Elongation factor 1-alpha 1

Overview
NameElongation factor 1-alpha 1
Smed IDSMED30004295
Length (bp)791
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Elongation factor 1-alpha 1 ( EF1a-like-1 ) is expressed during Stage 3 in the embryonic digestive system, primitive ectoderm cell, primitive ectoderm, primitive gut cell, blastomere and embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Rich Media File 1: S3 embryo architecture.

SPIM reconstructed S3 embryo costained with EF1a-like-1 (red) and sytox green nuclear counterstain. EF1a-like-1 is a pan-embryonic cell marker that stains primitive ectoderm cells, temporary embryonic pharynx, primitive gut and undifferentiated blastomeres in the embryonic wall. EF1a-like-1 staining is absent from yolk cells in the embryonic wall and gut cavity.

 

piwi-1 is expressed in all undifferentiated blastomeres of S3 embryos.  piwi-1 is expressed in all undifferentiated blastomeres of S3 embryos. 

 SPIM reconstructed S3 embryo costained with piwi-1 (red) and EF1a-like-1 (green). piwi-1 is expressed in all undifferentiated blastomeres in the embryonic wall (piwi-1+, EF1a-like-1+ cells).  piwi-1 is not expressed in differentiated tissues marked by EF1a-like-1 alone, including the primitive ectoderm and temporary embryonic pharynx (green). Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

Anatomical Expression

PAGE et. al., 2020




SMED30004295

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
embryonic pharynxSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
embryonic pharynxSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
embryonic pharynxSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
primitive ectodermSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
primitive ectodermSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
primitive ectodermSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
primitive gutSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
primitive gutSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
blastomereSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
blastomereSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30004295 SMED30004295smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Human
Match: EEF1A1 (eukaryotic translation elongation factor 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:3189])

HSP 1 Score: 468.389 bits (1204), Expect = 7.329e-166
Identity = 222/263 (84.41%), Postives = 240/263 (91.25%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G        +G TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNA------SGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Human
Match: EEF1A1 (eukaryotic translation elongation factor 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:3189])

HSP 1 Score: 468.389 bits (1204), Expect = 7.329e-166
Identity = 222/263 (84.41%), Postives = 240/263 (91.25%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G        +G TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNA------SGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Human
Match: EEF1A1 (eukaryotic translation elongation factor 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:3189])

HSP 1 Score: 468.389 bits (1204), Expect = 7.329e-166
Identity = 222/263 (84.41%), Postives = 240/263 (91.25%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G        +G TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNA------SGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Human
Match: EEF1A1 (eukaryotic translation elongation factor 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:3189])

HSP 1 Score: 466.463 bits (1199), Expect = 1.525e-165
Identity = 222/263 (84.41%), Postives = 240/263 (91.25%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G        +G TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNA------SGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Human
Match: EEF1A2 (eukaryotic translation elongation factor 1 alpha 2 [Source:HGNC Symbol;Acc:HGNC:3192])

HSP 1 Score: 463.381 bits (1191), Expect = 9.005e-164
Identity = 220/263 (83.65%), Postives = 239/263 (90.87%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFETT YY+T+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEP YSE RY+EI KEVS YIKK+GYNP +V FVPISGW GDNM+ PS NMPWFKGW ++RK G        +GV+LLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNA------SGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Celegans
Match: eef-1A.2 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 449.129 bits (1154), Expect = 1.479e-158
Identity = 211/263 (80.23%), Postives = 235/263 (89.35%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET  YY+T+IDAPGHRDFIKNMITGTSQADCAVL+VA G GEFEAGISKNGQTREHALLA TLGVKQ+IV  NK+DSTEPP+SE+R+ EI  EVSG+IKK+GYNP +V FVPISG+ GDNM+  S+NMPWFKGW ++RK G        +G TLLEA+D+I PP RPT++PLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNA------SGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Celegans
Match: eef-1A.2 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 449.129 bits (1154), Expect = 1.479e-158
Identity = 211/263 (80.23%), Postives = 235/263 (89.35%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET  YY+T+IDAPGHRDFIKNMITGTSQADCAVL+VA G GEFEAGISKNGQTREHALLA TLGVKQ+IV  NK+DSTEPP+SE+R+ EI  EVSG+IKK+GYNP +V FVPISG+ GDNM+  S+NMPWFKGW ++RK G        +G TLLEA+D+I PP RPT++PLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNA------SGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Celegans
Match: eef-1A.2 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 449.129 bits (1154), Expect = 1.479e-158
Identity = 211/263 (80.23%), Postives = 235/263 (89.35%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET  YY+T+IDAPGHRDFIKNMITGTSQADCAVL+VA G GEFEAGISKNGQTREHALLA TLGVKQ+IV  NK+DSTEPP+SE+R+ EI  EVSG+IKK+GYNP +V FVPISG+ GDNM+  S+NMPWFKGW ++RK G        +G TLLEA+D+I PP RPT++PLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNA------SGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Celegans
Match: eef-1A.2 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 449.129 bits (1154), Expect = 1.479e-158
Identity = 211/263 (80.23%), Postives = 235/263 (89.35%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET  YY+T+IDAPGHRDFIKNMITGTSQADCAVL+VA G GEFEAGISKNGQTREHALLA TLGVKQ+IV  NK+DSTEPP+SE+R+ EI  EVSG+IKK+GYNP +V FVPISG+ GDNM+  S+NMPWFKGW ++RK G        +G TLLEA+D+I PP RPT++PLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNA------SGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Celegans
Match: eef-1A.1 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 449.129 bits (1154), Expect = 1.479e-158
Identity = 211/263 (80.23%), Postives = 235/263 (89.35%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET  YY+T+IDAPGHRDFIKNMITGTSQADCAVL+VA G GEFEAGISKNGQTREHALLA TLGVKQ+IV  NK+DSTEPP+SE+R+ EI  EVSG+IKK+GYNP +V FVPISG+ GDNM+  S+NMPWFKGW ++RK G        +G TLLEA+D+I PP RPT++PLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNA------SGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Fly
Match: eEF1alpha1 (gene:FBgn0284245 transcript:FBtr0088035)

HSP 1 Score: 468.003 bits (1203), Expect = 6.849e-166
Identity = 222/263 (84.41%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET  YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DS+EPPYSE+RY EIKKEVS YIKK+GYNP +VAFVPISGW GDNM+ PSTNMPWFKGW ++RK G         G TL++A+DAI PPARPT+K LRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNAD------GKTLIDALDAILPPARPTDKALRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Fly
Match: eEF1alpha1 (gene:FBgn0284245 transcript:FBtr0345023)

HSP 1 Score: 468.003 bits (1203), Expect = 6.849e-166
Identity = 222/263 (84.41%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET  YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DS+EPPYSE+RY EIKKEVS YIKK+GYNP +VAFVPISGW GDNM+ PSTNMPWFKGW ++RK G         G TL++A+DAI PPARPT+K LRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNAD------GKTLIDALDAILPPARPTDKALRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Fly
Match: eEF1alpha1 (gene:FBgn0284245 transcript:FBtr0331927)

HSP 1 Score: 468.003 bits (1203), Expect = 6.849e-166
Identity = 222/263 (84.41%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET  YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DS+EPPYSE+RY EIKKEVS YIKK+GYNP +VAFVPISGW GDNM+ PSTNMPWFKGW ++RK G         G TL++A+DAI PPARPT+K LRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNAD------GKTLIDALDAILPPARPTDKALRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Fly
Match: eEF1alpha1 (gene:FBgn0284245 transcript:FBtr0345022)

HSP 1 Score: 468.003 bits (1203), Expect = 6.849e-166
Identity = 222/263 (84.41%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET  YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DS+EPPYSE+RY EIKKEVS YIKK+GYNP +VAFVPISGW GDNM+ PSTNMPWFKGW ++RK G         G TL++A+DAI PPARPT+K LRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNAD------GKTLIDALDAILPPARPTDKALRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Fly
Match: eEF1alpha2 (gene:FBgn0000557 transcript:FBtr0085835)

HSP 1 Score: 465.692 bits (1197), Expect = 5.283e-165
Identity = 221/263 (84.03%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DSTEPPYSE+RY EIKKEVS YIKK+GYNP SVAFVPISGW GDNM+ PS  MPWFKGW+++RK G  +      G  L++A+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAE------GKCLIDALDAILPPQRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Zebrafish
Match: eef1a1l1 (eukaryotic translation elongation factor 1 alpha 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-188])

HSP 1 Score: 466.848 bits (1200), Expect = 1.869e-165
Identity = 222/263 (84.41%), Postives = 242/263 (92.02%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS++R+ EI KEVS YIKK+GYNP +VAFVPISGW GDNM+ PS+NM WFKGW I+RK G         GVTLLEA+D+I PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEGGAN------GVTLLEALDSILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Zebrafish
Match: eef1a1a (eukaryotic translation elongation factor 1 alpha 1a [Source:ZFIN;Acc:ZDB-GENE-030131-8278])

HSP 1 Score: 464.151 bits (1193), Expect = 2.360e-164
Identity = 222/263 (84.41%), Postives = 237/263 (90.11%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEP YS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+  S NM WFKGW I RK G        AG TLLEA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPSYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEASPNMSWFKGWKITRKEGNA------AGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Zebrafish
Match: eef1a1a (eukaryotic translation elongation factor 1 alpha 1a [Source:ZFIN;Acc:ZDB-GENE-030131-8278])

HSP 1 Score: 464.151 bits (1193), Expect = 2.360e-164
Identity = 222/263 (84.41%), Postives = 237/263 (90.11%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEP YS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+  S NM WFKGW I RK G        AG TLLEA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPSYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEASPNMSWFKGWKITRKEGNA------AGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Zebrafish
Match: eef1a1b (eukaryotic translation elongation factor 1 alpha 1b [Source:ZFIN;Acc:ZDB-GENE-050417-327])

HSP 1 Score: 463.766 bits (1192), Expect = 3.576e-164
Identity = 221/263 (84.03%), Postives = 240/263 (91.25%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEP YS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+  S NM WFKGW I RK+G++      +G TLLEA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGSS------SGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Zebrafish
Match: eef1a1l2 (eukaryotic translation elongation factor 1 alpha 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-188])

HSP 1 Score: 463.766 bits (1192), Expect = 3.576e-164
Identity = 221/263 (84.03%), Postives = 240/263 (91.25%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEP YS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+  S NM WFKGW I RK+G++      +G TLLEA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGSS------SGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Xenopus
Match: eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:NCBI gene;Acc:549446])

HSP 1 Score: 469.159 bits (1206), Expect = 3.846e-166
Identity = 224/263 (85.17%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW I RK G      S +G TLLEA+D I PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKISRKEG------SGSGTTLLEALDCILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Xenopus
Match: eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:NCBI gene;Acc:549446])

HSP 1 Score: 466.077 bits (1198), Expect = 1.739e-165
Identity = 224/263 (85.17%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW I RK G      S +G TLLEA+D I PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKISRKEG------SGSGTTLLEALDCILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Xenopus
Match: eef1a2 (eukaryotic translation elongation factor 1 alpha 2 [Source:NCBI gene;Acc:496898])

HSP 1 Score: 463.766 bits (1192), Expect = 5.568e-164
Identity = 221/263 (84.03%), Postives = 238/263 (90.49%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET  YY+T+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVGINK+DSTEPPYSE RY+EI KEVS YIKK+GYNP +V FVPISGW GDNM+ PS NMPWFKGW ++RK G         GV+LLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETNKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNAN------GVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Xenopus
Match: map3k1 (mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-1008434])

HSP 1 Score: 461.84 bits (1187), Expect = 2.511e-163
Identity = 223/263 (84.79%), Postives = 240/263 (91.25%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA TLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW I RK G      S +G TLLEA+D I PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA-TLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKISRKEG------SGSGTTLLEALDCILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 263          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Xenopus
Match: anp32b (acidic nuclear phosphoprotein 32 family member B [Source:Xenbase;Acc:XB-GENE-988727])

HSP 1 Score: 456.062 bits (1172), Expect = 5.616e-161
Identity = 215/263 (81.75%), Postives = 237/263 (90.11%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET  +Y+T+IDAPGHRDFIKNMITGTSQADCAVLIVA GVGEFEAGISKNGQTREHALLA+TLGVKQ+I+G+NK+DSTEPP+S+ R+ EI KEVS YIKK+GYNP +V FVPISGW GDNM+  STNMPWFKGW I+RK G        +GVTLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETGKFYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIIGVNKMDSTEPPFSQKRFEEITKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEASTNMPWFKGWKIERKEGNA------SGVTLLEALDCIIPPQRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Mouse
Match: Eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:MGI Symbol;Acc:MGI:1096881])

HSP 1 Score: 469.929 bits (1208), Expect = 1.632e-166
Identity = 223/263 (84.79%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G      S +G TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG------SASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Mouse
Match: Eef1a2 (eukaryotic translation elongation factor 1 alpha 2 [Source:MGI Symbol;Acc:MGI:1096317])

HSP 1 Score: 462.996 bits (1190), Expect = 6.972e-164
Identity = 220/263 (83.65%), Postives = 239/263 (90.87%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFETT YY+T+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEP YSE RY+EI KEVS YIKK+GYNP +V FVPISGW GDNM+ PS NMPWFKGW ++RK G        +GV+LLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNA------SGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Mouse
Match: Eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:MGI Symbol;Acc:MGI:1096881])

HSP 1 Score: 437.573 bits (1124), Expect = 4.451e-157
Identity = 208/248 (83.87%), Postives = 226/248 (91.13%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLP 744
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G      S +G TLLEA+D I PP RPT+KPLRLP
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG------SASGTTLLEALDCILPPTRPTDKPLRLP 249          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Mouse
Match: Eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:MGI Symbol;Acc:MGI:1096881])

HSP 1 Score: 343.199 bits (879), Expect = 1.114e-120
Identity = 162/179 (90.50%), Postives = 173/179 (96.65%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPD 537
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPD 186          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Mouse
Match: Hbs1l (Hbs1-like (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1891704])

HSP 1 Score: 251.136 bits (640), Expect = 1.997e-78
Identity = 122/262 (46.56%), Postives = 168/262 (64.12%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTN---MPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIG 777
            +N+VVIGHVD+GKST  GHM+Y  G ++KRT+ K+E+E++  GK SF YAWVLD+   ERERG+T+D+ + KFETT   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQTREH LL  +LGV Q+ V +NK+D     + + R+ EI  ++  ++K+ G+    VAF+P SG  G+N+   S +     W+K                  G+ LLE +D+  PP R  +KP RL + DV+K  G G
Sbjct:  259 LNLVVIGHVDAGKSTLMGHMLYLLGNVNKRTMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVAFIPTSGLSGENLTARSQSSDLTTWYK------------------GMCLLEQIDSFKPPQRSIDKPFRLCVSDVFKDQGSG 500          
BLAST of Elongation factor 1-alpha 1 vs. UniProt/SwissProt
Match: sp|P62630|EF1A1_RAT (Elongation factor 1-alpha 1 OS=Rattus norvegicus OX=10116 GN=Eef1a1 PE=2 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 1.142e-165
Identity = 223/263 (84.79%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G      S +G TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG------SASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. UniProt/SwissProt
Match: sp|P10126|EF1A1_MOUSE (Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3)

HSP 1 Score: 469.929 bits (1208), Expect = 1.142e-165
Identity = 223/263 (84.79%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G      S +G TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG------SASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. UniProt/SwissProt
Match: sp|P62629|EF1A1_CRIGR (Elongation factor 1-alpha 1 OS=Cricetulus griseus OX=10029 GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 1.142e-165
Identity = 223/263 (84.79%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G      S +G TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG------SASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. UniProt/SwissProt
Match: sp|Q5VTE0|EF1A3_HUMAN (Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 2.955e-165
Identity = 222/263 (84.41%), Postives = 240/263 (91.25%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G        +G TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNA------SGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. UniProt/SwissProt
Match: sp|P13549|EF1A0_XENLA (Elongation factor 1-alpha, somatic form OS=Xenopus laevis OX=8355 GN=eef1as PE=2 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 3.260e-165
Identity = 225/263 (85.55%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVGINK+DSTEPPYS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW I RK G      S +G TLLEA+D I PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSPNMPWFKGWKITRKEG------SGSGTTLLEALDCILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. TrEMBL
Match: A0A267FB43 (Tr-type G domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033269g1 PE=4 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 9.654e-168
Identity = 227/263 (86.31%), Postives = 245/263 (93.16%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            I+IVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEK+EKEAQ++GKGSFKYAWVLDKLKAERERGITIDIALWKFET  YYVTVIDAPGHRDFIKNMITGTSQADCAVLI+AAGVGEFEAGISKNGQTREHALLAYTLGVKQMI+G+NK+DSTEPPYSE+RYNEIKKEVS YIKKVGYNPD+VAFVPISGW GDNM+  S NM WFKGW+IKRK    K+E +  G TL+EA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 ISIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKYEKEAQELGKGSFKYAWVLDKLKAERERGITIDIALWKFETEKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIIGVNKMDSTEPPYSEARYNEIKKEVSAYIKKVGYNPDAVAFVPISGWHGDNMIEESNNMSWFKGWSIKRKLPGKKEETTTEGKTLIEALDAIIPPERPTDKPLRLPLQDVYKIGGIGTVPV 270          
BLAST of Elongation factor 1-alpha 1 vs. TrEMBL
Match: A0A267GV80 (Tr-type G domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033269g2 PE=4 SV=1)

HSP 1 Score: 473.011 bits (1216), Expect = 8.644e-167
Identity = 226/263 (85.93%), Postives = 244/263 (92.78%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            I+IVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEK+EKEAQ++GKGSFKYAWVLDKLKAERERGITIDIALWKFE   YYVTVIDAPGHRDFIKNMITGTSQADCAVLI+AAGVGEFEAGISKNGQTREHALLAYTLGVKQMI+G+NK+DSTEPPYSE+RYNEIKKEVS YIKKVGYNPD+VAFVPISGW GDNM+  S NM WFKGW+IKRK    K+E +  G TL+EA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 ISIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKYEKEAQELGKGSFKYAWVLDKLKAERERGITIDIALWKFEIEKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIIGVNKMDSTEPPYSEARYNEIKKEVSAYIKKVGYNPDAVAFVPISGWHGDNMIEESNNMSWFKGWSIKRKLPGKKEETTTEGKTLIEALDAIIPPERPTDKPLRLPLQDVYKIGGIGTVPV 270          
BLAST of Elongation factor 1-alpha 1 vs. TrEMBL
Match: E1XUM3 (Elongation factor 1-alpha OS=Macrostomum lignano OX=282301 GN=efa1a PE=2 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 3.335e-166
Identity = 227/263 (86.31%), Postives = 245/263 (93.16%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            +NIVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEK+EKEAQ++GKGSFKYAWVLDKLKAERERGITIDIALWKFET  YYVTVIDAPGHRDFIKNMITGTSQADCAVLI+AAGVGEFEAGISKNGQTREHALLAYTLGVKQMI+G+NK+DSTEPPYSE+RYNEIKKEVS YIKKVGYNPD+VAFVPISGW GDNM+  S NM WFKGW+IKRK    K+E +  G TL+EA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    9 VNIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKYEKEAQELGKGSFKYAWVLDKLKAERERGITIDIALWKFETEKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIIGVNKMDSTEPPYSEARYNEIKKEVSAYIKKVGYNPDAVAFVPISGWHGDNMIEESNNMSWFKGWSIKRKLPGKKEETTTEGKTLIEALDAIIPPERPTDKPLRLPLQDVYKIGGIGTVPV 271          
BLAST of Elongation factor 1-alpha 1 vs. TrEMBL
Match: A0A267F9J4 (Elongation factor 1-alpha OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017901g1 PE=3 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 3.484e-166
Identity = 227/263 (86.31%), Postives = 245/263 (93.16%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            +NIVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEK+EKEAQ++GKGSFKYAWVLDKLKAERERGITIDIALWKFET  YYVTVIDAPGHRDFIKNMITGTSQADCAVLI+AAGVGEFEAGISKNGQTREHALLAYTLGVKQMI+G+NK+DSTEPPYSE+RYNEIKKEVS YIKKVGYNPD+VAFVPISGW GDNM+  S NM WFKGW+IKRK    K+E +  G TL+EA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    9 VNIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKYEKEAQELGKGSFKYAWVLDKLKAERERGITIDIALWKFETEKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIIGVNKMDSTEPPYSEARYNEIKKEVSAYIKKVGYNPDAVAFVPISGWHGDNMIEESNNMSWFKGWSIKRKLPGKKEETTTEGKTLIEALDAIIPPERPTDKPLRLPLQDVYKIGGIGTVPV 271          
BLAST of Elongation factor 1-alpha 1 vs. TrEMBL
Match: A0A267FSI2 (Elongation factor 1-alpha OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017901g2 PE=3 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 3.523e-166
Identity = 227/263 (86.31%), Postives = 245/263 (93.16%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            +NIVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEK+EKEAQ++GKGSFKYAWVLDKLKAERERGITIDIALWKFET  YYVTVIDAPGHRDFIKNMITGTSQADCAVLI+AAGVGEFEAGISKNGQTREHALLAYTLGVKQMI+G+NK+DSTEPPYSE+RYNEIKKEVS YIKKVGYNPD+VAFVPISGW GDNM+  S NM WFKGW+IKRK    K+E +  G TL+EA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    9 VNIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKYEKEAQELGKGSFKYAWVLDKLKAERERGITIDIALWKFETEKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIIGVNKMDSTEPPYSEARYNEIKKEVSAYIKKVGYNPDAVAFVPISGWHGDNMIEESNNMSWFKGWSIKRKLPGKKEETTTEGKTLIEALDAIIPPERPTDKPLRLPLQDVYKIGGIGTVPV 271          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Cavefish
Match: ENSAMXT00000053636.1 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 464.537 bits (1194), Expect = 1.379e-164
Identity = 219/263 (83.27%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ YY+T+IDAPGHRDFIKNMITGTSQADCAVLIVA GVGEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DSTEPPYS++R+ EI KEVS YIKK+GYNP +VAFVPISGW GDNM+ PS+NM WFKGW I+RK G        +G TLLEA+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEGNA------SGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Cavefish
Match: ENSAMXT00000032787.1 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 464.151 bits (1193), Expect = 1.894e-164
Identity = 219/263 (83.27%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ YY+T+IDAPGHRDFIKNMITGTSQADCAVLIVA GVGEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DSTEPPYS++R+ EI KEVS YIKK+GYNP +VAFVPISGW GDNM+ PS+NM WFKGW I+RK G        +G TLLEA+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEGNA------SGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Cavefish
Match: ENSAMXT00000021279.2 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 463.766 bits (1192), Expect = 2.838e-164
Identity = 219/263 (83.27%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ YY+T+IDAPGHRDFIKNMITGTSQADCAVLIVA GVGEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DSTEPPYS++R+ EI KEVS YIKK+GYNP +VAFVPISGW GDNM+ PS+NM WFKGW I+RK G        +G TLLEA+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEGNA------SGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Cavefish
Match: ENSAMXT00000043242.1 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 463.381 bits (1191), Expect = 3.690e-164
Identity = 219/263 (83.27%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ YY+T+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DSTEPPYS+ R+ EI KEVS YIKK+GYNP +VAFVPISGW GDNM+ PS+NM WFKGW I+RK G +      +G TLLEA+D+I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQKRFEEITKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEGGS------SGTTLLEALDSILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Cavefish
Match: ENSAMXT00000052370.1 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 462.611 bits (1189), Expect = 7.508e-164
Identity = 218/263 (82.89%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ YY+T+IDAPGHRDFIKNMITGTSQADCAVLIVA GVGEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DSTEPPYS++R+ EI KEVS YIKK+GYNP +VAFVPISGW GDNM+ PS+NM WFKGW I+RK G +      +G TLLEA+D+I PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEGGS------SGTTLLEALDSILPPTRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011427.1 (pep scaffold:Pmarinus_7.0:GL499053:103:1494:1 gene:ENSPMAG00000010399.1 transcript:ENSPMAT00000011427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 466.077 bits (1198), Expect = 8.058e-166
Identity = 223/263 (84.79%), Postives = 239/263 (90.87%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET  YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQ+IVGINK+DSTEPPYS  RYNEI KEV  YIKK+GYNP +V FVPISGW GDNM+  STNMPWFKGW ++RK+G        +G TLLEA+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETQKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSSDRYNEIVKEVGTYIKKIGYNPAAVGFVPISGWHGDNMLEASTNMPWFKGWKVERKDGNA------SGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Sea Lamprey
Match: hbs1l (HBS1-like translational GTPase [Source:ZFIN;Acc:ZDB-GENE-030131-2987])

HSP 1 Score: 246.128 bits (627), Expect = 2.706e-77
Identity = 119/262 (45.42%), Postives = 168/262 (64.12%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTN---MPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIG 777
            IN+VVIGHVD+GKST  GH++Y  G ++KR + K+E+E++  GK SF YAWVLD+   ERERG+T+D+ L KFE+    VT++DAPGH+DFI NMITG +QAD A+L+V +  GEFEAG    GQTREHALL  +LGV Q+ V INK+D     +S+ R+ EI  ++  ++K+ G+    V ++P SG  G+N+ + S +     W+                  +G  LL+ +D+  PP RP +KP RL + DV+K  G G
Sbjct:  261 INLVVIGHVDAGKSTLMGHLLYLLGNVNKRAMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGLTKFESKTKLVTLMDAPGHKDFIPNMITGAAQADVALLVVDSITGEFEAGFEAGGQTREHALLVRSLGVTQLAVAINKMDMLN--WSKERFEEITSKLGQFLKQAGFKESDVTYIPTSGLSGENLAMRSKDEKLTSWY------------------SGPCLLDCIDSFRPPQRPVDKPCRLCVSDVFKDVGAG 502          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Sea Lamprey
Match: eefsec (eukaryotic elongation factor, selenocysteine-tRNA-specific [Source:ZFIN;Acc:ZDB-GENE-051120-72])

HSP 1 Score: 47.7506 bits (112), Expect = 1.292e-6
Identity = 41/165 (24.85%), Postives = 62/165 (37.58%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFET---------------TNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTRE-HALLAYTLGVKQMIVGINKID 447
             N+ V+GHVDSGK++    +                         S       DK    RERGIT+D+    F                     VT++D PGH   I+ +I G    D  +L++          ++K  QT+    LL   +   +M+V +NK D
Sbjct:    8 FNVGVLGHVDSGKTSLARAL------------------------SSTASTAAFDKNPQSRERGITLDLGFSAFGAPLPAHLRDDPRAGGYEALQVTLVDCPGHASLIRTIIGGAQIIDLMMLVI---------DVTKGMQTQSAECLLIGEITCPRMMVVLNKTD 139          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Sea Lamprey
Match: gtpbp2b (GTP binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-050208-373])

HSP 1 Score: 45.0542 bits (105), Expect = 8.827e-6
Identity = 49/184 (26.63%), Postives = 78/184 (42.39%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALW--KFETTNY---------------YVTVIDAPGHRDFIKNMITG-TSQA-DCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKK 495
            + + V+G+VD+GKST  G  +   G +D              G+        L ++++ R   I+ +I  +  K E  NY                +T ID  GH  +++  I G TS A D A+L+V A  G         G  +EH  LA  L V   IV ++K+D   P   E    ++++
Sbjct:  112 LRVAVLGNVDAGKSTLLG--VLTQGELD-----------NGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYNGSRTAEEICESSSKMITFIDLAGHHKYLRTTIFGLTSYAPDFAMLVVGANTGLV-------GTAKEHLGLAMALKVPFFIV-VSKVDVCSPGTVERTVRQLER 274          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Yeast
Match: TEF1 (Translational elongation factor EF-1 alpha; in the GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; associates with vacuolar Rho1p GTPase; may also have a role in tRNA re-export from the nucleus; TEF1 has a paralog, TEF2, that arose from the whole genome duplication [Source:SGD;Acc:S000006284])

HSP 1 Score: 420.239 bits (1079), Expect = 4.929e-148
Identity = 203/263 (77.19%), Postives = 229/263 (87.07%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            IN+VVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA ++GKGSFKYAWVLDKLKAERERGITIDIALWKFET  Y VTVIDAPGHRDFIKNMITGTSQADCA+LI+A GVGEFEAGISK+GQTREHALLA+TLGV+Q+IV +NK+DS +  + ESR+ EI KE S +IKKVGYNP +V FVPISGW GDNM+  +TN PW+KGW  + K G  K      G TLLEA+DAI+ P+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVK--WDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVK------GKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPV 262          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Yeast
Match: TEF2 (Translational elongation factor EF-1 alpha; in the GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; associates with vacuolar Rho1p GTPase; TEF2-RFP levels increase during replicative aging; may also have a role in tRNA re-export from the nucleus; TEF2 has a paralog, TEF1, that arose from the whole genome duplication [Source:SGD;Acc:S000000322])

HSP 1 Score: 420.239 bits (1079), Expect = 4.929e-148
Identity = 203/263 (77.19%), Postives = 229/263 (87.07%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            IN+VVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA ++GKGSFKYAWVLDKLKAERERGITIDIALWKFET  Y VTVIDAPGHRDFIKNMITGTSQADCA+LI+A GVGEFEAGISK+GQTREHALLA+TLGV+Q+IV +NK+DS +  + ESR+ EI KE S +IKKVGYNP +V FVPISGW GDNM+  +TN PW+KGW  + K G  K      G TLLEA+DAI+ P+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVK--WDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVK------GKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPV 262          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Yeast
Match: HBS1 (GTPase with similarity to translation release factors; together with binding partner Dom34p, facilitates ribosomal subunit dissociation and peptidyl-tRNA release when translation is stalled, particularly in 3' UTRs; genetically implicated in mRNA no-go decay; HBS1 has a paralog, SKI7, that arose from the whole genome duplication [Source:SGD;Acc:S000001792])

HSP 1 Score: 187.963 bits (476), Expect = 3.659e-56
Identity = 82/192 (42.71%), Postives = 130/192 (67.71%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGD 576
            ++ VV+GHVD+GKST  G ++Y    +++  + K ++E++ MGK SFK+AW++D+   ERERG+T+ I    F T     T++DAPGHRDF+ N I G SQAD A+L V      FE+G   +GQT+EH LLA +LG+  +I+ +NK+D+ +  +S+ R+ EIK ++  Y+  +G+  D++ +VPISG+ G+
Sbjct:  168 LSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLASSLGIHNLIIAMNKMDNVD--WSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGE 357          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Yeast
Match: SUP35 (Translation termination factor eRF3; has a role in mRNA deadenylation and decay; altered protein conformation creates the [PSI(+)] prion that modifies cellular fitness, alters translational fidelity by affecting reading frame selection, and results in a nonsense suppressor phenotype; many stress-response genes are repressed in the presence of [PSI(+)] [Source:SGD;Acc:S000002579])

HSP 1 Score: 184.111 bits (466), Expect = 3.275e-54
Identity = 103/264 (39.02%), Postives = 157/264 (59.47%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYN-PDSVAFVPISGWVGDNMV--LPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTV 783
            ++++ +GHVD+GKST  G+++Y  G +DKRTIEK+E+EA+D G+  +  +WV+D  K ER  G TI++    FET     T++DAPGH+ ++  MI G SQAD  VL+++A  GE+E G  + GQTREHALLA T GV +M+V +NK+D     +S+ RY++    VS +++ +GYN    V F+P+SG+ G N+   +     PW+                   G TLLE +D ++   R    P  LP+    K+  +GT+
Sbjct:  261 VSLIFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNKEERNDGKTIEVGKAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGVLVISARKGEYETGFERGGQTREHALLAKTQGVNKMVVVVNKMDDPTVNWSKERYDQCVSNVSNFLRAIGYNIKTDVVFMPVSGYSGANLKDHVDPKECPWY------------------TGPTLLEYLDTMNHVDRHINAPFMLPI--AAKMKDLGTI 504          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Yeast
Match: TUF1 (Mitochondrial translation elongation factor Tu (EF-Tu); involved in fundamental pathway of mtDNA homeostasis; comprises both GTPase and guanine nucleotide exchange factor activities, while these activities are found in separate proteins in S. pombe and humans; rare mutations in human mitochondrial elongation factor Tu (EFTu) associated with severe lactic acidosis, rapidly progressive fatal encephalopathy, severe infantile macrocystic leukodystrophy with micropolygyria [Source:SGD;Acc:S000005713])

HSP 1 Score: 124.02 bits (310), Expect = 2.398e-33
Identity = 86/262 (32.82%), Postives = 126/262 (48.09%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDP-PARPTEKPLRLPLQDVYKIGGIGTV 783
            +NI  IGHVD GK+T T         I K    K        G  +F     +DK   ER RGITI  A  ++ET   + + +D PGH D+IKNMITG +Q D A+++VAA  G+         QTREH LLA  +GV+ ++V +NK+D+ + P        ++ E+   + + G++ D                    N P   G  +    G   +    A + LL+A+D   P P R   KP  +P++D++ I G GTV
Sbjct:   49 VNIGTIGHVDHGKTTLTA-------AITKTLAAK--------GGANFLDYAAIDKAPEERARGITISTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMP-------QTREHLLLARQVGVQHIVVFVNKVDTIDDP---EMLELVEMEMRELLNEYGFDGD--------------------NAPIIMGSALCALEGRQPEIGEQAIMKLLDAVDEYIPTPERDLNKPFLMPVEDIFSISGRGTV 265          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Nematostella
Match: EF1ALPHA (Elongation factor 1-alpha [Source:UniProtKB/TrEMBL;Acc:A7SSW8])

HSP 1 Score: 447.203 bits (1149), Expect = 6.059e-158
Identity = 210/263 (79.85%), Postives = 237/263 (90.11%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKE+ +MGKGSFKYAWVLDKLKAERERGITIDIALWKFET  YYVTVIDAPGHRDFIKNMITGTSQADCAVLI+A+G GEFEAGISKNGQTREHALLAYTLGVKQM+V  NK+DSTEPPYSE+R+ EI+KEV+ ++KKVG+NP +V F+PISG+ GDNM+  S NMPWFK W I+R +  TKKE + +GVTL E +D+I PP+RP+  PLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIASGTGEFEAGISKNGQTREHALLAYTLGVKQMLVCANKMDSTEPPYSEARFKEIQKEVANFLKKVGFNPKAVPFIPISGFHGDNMLEKSENMPWFKQWTIERVDPATKKEANASGVTLFEGLDSILPPSRPSGLPLRLPLQDVYKIGGIGTVPV 270          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Nematostella
Match: EDO47521 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM15])

HSP 1 Score: 227.254 bits (578), Expect = 6.437e-72
Identity = 119/273 (43.59%), Postives = 165/273 (60.44%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFE-------------KEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGT 780
            +N+V+IGHVD+GKST  GH+++  G + K+ + K+               E++  GK SF YAWVLD+   ERERGIT+D+ L +F+T N  +T++DAPGH+DFI NMITG +QAD A+L+V A  GEFEAG    GQTREHA+L  +LGV Q+IV INK+D     +SE RY  I  ++  ++K+VG+    V +VP+SG  G+N+V P T     K W                G  L++ +D    P R  +KP R  + DVYK  G+GT
Sbjct:   39 LNLVIIGHVDAGKSTLMGHLLFLLGDVSKKAMHKYPFFFLIIIFNLKACTESKKAGKASFAYAWVLDETGEERERGITMDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQTREHAILVRSLGVTQLIVAINKLDMMS--WSEERYLHIVSKLKHFLKQVGFKDSDVVYVPVSGLSGENLVKPCTEEK-LKKW--------------YQGQCLVDRIDEFKSPKRDMDKPWRFCVSDVYK--GLGT 292          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Nematostella
Match: EDO48034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR5])

HSP 1 Score: 211.46 bits (537), Expect = 5.132e-66
Identity = 103/264 (39.02%), Postives = 166/264 (62.88%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDS-VAFVPISGWVGDNMVLP--STNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTV 783
            +NI+ IGHVD+GKST  GH++Y  G +DKRT+EK+E+EA++  + ++  +W LD  + ER++G T+++    F+T   + T++DAPGH+ F+ NMI+G +QAD  VL+++A  GEFE G  + GQTREHA+LA T GVK +++ +NK+D     ++E RY EIK +++ ++KKVG+NP + + ++P SG  G N+  P      PW+                  +G   L+ +D +    R  + P+RLP+ D Y+   +GT+
Sbjct:   30 VNIIFIGHVDAGKSTIGGHVMYLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAAFDTDTKHFTLLDAPGHKSFVPNMISGAAQADLGVLVISARKGEFETGFERGGQTREHAMLAKTAGVKHLVILVNKMDDPTVKWNEERYEEIKVKLTPFLKKVGFNPKTDIMYMPCSGLTGANLKEPLDPQVCPWY------------------SGKPFLKYIDQLPSLTRSVDGPVRLPIADKYR--DMGTI 273          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Nematostella
Match: EDO39883 (Elongation factor Tu [Source:UniProtKB/TrEMBL;Acc:A7S8T2])

HSP 1 Score: 117.087 bits (292), Expect = 1.452e-30
Identity = 90/268 (33.58%), Postives = 127/268 (47.39%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA-----YTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNM-VLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDP-PARPTEKPLRLPLQDVYKIGGIGTV 783
            +NI  IGHVD GK+T T  +                K   D G  +FK    +D    ER RGITI+ A  +++T   +   +D PGH D+IKNMITG +Q D A+L+VA   G+         QTREH LLA      ++GVK ++V +NK D  + P          +E+                    G+ GDN  ++  + +   +G N      + KK        LLEA+D+  P PAR  +KP  LP++DV+ I G GTV
Sbjct:   16 VNIGTIGHVDHGKTTLTAAIT---------------KVLADTGAANFKSYGDIDNAPEERARGITINTAHVEYQTEKRHYGHVDCPGHADYIKNMITGAAQMDGAILVVAGTDGQMP-------QTREHLLLANQASKCSVGVKDIVVYVNKADMIDDPELLELVELELRELLSEY----------------GYDGDNTPIIIGSALCALEGKNDDLGINSIKK--------LLEAVDSHIPTPARDLDKPFLLPIEDVFSISGRGTV 237          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Nematostella
Match: EDO48035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR6])

HSP 1 Score: 97.0561 bits (240), Expect = 7.612e-26
Identity = 40/92 (43.48%), Postives = 67/92 (72.83%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFI 276
            +NI+ IGHVD+GKST  GH++Y  G +DKRT+EK+E+EA++  + ++  +W LD  + ER++G T+++    F+T   + T++DAPGH+ F+
Sbjct:    3 VNIIFIGHVDAGKSTIGGHVMYLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAAFDTDTKHFTLLDAPGHKSFV 94          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Medaka
Match: ENSORLT00000009507.2 (elongation factor 1-alpha [Source:NCBI gene;Acc:101170939])

HSP 1 Score: 460.685 bits (1184), Expect = 4.384e-163
Identity = 219/263 (83.27%), Postives = 240/263 (91.25%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DSTEPPYS++R+ EI+KEVS YIKK+GYNP +VAFVPISGW GDNM+  S  M WFKGW I+RK G         GVTLLEA+D+I PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEASDKMSWFKGWKIERKEG------GATGVTLLEALDSILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Medaka
Match: eef1a (elongation factor 1 alpha [Source:NCBI gene;Acc:100049188])

HSP 1 Score: 460.685 bits (1184), Expect = 5.103e-163
Identity = 220/263 (83.65%), Postives = 241/263 (91.63%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA+TLGVKQ+IVG+NK+DSTEPPYS++R+ EI+KEVS YIKK+GYNP +VAFVPISGW GDNM+  S  M WFKGW I+RK+G        +G TLLEA+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSTYIKKIGYNPAAVAFVPISGWHGDNMLEASDKMSWFKGWKIERKDGNA------SGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Medaka
Match: eef1a1a (elongation factor 1-alpha 1 [Source:NCBI gene;Acc:101166076])

HSP 1 Score: 401.749 bits (1031), Expect = 2.657e-137
Identity = 199/263 (75.67%), Postives = 213/263 (80.99%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ                         T+P YS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NM WFKGW I RK G        +G TLLEA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ-------------------------TQPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEGNA------SGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPV 239          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Medaka
Match: eef1a1a (elongation factor 1-alpha 1 [Source:NCBI gene;Acc:101166076])

HSP 1 Score: 402.134 bits (1032), Expect = 3.711e-137
Identity = 199/263 (75.67%), Postives = 213/263 (80.99%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKST+TGH+IYKCGGIDKRTIEKFEKEA +MGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+ YYVT+IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ                         T+P YS+ RY EI KEVS YIKK+GYNPD+VAFVPISGW GDNM+ PS NM WFKGW I RK G        +G TLLEA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPV
Sbjct:   23 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ-------------------------TQPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEGNA------SGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPV 254          
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Medaka
Match: si:dkey-37o8.1 (42Sp50 [Source:NCBI gene;Acc:100049338])

HSP 1 Score: 390.578 bits (1002), Expect = 1.686e-135
Identity = 176/263 (66.92%), Postives = 219/263 (83.27%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            +N+VVIGHVDSGKST+TGH++YKCGGID R +EKFEK A  +GK SFK+AWVLDKLKAERERGITIDI+L KF T  Y +T+IDAPGHRDFIKNMITGTSQAD A+L+V+A  GE+EAG+S++GQTREHALLAYTLGVKQ+IV +NK+D TEPPYS+ RY E+ + VSG+++K+GY+ ++V FVP+SGW G+NM+  +  MPW++GW I+R+ G +       G TLLE +D+I PP R   KPLRLPLQDVYKIGG+GTVPV
Sbjct:    8 VNVVVIGHVDSGKSTTTGHLVYKCGGIDPRKLEKFEKAAAQLGKSSFKFAWVLDKLKAERERGITIDISLLKFNTQKYTMTIIDAPGHRDFIKNMITGTSQADVALLMVSAAKGEYEAGVSRSGQTREHALLAYTLGVKQIIVCVNKMDLTEPPYSQKRYEEVMRGVSGFLRKIGYDTNAVPFVPVSGWTGENMISVTQKMPWYQGWKIRRREGPS------TGKTLLEVLDSIQPPVRTINKPLRLPLQDVYKIGGVGTVPV 264          
BLAST of Elongation factor 1-alpha 1 vs. Planmine SMEST
Match: SMESG000078056.1 (SMESG000078056.1)

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 259/263 (98.48%), Postives = 262/263 (99.62%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFET+NYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNP+SVAFVPISGWVGDNMVLPSTNMPWFKGW+IKRKNG TKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPESVAFVPISGWVGDNMVLPSTNMPWFKGWSIKRKNGATKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 270          
BLAST of Elongation factor 1-alpha 1 vs. Planmine SMEST
Match: SMESG000052648.1 (SMESG000052648.1)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 258/263 (98.10%), Postives = 261/263 (99.24%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFET+NYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSE+RYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGW IKRKNG TKKEESL+GVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSENRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 270          
BLAST of Elongation factor 1-alpha 1 vs. Planmine SMEST
Match: SMESG000061164.1 (SMESG000061164.1)

HSP 1 Score: 468.774 bits (1205), Expect = 2.439e-166
Identity = 222/263 (84.41%), Postives = 243/263 (92.40%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFETT +YVTVIDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQMIVG+NK+DSTEPP+ E R++EIKKEVS Y+KKVGY PDSVAFVPISGW GDNM+  S+NMPW+KGW + R+N   K+E  + G TLL+A+DA++PPARPT KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNA-KKEETKVTGKTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPV 269          
BLAST of Elongation factor 1-alpha 1 vs. Planmine SMEST
Match: SMESG000061099.1 (SMESG000061099.1)

HSP 1 Score: 468.774 bits (1205), Expect = 2.439e-166
Identity = 222/263 (84.41%), Postives = 243/263 (92.40%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            INIVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFETT +YVTVIDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQMIVG+NK+DSTEPP+ E R++EIKKEVS Y+KKVGY PDSVAFVPISGW GDNM+  S+NMPW+KGW + R+N   K+E  + G TLL+A+DA++PPARPT KPLRLPLQDVYKIGGIGTVPV
Sbjct:    8 INIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNA-KKEETKVTGKTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPV 269          
BLAST of Elongation factor 1-alpha 1 vs. Planmine SMEST
Match: SMESG000040079.1 (SMESG000040079.1)

HSP 1 Score: 217.238 bits (552), Expect = 2.271e-66
Identity = 112/271 (41.33%), Postives = 164/271 (60.52%), Query Frame = 1
Query:    1 INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMV--------LPSTNMPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPV 789
            IN++ IGHVD+GKST  G+++++   +  R + K++ EAQ +GK SF+YAW+LD+   ER RGIT D+A   FET+N  + ++DAPGH+DFI NMITG +QAD A+L+V A  GEFE G    GQTREHALL   LG+  +IV +NK+D+    +S+ R++EI ++V  ++K +  N     F P+SG +G N+         L +  M W+KG                    L++ +D +D P R  +KPLR+ + DV+K  G G   V
Sbjct:  159 INLITIGHVDAGKSTLMGNLLFQMKYVSDRKLSKYKHEAQKVGKTSFQYAWILDESTEERSRGITTDVAQTYFETSNRKIILLDAPGHKDFIPNMITGATQADAALLVVNATKGEFETGFDLGGQTREHALLVRMLGINDIIVAVNKMDTVN--WSQERFDEISEKVKKFLKSLKING---KFCPVSGLMGTNLTDNVDNDSFLVNKVMSWYKGP------------------MLIDLIDELDCPTRSLDKPLRINVTDVFKPQGSGIYQV 406          
The following BLAST results are available for this feature:
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EEF1A17.329e-16684.41eukaryotic translation elongation factor 1 alpha 1... [more]
EEF1A17.329e-16684.41eukaryotic translation elongation factor 1 alpha 1... [more]
EEF1A17.329e-16684.41eukaryotic translation elongation factor 1 alpha 1... [more]
EEF1A11.525e-16584.41eukaryotic translation elongation factor 1 alpha 1... [more]
EEF1A29.005e-16483.65eukaryotic translation elongation factor 1 alpha 2... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef-1A.21.479e-15880.23Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
eef-1A.21.479e-15880.23Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
eef-1A.21.479e-15880.23Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
eef-1A.21.479e-15880.23Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
eef-1A.11.479e-15880.23Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eEF1alpha16.849e-16684.41gene:FBgn0284245 transcript:FBtr0088035[more]
eEF1alpha16.849e-16684.41gene:FBgn0284245 transcript:FBtr0345023[more]
eEF1alpha16.849e-16684.41gene:FBgn0284245 transcript:FBtr0331927[more]
eEF1alpha16.849e-16684.41gene:FBgn0284245 transcript:FBtr0345022[more]
eEF1alpha25.283e-16584.03gene:FBgn0000557 transcript:FBtr0085835[more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef1a1l11.869e-16584.41eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1a2.360e-16484.41eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1a2.360e-16484.41eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1b3.576e-16484.03eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1l23.576e-16484.03eukaryotic translation elongation factor 1 alpha 1... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef1a13.846e-16685.17eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a11.739e-16585.17eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a25.568e-16484.03eukaryotic translation elongation factor 1 alpha 2... [more]
map3k12.511e-16384.79mitogen-activated protein kinase kinase kinase 1, ... [more]
anp32b5.616e-16181.75acidic nuclear phosphoprotein 32 family member B [... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eef1a11.632e-16684.79eukaryotic translation elongation factor 1 alpha 1... [more]
Eef1a26.972e-16483.65eukaryotic translation elongation factor 1 alpha 2... [more]
Eef1a14.451e-15783.87eukaryotic translation elongation factor 1 alpha 1... [more]
Eef1a11.114e-12090.50eukaryotic translation elongation factor 1 alpha 1... [more]
Hbs1l1.997e-7846.56Hbs1-like (S. cerevisiae) [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62630|EF1A1_RAT1.142e-16584.79Elongation factor 1-alpha 1 OS=Rattus norvegicus O... [more]
sp|P10126|EF1A1_MOUSE1.142e-16584.79Elongation factor 1-alpha 1 OS=Mus musculus OX=100... [more]
sp|P62629|EF1A1_CRIGR1.142e-16584.79Elongation factor 1-alpha 1 OS=Cricetulus griseus ... [more]
sp|Q5VTE0|EF1A3_HUMAN2.955e-16584.41Putative elongation factor 1-alpha-like 3 OS=Homo ... [more]
sp|P13549|EF1A0_XENLA3.260e-16585.55Elongation factor 1-alpha, somatic form OS=Xenopus... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FB439.654e-16886.31Tr-type G domain-containing protein OS=Macrostomum... [more]
A0A267GV808.644e-16785.93Tr-type G domain-containing protein OS=Macrostomum... [more]
E1XUM33.335e-16686.31Elongation factor 1-alpha OS=Macrostomum lignano O... [more]
A0A267F9J43.484e-16686.31Elongation factor 1-alpha OS=Macrostomum lignano O... [more]
A0A267FSI23.523e-16686.31Elongation factor 1-alpha OS=Macrostomum lignano O... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000053636.11.379e-16483.27elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000032787.11.894e-16483.27elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000021279.22.838e-16483.27elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000043242.13.690e-16483.27elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000052370.17.508e-16482.89elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000011427.18.058e-16684.79pep scaffold:Pmarinus_7.0:GL499053:103:1494:1 gene... [more]
hbs1l2.706e-7745.42HBS1-like translational GTPase [Source:ZFIN;Acc:ZD... [more]
eefsec1.292e-624.85eukaryotic elongation factor, selenocysteine-tRNA-... [more]
gtpbp2b8.827e-626.63GTP binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TEF14.929e-14877.19Translational elongation factor EF-1 alpha; in the... [more]
TEF24.929e-14877.19Translational elongation factor EF-1 alpha; in the... [more]
HBS13.659e-5642.71GTPase with similarity to translation release fact... [more]
SUP353.275e-5439.02Translation termination factor eRF3; has a role in... [more]
TUF12.398e-3332.82Mitochondrial translation elongation factor Tu (EF... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EF1ALPHA6.059e-15879.85Elongation factor 1-alpha [Source:UniProtKB/TrEMB... [more]
EDO475216.437e-7243.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480345.132e-6639.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398831.452e-3033.58Elongation factor Tu [Source:UniProtKB/TrEMBL;Acc... [more]
EDO480357.612e-2643.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000009507.24.384e-16383.27elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
eef1a5.103e-16383.65elongation factor 1 alpha [Source:NCBI gene;Acc:10... [more]
eef1a1a2.657e-13775.67elongation factor 1-alpha 1 [Source:NCBI gene;Acc:... [more]
eef1a1a3.711e-13775.67elongation factor 1-alpha 1 [Source:NCBI gene;Acc:... [more]
si:dkey-37o8.11.686e-13566.9242Sp50 [Source:NCBI gene;Acc:100049338][more]
back to top
BLAST of Elongation factor 1-alpha 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078056.10.000e+098.48SMESG000078056.1[more]
SMESG000052648.10.000e+098.10SMESG000052648.1[more]
SMESG000061164.12.439e-16684.41SMESG000061164.1[more]
SMESG000061099.12.439e-16684.41SMESG000061099.1[more]
SMESG000040079.12.271e-6641.33SMESG000040079.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004295 ID=SMED30004295|Name=Elongation factor 1-alpha 1|organism=Schmidtea mediterranea sexual|type=transcript|length=791bp
ATCAATATCGTTGTCATCGGACACGTCGACAGTGGAAAATCTACTTCTAC
TGGGCATATGATCTACAAATGCGGTGGTATCGACAAGAGAACCATTGAAA
AATTCGAGAAGGAAGCCCAAGATATGGGTAAAGGATCCTTTAAATACGCC
TGGGTCTTGGACAAATTGAAGGCAGAAAGAGAACGTGGTATCACTATTGA
TATTGCTTTGTGGAAATTCGAAACTACCAACTACTATGTAACAGTCATTG
ATGCCCCAGGCCATCGTGATTTCATCAAAAACATGATCACTGGTACCTCA
CAAGCCGATTGTGCAGTATTGATTGTTGCAGCTGGTGTTGGTGAGTTCGA
AGCTGGTATTAGCAAGAACGGCCAAACCAGAGAACATGCTCTTTTGGCTT
ACACTTTGGGTGTCAAACAAATGATTGTCGGTATCAACAAGATTGATTCA
ACTGAACCACCATATAGCGAAAGCCGATACAATGAAATTAAGAAAGAAGT
TTCAGGTTACATTAAGAAGGTTGGTTACAATCCAGATTCAGTCGCTTTTG
TACCAATTTCTGGATGGGTTGGGGACAACATGGTCCTTCCAAGTACTAAC
ATGCCATGGTTCAAGGGATGGAACATTAAGAGAAAGAATGGTACCACCAA
AAAAGAAGAAAGCCTTGCTGGTGTTACTCTTTTGGAAGCTATGGATGCCA
TTGATCCACCAGCTAGACCAACCGAAAAACCTTTGAGACTTCCTCTTCAA
GATGTCTACAAAATTGGTGGTATTGGAACAGTTCCAGTTGG
back to top

protein sequence of SMED30004295-orf-1

>SMED30004295-orf-1 ID=SMED30004295-orf-1|Name=SMED30004295-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=263bp
INIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYA
WVLDKLKAERERGITIDIALWKFETTNYYVTVIDAPGHRDFIKNMITGTS
QADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDS
TEPPYSESRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTN
MPWFKGWNIKRKNGTTKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQ
DVYKIGGIGTVPV
back to top
Aliases
The feature 'Elongation factor 1-alpha 1' has the following synonyms
Synonym
EF1a-like-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002087primitive gut
PLANA:0000211primitive ectoderm cell
PLANA:0000029primitive ectoderm
PLANA:0000023embryonic pharynx
PLANA:0000058embryonic digestive system
PLANA:0000085primitive gut cell
PLANA:0004517blastomere
Vocabulary: INTERPRO
TermDefinition
IPR000795TF_GTP-bd_dom
IPR027417P-loop_NTPase
IPR031157G_TR_CS
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0008144drug binding
GO:0000166nucleotide binding
GO:0003729mRNA binding
GO:0003746translation elongation factor activity
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0006414translational elongation
GO:0007568aging
GO:0010942positive regulation of cell death
GO:0010976positive regulation of neuron projection development
GO:0035690cellular response to drug
GO:0051260protein homooligomerization
GO:0071364cellular response to epidermal growth factor stimulus
GO:1903427negative regulation of reactive oxygen species biosynthetic process
GO:1990090cellular response to nerve growth factor stimulus
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3