHFQSFWQALDENL-DLIDGVTGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSEPQLRVWMSKYGWIESENGKIFVCNQEENIKPKNIVEKIDFDSVSGI 213          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. UniProt/SwissProt
Match: sp|Q9UBQ5|EIF3K_HUMAN (Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 5.632e-61
Identity = 94/204 (46.08%), Postives = 129/204 (63.24%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G  ++ + + W++K GW     G +FICS E++++     + I  DS+ SI
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSI 213          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. UniProt/SwissProt
Match: sp|Q3T0V3|EIF3K_BOVIN (Eukaryotic translation initiation factor 3 subunit K OS=Bos taurus OX=9913 GN=EIF3K PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 7.802e-61
Identity = 94/204 (46.08%), Postives = 128/204 (62.75%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G   + + + W++K GW     G +FICS E++++     + I  DS+ SI
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSI 213          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. UniProt/SwissProt
Match: sp|Q9DBZ5|EIF3K_MOUSE (Eukaryotic translation initiation factor 3 subunit K OS=Mus musculus OX=10090 GN=Eif3k PE=1 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 8.792e-61
Identity = 95/204 (46.57%), Postives = 128/204 (62.75%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G   + + + W++K GW     G VFICS E++++     + I  DS+ SI
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLKVWMSKYGWSADESGQVFICSQEESIKPKNIVEKIDFDSVSSI 213          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. TrEMBL
Match: B6VFL4 (Eukaryotic translation initiation factor 3 subunit K OS=Bombina orientalis OX=8346 GN=EIF3K PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.261e-59
Identity = 93/204 (45.59%), Postives = 133/204 (65.20%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV+ Q    TYD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D ++G  GFEDS+R +I ++VG+TYQ I R LL   +G  +E + + W++K GW++  +G +F+C+ E+N++     + I  DS+  I
Sbjct:   11 VGKLLRGIDRYNPENLATLERYVDTQAKENTYDLEANLAVLKLYQFNPPFFQTSVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENL-DLLDGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSEPQLRVWMSKYGWVEAENGKIFVCNQEENIKPKNIVEKIDFDSVSGI 213          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. TrEMBL
Match: L7N3U8 (Eukaryotic translation initiation factor 3 subunit K OS=Xenopus tropicalis OX=8364 GN=eif3k PE=3 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 8.956e-59
Identity = 93/204 (45.59%), Postives = 131/204 (64.22%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D I+G  GFEDS+R +I ++VG+TYQ I R LL   +G  +E + + W++K GW++  +G +F+C+ E+N++     + I  DS+  I
Sbjct:    5 VGKLLRGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQSFWQALDENL-DLIDGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSEPQLRVWMSKYGWMESENGKIFVCNQEENIKPKNIVEKIDFDSVSGI 207          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. TrEMBL
Match: A0A1L8F925 (Eukaryotic translation initiation factor 3 subunit K OS=Xenopus laevis OX=8355 GN=EIF3K PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.548e-58
Identity = 95/221 (42.99%), Postives = 139/221 (62.90%), Query Frame = 1
Query:   52 FSLANNKMSTTPKL---IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            F  A + M++  ++   +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   +++KA+T LP TD  L K ++D    E+  +R ILYLGDLLE C+F+ FW  L +N  D I+G  GFEDS+R +I ++VG+TYQ I R LL   +G  +E + + W++K GWI+  +G +F+C+ E+N++     + I  DS+  I
Sbjct:    8 FPSAADNMASFEQMRANVGKLLRGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQVLLKALTNLPHTDFTLCKCMIDQAHQEDRPIRQILYLGDLLETCHFQSFWQALDENL-DLIDGVTGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSEPQLRVWMSKYGWIESENGKIFVCNQEENIKPKNIVEKIDFDSVSGI 227          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. TrEMBL
Match: A0A1L8F418 (Eukaryotic translation initiation factor 3 subunit K OS=Xenopus laevis OX=8355 GN=EIF3K PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.606e-58
Identity = 97/225 (43.11%), Postives = 142/225 (63.11%), Query Frame = 1
Query:   43 LFKFSL-ANNKMSTTPKL---IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
               FSL A + M++  ++   + +LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    E+  +R ILYLGDLLE C+F+ FW  L +N  D ++G  GFEDS+R +I ++VG+TYQ I R LL   +G  +E + + W++K GWI+  +G +F+C+ E+N++     + I  DS+  I
Sbjct:   33 FLSFSLSATDNMASFEQMRANVGNLLRGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEDRPIRQILYLGDLLETCHFQSFWQALDENL-DLLDGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSEPQLRVWMSKYGWIESENGKIFVCNQEENIKPKNIVEKIDFDSVSGI 256          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. TrEMBL
Match: A0A3Q0C9P0 (Eukaryotic translation initiation factor 3 subunit K OS=Mesocricetus auratus OX=10036 GN=Eif3k PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.651e-58
Identity = 95/204 (46.57%), Postives = 129/204 (63.24%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLGDLLE C+F+ FW  L +N  D +EG  GFEDS+R +I ++VG+TYQ I R LL   +G   + + + W++K GW   + G VFICS E++++     + I  DS+ SI
Sbjct:   11 VGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENM-DLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLKVWMSKYGWSADDSGQVFICSQEESIKPKNIVEKIDFDSVSSI 213          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Cavefish
Match: eif3k (eukaryotic translation initiation factor 3, subunit K [Source:NCBI gene;Acc:550245])

HSP 1 Score: 151.369 bits (381), Expect = 2.324e-45
Identity = 81/204 (39.71%), Postives = 111/204 (54.41%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            +  LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLG+LLE C+F+ FW  L +N E  I+G  GFEDS+R Y    V                          W+ K GW +  +G +FI + E++++     + I  +S+ SI
Sbjct:   11 VGKLLRGIDRYNPENLATLERYVETQARENAYDLEANLAVLKLYQFNPAYFQTSVTAQILLKALTNLPHTDFTLCKCMIDQPHQEERPIRQILYLGNLLETCHFQSFWTSLEENRE-LIDGIAGFEDSVRKYTQVKV--------------------------WMNKYGWTENEEGQIFIFNQEESVKPKNIVEKIDFESVSSI 187          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Cavefish
Match: eif3k (eukaryotic translation initiation factor 3, subunit K [Source:NCBI gene;Acc:550245])

HSP 1 Score: 100.523 bits (249), Expect = 4.761e-25
Identity = 48/123 (39.02%), Postives = 76/123 (61.79%), Query Frame = 1
Query:  337 RKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
             + EE  +R ILYLG+LLE C+F+ FW  L +N E  I+G  GFEDS+R +I ++VG+TYQ I   LL   +G   + + + W+ K GW +  +G +FI + E++++     + I  +S+ SI
Sbjct:  136 SQQEERPIRQILYLGNLLETCHFQSFWTSLEENRE-LIDGIAGFEDSVRKFICHVVGITYQTIEHRLLAEMLGDPLDTQVKVWMNKYGWTENEEGQIFIFNQEESVKPKNIVEKIDFESVSSI 257          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Sea Lamprey
Match: eif3k (eukaryotic translation initiation factor 3, subunit K [Source:NCBI gene;Acc:550245])

HSP 1 Score: 176.407 bits (446), Expect = 2.264e-55
Identity = 88/201 (43.78%), Postives = 124/201 (61.69%), Query Frame = 1
Query:  103 LLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            LL GIDR+NPE+L  LE+YV  Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K L+D   +E++ L  IL LG+LLE C F+ FW EL    E  ++G  GFEDSIR +I ++VG+TYQRI + LL   +G   + +   W++K GW +   G ++I + E+ ++     + I  +S+ SI
Sbjct:   15 LLRGIDRYNPENLGTLERYVETQAQENAYDLEANLAVLKLYQFNPAYFQTSVTAQILLKALTNLPHTDFTLCKCLIDQVHLEDKQLGRILLLGELLETCRFQNFWTELD---ETLVDGITGFEDSIRKFICHVVGITYQRIGKRLLSDMLGGLTDGQLNVWMSKYGWNEGEPGTIYIANQEETVKPKNIVEKIDFESVASI 212          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Nematostella
Match: EDO37003 (Eukaryotic translation initiation factor 3 subunit K [Source:UniProtKB/Swiss-Prot;Acc:A7SGZ5])

HSP 1 Score: 154.066 bits (388), Expect = 1.463e-46
Identity = 71/209 (33.97%), Postives = 118/209 (56.46%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISIADVFR 720
            ++ LL GIDR+NPE+L  LE YV+ QV    YD +ANL VLKLYQF P   Q  ++  I++KA+  LP  D  + + ++D    ++ +++ ++ L + LE C F   W +        ++G  GF D+IRNYI+Y++G+TYQ I   L    +G     + Q W+   GW+  +DG +++ + E ++++    + I   S+ +I    R
Sbjct:    9 VSQLLKGIDRYNPENLKVLEHYVHLQVHENAYDLDANLAVLKLYQFNPAYSQTSVISQILLKALMNLPNADFIMCRCVIDDAIQQDLTIKKVILLAERLETCAFTSAW-QFIKEEASLVDGVTGFHDAIRNYITYVIGVTYQTIEESLASELLGGLQGAQLQDWIKAKGWMSSDDGTIYVTNQEAHIKSKNIAEKIDFASVANIIAAAR 216          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Nematostella
Match: EDO27795 (Eukaryotic translation initiation factor 3 subunit K [Source:UniProtKB/TrEMBL;Acc:A7T899])

HSP 1 Score: 124.02 bits (310), Expect = 6.107e-35
Identity = 61/201 (30.35%), Postives = 105/201 (52.24%), Query Frame = 1
Query:   94 IADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLT-VLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDS 693
            ++ LL GIDR+NPE+L  LE YV+ QV          L      YQF P   Q  ++  I++KA+  LP  D  + + ++D    ++ +++ ++ L + LE C F   W +        ++G  GF D+IRNYI+Y++G+TYQ I   L    +G     + Q W+   GW+  +DG +++ + E ++++    + I   S
Sbjct:    9 VSQLLKGIDRYNPENLKVLEHYVHLQVNQLKVKTLICLIYFFSRYQFNPAYSQTSVISQILLKALMNLPNADFIMCRCVIDDAIQQDLTIKKVILLAERLETCAFTSAW-QFIKEEASLVDGVTGFHDAIRNYITYVIGVTYQTIEESLASELLGGLQGAQLQDWIKAKGWMSSDDGTIYVTNQEAHIKSKNIAEKIDFAS 208          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Nematostella
Match: EDO29829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2I5])

HSP 1 Score: 121.709 bits (304), Expect = 1.909e-34
Identity = 55/176 (31.25%), Postives = 95/176 (53.98%), Query Frame = 1
Query:  166 EQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDS 693
             QV    YD +ANL VLKLYQF P   Q  ++  I++KA+  LP  D  + + ++D    ++ +++ ++ L + LE C F   W +        ++G  GF D+IRNYI+Y++G+TYQ I   L    +G     + Q W+   GW+  +DG +++ + E ++++    + I   S
Sbjct:    1 SQVHENAYDLDANLAVLKLYQFNPAYSQTSVISQILLKALMNLPNADFIMCRCVIDDAIQQDLTIKKVILLAERLETCAFTSAW-QFIKEEASLVDGVTGFHDAIRNYITYVIGVTYQTIEESLASELLGGLQGAQLQDWIKAKGWMSSDDGTIYVTNQEAHIKSKNIAEKIDFAS 175          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Medaka
Match: EIF3K (eukaryotic translation initiation factor 3 subunit K [Source:NCBI gene;Acc:101156027])

HSP 1 Score: 173.326 bits (438), Expect = 3.583e-53
Identity = 86/198 (43.43%), Postives = 124/198 (62.63%), Query Frame = 1
Query:  115 IDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLD-CRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            + R+NPE+L  LEQYV+ Q     YD EANL VLKLYQF P  +Q  +   I++KA+T LP TD  L K ++D   + EE  +R ILYLG+LLE C+F+ FW  L +N E  I+G  GFEDS+R +I ++VG+TYQ I   LL   +G   + + + W+ K GW +  DG +FI + E++++     + I  +S+ SI
Sbjct:   28 LHRYNPENLVTLEQYVDTQARENAYDLEANLAVLKLYQFNPAYFQTPVTAQILLKALTNLPHTDFTLCKCMIDQTHQQEERPIRQILYLGNLLETCHFQSFWTSLEENRE-LIDGIAGFEDSVRKFICHVVGITYQTIDHRLLAEMLGDPLDTQVKVWMNKYGWTENEDGQIFIYNQEESIKPKNIVEKIDFESVSSI 224          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Medaka
Match: EIF3K (eukaryotic translation initiation factor 3 subunit K [Source:NCBI gene;Acc:101156027])

HSP 1 Score: 135.576 bits (340), Expect = 3.064e-39
Identity = 65/161 (40.37%), Postives = 98/161 (60.87%), Query Frame = 1
Query:  223 YQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISI 705
            YQF P  +Q  +   I++KA+T LP TD  L K ++D    EE  +R ILYLG+LLE C+F+ FW  L +N E  I+G  GFEDS+R +I ++VG+TYQ I   LL   +G   + + + W+ K GW +  DG +FI + E++++     + I  +S+ SI
Sbjct:   22 YQFNPAYFQTPVTAQILLKALTNLPHTDFTLCKCMIDQTHQEERPIRQILYLGNLLETCHFQSFWTSLEENRE-LIDGIAGFEDSVRKFICHVVGITYQTIDHRLLAEMLGDPLDTQVKVWMNKYGWTENEDGQIFIYNQEESIKPKNIVEKIDFESVSSI 181          
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Planmine SMEST
Match: SMESG000017237.1 (SMESG000017237.1)

HSP 1 Score: 457.603 bits (1176), Expect = 9.181e-166
Identity = 221/222 (99.55%), Postives = 221/222 (99.55%), Query Frame = 1
Query:   73 MSTTPKLIADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISIADVFRPKEIGF 738
            MSTTPKLIADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKN WIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISIADVFRPKEIGF
Sbjct:    1 MSTTPKLIADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKLYQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGILYLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQRISRDLLKSFMGIANEVEFQKWLAKNDWIDKNDGYVFICSHEKNLRNNTEEDPITLDSIISIADVFRPKEIGF 222          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF3K1.173e-6146.08eukaryotic translation initiation factor 3 subunit... [more]
EIF3K1.173e-6146.08eukaryotic translation initiation factor 3 subunit... [more]
EIF3K6.311e-6046.00eukaryotic translation initiation factor 3 subunit... [more]
EIF3K6.311e-6046.00eukaryotic translation initiation factor 3 subunit... [more]
EIF3K7.797e-4941.18eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif-3.K4.148e-3528.82Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eIF3k2.339e-5038.24gene:FBgn0034654 transcript:FBtr0071670[more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif3k3.316e-5743.63eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif3k5.704e-6245.59eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Eif3k1.257e-6146.57eukaryotic translation initiation factor 3, subuni... [more]
Eif3k7.671e-4343.48eukaryotic translation initiation factor 3, subuni... [more]
Eif3k2.126e-4042.68eukaryotic translation initiation factor 3, subuni... [more]
Eif3k2.241e-958.14eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28C65|EIF3K_XENTR2.632e-6145.59Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q6GNI4|EIF3K_XENLA5.632e-6145.10Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q9UBQ5|EIF3K_HUMAN5.632e-6146.08Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q3T0V3|EIF3K_BOVIN7.802e-6146.08Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q9DBZ5|EIF3K_MOUSE8.792e-6146.57Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B6VFL42.261e-5945.59Eukaryotic translation initiation factor 3 subunit... [more]
L7N3U88.956e-5945.59Eukaryotic translation initiation factor 3 subunit... [more]
A0A1L8F9251.548e-5842.99Eukaryotic translation initiation factor 3 subunit... [more]
A0A1L8F4181.606e-5843.11Eukaryotic translation initiation factor 3 subunit... [more]
A0A3Q0C9P01.651e-5846.57Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eif3k2.324e-4539.71eukaryotic translation initiation factor 3, subuni... [more]
eif3k4.761e-2539.02eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif3k2.264e-5543.78eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO370031.463e-4633.97Eukaryotic translation initiation factor 3 subunit... [more]
EDO277956.107e-3530.35Eukaryotic translation initiation factor 3 subunit... [more]
EDO298291.909e-3431.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
EIF3K3.583e-5343.43eukaryotic translation initiation factor 3 subunit... [more]
EIF3K3.064e-3940.37eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit K vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000017237.19.181e-16699.55SMESG000017237.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004297 ID=SMED30004297|Name=Eukaryotic translation initiation factor 3 subunit K|organism=Schmidtea mediterranea sexual|type=transcript|length=776bp
GTAAAAAGTTGCATCAAATTTTTGTAATATCAAAAAATCGAGTTGTTTAA
ATTTTCATTGGCAAATAATAAAATGTCAACGACACCGAAATTAATTGCTG
ATTTACTTACTGGAATCGACAGGTTTAACCCGGAACATTTGCCAAAACTA
GAGCAATATGTCAATGAGCAAGTTGCAAATGGAACTTATGACAGGGAAGC
CAACTTGACAGTTTTAAAGCTTTATCAATTCTGTCCTCATCTTTATCAGC
CAGAAATCGTCATGAACATCATTATGAAAGCCATTACACAATTGCCTATG
ACAGATTTAGCTTTGTCTAAGTATTTGTTGGATTGCAGAAAAATGGAAGA
GGAGTCGTTAAGAGGGATTTTATATCTAGGTGATTTATTGGAACGTTGCA
ATTTCCGAGAATTTTGGATTGAATTGCACGACAATTACGAGGACAAGATA
GAAGGATTCCTGGGATTCGAGGACAGCATTAGGAATTACATTTCCTACAT
TGTCGGCCTCACGTATCAGCGCATCTCACGAGATCTCCTGAAATCCTTCA
TGGGAATCGCAAATGAGGTCGAATTTCAGAAATGGCTGGCCAAGAACGGC
TGGATCGATAAGAACGATGGTTATGTGTTTATTTGCAGCCACGAGAAGAA
TTTGCGGAACAACACAGAGGAGGATCCGATCACGCTCGATTCCATTATCA
GCATTGCCGATGTCTTCAGGCCCAAGGAAATCGGATTTTAATTCAATATA
ATTTATATTTGTCTTTTTAAAAAAAA
back to top

protein sequence of SMED30004297-orf-1

>SMED30004297-orf-1 ID=SMED30004297-orf-1|Name=SMED30004297-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=223bp
MSTTPKLIADLLTGIDRFNPEHLPKLEQYVNEQVANGTYDREANLTVLKL
YQFCPHLYQPEIVMNIIMKAITQLPMTDLALSKYLLDCRKMEEESLRGIL
YLGDLLERCNFREFWIELHDNYEDKIEGFLGFEDSIRNYISYIVGLTYQR
ISRDLLKSFMGIANEVEFQKWLAKNGWIDKNDGYVFICSHEKNLRNNTEE
DPITLDSIISIADVFRPKEIGF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001732formation of cytoplasmic translation initiation complex
GO:0002183cytoplasmic translational initiation
GO:0006446regulation of translational initiation
GO:0006412translation
GO:0006413translational initiation
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003743translation initiation factor activity
GO:0043022ribosome binding
GO:0005488binding
Vocabulary: cellular component
TermDefinition
GO:0016282eukaryotic 43S preinitiation complex
GO:0033290eukaryotic 48S preinitiation complex
GO:0005852eukaryotic translation initiation factor 3 complex
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR009374eIF3k
IPR000717PCI_dom
IPR036390WH_DNA-bd_sf
IPR011991WHTH_DNA-bd_dom
IPR016020Transl_init_fac_sub12_N_euk
IPR033464CSN8_PSD8_EIF3K
IPR016024ARM-type_fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033464CSN8/PSMD8/EIF3KPFAMPF10075CSN8_PSD8_EIF3Kcoord: 59..190
e-value: 4.8E-20
score: 72.0
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 121..218
e-value: 1.4E-21
score: 78.6
IPR016020Translation initiation factor 3, subunit 12, N-terminal, eukaryoticGENE3DG3DSA:1.25.40.250coord: 1..118
e-value: 2.0E-41
score: 142.5
IPR009374Eukaryotic translation initiation factor 3 subunit KPANTHERPTHR13022EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 11coord: 4..211
IPR000717Proteasome component (PCI) domainPROSITEPS50250PCIcoord: 39..202
score: 11.629
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 131..211
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 3..123