nuclear protein localization protein 4 homolog

Overview
Namenuclear protein localization protein 4 homolog
Smed IDSMED30004289
Length (bp)2118
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nuclear protein localization protein 4 homolog (SMED30004289) t-SNE clustered cells

Violin plots show distribution of expression levels for nuclear protein localization protein 4 homolog (SMED30004289) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nuclear protein localization protein 4 homolog (SMED30004289) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nuclear protein localization protein 4 homolog (SMED30004289) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004289

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30004289SMESG000025775.1 dd_Smed_v4_5277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30004289SMESG000025775.1 dd_Smed_v4_5277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30004289SMESG000025775.1 dd_Smed_v4_5277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30004289SMESG000025775.1 dd_Smed_v4_5277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Human
Match: NPLOC4 (NPL4 homolog, ubiquitin recognition factor [Source:HGNC Symbol;Acc:HGNC:18261])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 298/643 (46.35%), Postives = 408/643 (63.45%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDVEPILSNS-KHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +IIR+ SP G KRIT   R++     +K   EF   N  + +Y   +    I ++S K L  + +KHGD+++L    S +  +S ME         F++     V E++ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HL+PP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ HLPWP GICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG Q  G ++G YT+    PLGI+A V+AIYEPPQ  T+ S+ELL   +           + + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++++ECITA   QNK PN+C LSP+G+FGSKFVT V TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++  FPK+  ++ +   ++ + FPI NR+ +GE Q   S   Y+ Q      +D +S+ HLL +L +N    L++ I  L    R           + + + A+    ++K+S +W   +Q         PG   Y  V        G  + A   +W+C HCT+ N+     C+MC LP+
Sbjct:    5 IIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFL-FPSSLAGPSSEMETS---VPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKA----------EVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSSEECITAGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFS---ISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVR-----------TRNEELAQ----TWKRSEQWATIEQLCSTVGGQLPGLHEYGAV-------GGSTHTATAAMWACQHCTFMNQPGTGHCEMCSLPR 607          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Human
Match: NPLOC4 (NPL4 homolog, ubiquitin recognition factor [Source:HGNC Symbol;Acc:HGNC:18261])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 276/547 (50.46%), Postives = 370/547 (67.64%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDVEPILSNS-KHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFR 1718
            +IIR+ SP G KRIT   R++     +K   EF   N  + +Y   +    I ++S K L  + +KHGD+++L    S +  +S ME         F++     V E++ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HL+PP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ HLPWP GICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG Q  G ++G YT+    PLGI+A V+AIYEPPQ  T+ S+ELL   +           + + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++++ECITA   QNK PN+C LSP+G+FGSKFVT V TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++  FPK+  ++ +   ++ + FPI NR+ +GE Q   S   Y+ Q      +D +S+ HLL +L +N    L++ I  L    R
Sbjct:    5 IIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFL-FPSSLAGPSSEMETS---VPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKA----------EVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSSEECITAGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFS---ISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVR 533          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Human
Match: NPLOC4 (NPL4 homolog, ubiquitin recognition factor [Source:HGNC Symbol;Acc:HGNC:18261])

HSP 1 Score: 71.2478 bits (173), Expect = 1.320e-13
Identity = 36/104 (34.62%), Postives = 60/104 (57.69%), Query Frame = 3
Query: 1410 GNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFR 1718
            GN +T+L RPLPVE+L++ ++  FPK+  ++ +   ++ + FPI NR+ +GE Q   S   Y+ Q      +D +S+ HLL +L +N    L++ I  L    R
Sbjct:    1 GNEITQLARPLPVEYLIIDITTTFPKDPVYTFS---ISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVR 101          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Human
Match: NPLOC4 (NPL4 homolog, ubiquitin recognition factor [Source:HGNC Symbol;Acc:HGNC:18261])

HSP 1 Score: 61.2326 bits (147), Expect = 1.630e-11
Identity = 26/41 (63.41%), Postives = 33/41 (80.49%), Query Frame = 3
Query:  393 VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLE 515
            V E++ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLE
Sbjct:    5 VVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLE 45          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Human
Match: NPLOC4 (NPL4 homolog, ubiquitin recognition factor [Source:HGNC Symbol;Acc:HGNC:18261])

HSP 1 Score: 61.6178 bits (148), Expect = 1.105e-10
Identity = 43/128 (33.59%), Postives = 68/128 (53.12%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDVEPILSNS-KHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQ 464
            +IIR+ SP G KRIT   R++     +K   EF   N  + +Y   +    I ++S K L  + +KHGD+++L    S +  +S ME         F++     V E++ID+ L+K DG+IYR R+ Q
Sbjct:    4 VIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFL-FPSSLAGPSSEMETS---VPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRDPQ 127          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Celegans
Match: npl-4.2 (Nuclear protein localization protein 4 homolog 2 [Source:UniProtKB/Swiss-Prot;Acc:Q95QZ9])

HSP 1 Score: 405.986 bits (1042), Expect = 3.677e-134
Identity = 223/544 (40.99%), Postives = 323/544 (59.38%), Query Frame = 3
Query:  405 DIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTL----ENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRES--TGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSM---THRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLR-EQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDV-TSPSDQ--CKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLP 1994
            D+D  L+  DG+I R +    CRH    KC +C+P++P+DEEYL+  D  I+ MSFHA++RKL G Q  GK TTL    EN  C +KP C  H P+P+GICTKC+P  VTL+ QK+RHVDNI  EN  L++ FLDYWR +G QR+G + G Y    + PLGIKA V+AIYEPPQ      +E L    E  NQ+ +   D+++E+   LGL+ VGWIFTD  + +   G+V HY    D++F++A+ECITAA LQN+ PN+   S + ++GSKFVTVV +GDE+  ++F GYQVSNQC A+V  +IL PT   PEL Y+RE+  +   Y+ DV    K++YG  V K GRPLPVE+LLV + A  PKE  ++    T  +   ++F + NR+++G++Q   +  +Y  +F+  Q ++  +N H L YL +N+  Q+  E +K LC   +              ++     ++  ++  +W Q M   + +    +  SD+   P+        +  +   +WSC HCT+ NE     C MCGLP
Sbjct:   13 DVDVFLSTQDGQIQRPKGPN-CRHPVRQKCTNCLPVDPFDEEYLKEKD--IKHMSFHAHVRKLLGSQ--GKGTTLKKPLENFRCSLKPNCDAHKPFPKGICTKCKPQVVTLNRQKFRHVDNIQIENQELVNQFLDYWRLSGHQRVGFLIGQYQPHLEVPLGIKATVAAIYEPPQHCREDGIEFL----EDKNQKTI---DNLLEM---LGLQRVGWIFTDCWTANSAEGTV-HYTRHKDSFFLSAEECITAAMLQNQHPNITEYSMDRHYGSKFVTVVASGDESMHVNFHGYQVSNQCAAMVEADILCPTLYTPELAYVRETPLSEEHYITDVQFSMKNEYGAEVMKNGRPLPVEYLLVDVPAGMPKEPHYTFHVGTSNKSKSAKFNVENRQAIGQLQGGANLIQYSSEFSTNQFLEQATNFHFLLYLVTNDQVQISDEWMKRLCDAVK--------------AQDRGTAMEWAQECEDWHQLMALAHANGGSGNDVSDIPVIPNGDPFSGSSSGGSRGAVWSCGHCTFQNEAGRQDCSMCGLP 526          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Celegans
Match: npl-4.1 (Nuclear protein localization protein 4 homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:H2KYU6])

HSP 1 Score: 405.216 bits (1040), Expect = 9.577e-134
Identity = 222/544 (40.81%), Postives = 325/544 (59.74%), Query Frame = 3
Query:  405 DIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTL----ENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRES--TGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSM---THRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLR-EQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDV-TSPSDQ--CKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLP 1994
            D+D  L+  DG+I R +    CRH    KC +C+P++P+DEEYL+  D  I+ MSFHA++RKL G Q  GK TTL    EN  C +KP C  H P+P+GICTKC+P  VTL+ QK+RHVDNI  EN  L++ FLDYWR +G QR+G + G Y    + PLGIKA V+AIYEPPQ      +E L    E  NQ+ +   D+++E+   LGL+ VGWIFTD  + +   G+V HY    D++F++A+ECITAA LQN+ PN+   S + ++GSKFVTVV +GDE+  ++F GYQVSNQC A+V  +IL PT   PEL Y+RE+  +   Y+ DV    K++YG  V K GRPLPVE+LLV + A  PKE  ++    T  +   ++F + NR+++G++Q   +  +Y  +F++ Q ++  +N H L YL +N+  Q+  E +K LC   +              ++     ++  ++  +W Q M   + +    +  SD+   P+        +  +   +W+C HCT+ NE +   C MCGLP
Sbjct:   13 DVDVFLSTQDGQIQRPKGPN-CRHPVRQKCTNCLPVDPFDEEYLKEKD--IKHMSFHAHVRKLLGSQ--GKGTTLKKPLENFRCSLKPNCDAHKPFPKGICTKCKPQVVTLNRQKFRHVDNIQIENQELVNQFLDYWRLSGHQRVGFLIGQYQPHLEVPLGIKATVAAIYEPPQHCREDGIEFL----EDKNQKTI---DNLLEM---LGLQRVGWIFTDCWTANSAEGTV-HYTRHKDSFFLSAEECITAAMLQNQHPNITEYSMDRHYGSKFVTVVASGDESMHVNFHGYQVSNQCAAMVEADILCPTLYTPELAYVRETPLSEEHYITDVQFSMKNEYGAEVMKNGRPLPVEYLLVDVPAGMPKEPHYTFHVGTSNKSKSAKFNVENRQAIGQLQGGANLIQYSSEFSKNQFLEQATNFHFLLYLVTNDQVQISDEWMKRLCDAVK--------------AQDRGTAMEWAQECEDWHQLMALAHANGGSGNDVSDIPVIPNGDPFSGSSSGGSGGAVWNCGHCTFQNEAARQDCSMCGLP 526          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Celegans
Match: npl-4.2 (Nuclear protein localization protein 4 homolog 2 [Source:UniProtKB/Swiss-Prot;Acc:Q95QZ9])

HSP 1 Score: 404.831 bits (1039), Expect = 9.591e-134
Identity = 224/544 (41.18%), Postives = 323/544 (59.38%), Query Frame = 3
Query:  405 DIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTL----ENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRES--TGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSM---THRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLR-EQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDV-TSPSDQ--CKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLP 1994
            D+D  L+  DG+I R +    CRH    KC +C+P++P+DEEYL+  D  I+ MSFHA++RKL G Q  GK TTL    EN  C +KP C  H P+P+GICTKC+P  VTL+ QK+RHVDNI  EN  L++ FLDYWR +G QR+G + G Y    + PLGIKA V+AIYEPPQ      +E L    E  NQ+ +   D+++E+   LGL+ VGWIFTD  + +   G+V HY    D++F++A+ECITAA LQN+ PN+   S + ++GSKFVTVV +GDE+  ++F GYQVSNQC A+V  +IL PT   PEL Y+RE+  +   Y+ DV    K++YG  V K GRPLPVE+LLV + A  PKE  ++    T  +   ++F + NR+++G++Q   +  +Y  +F+  Q ++  +N H L YL +N+  Q+  E +K LC   +              ++     ++  ++  +W Q M   + +  G S   D+   P+        +  +   +WSC HCT+ NE     C MCGLP
Sbjct:   13 DVDVFLSTQDGQIQRPKGPN-CRHPVRQKCTNCLPVDPFDEEYLKEKD--IKHMSFHAHVRKLLGSQ--GKGTTLKKPLENFRCSLKPNCDAHKPFPKGICTKCKPQVVTLNRQKFRHVDNIQIENQELVNQFLDYWRLSGHQRVGFLIGQYQPHLEVPLGIKATVAAIYEPPQHCREDGIEFL----EDKNQKTI---DNLLEM---LGLQRVGWIFTDCWTANSAEGTV-HYTRHKDSFFLSAEECITAAMLQNQHPNITEYSMDRHYGSKFVTVVASGDESMHVNFHGYQVSNQCAAMVEADILCPTLYTPELAYVRETPLSEEHYITDVQFSMKNEYGAEVMKNGRPLPVEYLLVDVPAGMPKEPHYTFHVGTSNKSKSAKFNVENRQAIGQLQGGANLIQYSSEFSTNQFLEQATNFHFLLYLVTNDQVQISDEWMKRLCDAVK--------------AQDRGTAMEWAQECEDWHQLMALAHAN--GGSGNDDIPVIPNGDPFSGSSSGGSRGAVWSCGHCTFQNEAGRQDCSMCGLP 524          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Celegans
Match: npl-4.1 (Nuclear protein localization protein 4 homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:H2KYU6])

HSP 1 Score: 403.675 bits (1036), Expect = 2.967e-133
Identity = 223/544 (40.99%), Postives = 325/544 (59.74%), Query Frame = 3
Query:  405 DIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTL----ENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRES--TGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSM---THRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLR-EQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDV-TSPSDQ--CKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLP 1994
            D+D  L+  DG+I R +    CRH    KC +C+P++P+DEEYL+  D  I+ MSFHA++RKL G Q  GK TTL    EN  C +KP C  H P+P+GICTKC+P  VTL+ QK+RHVDNI  EN  L++ FLDYWR +G QR+G + G Y    + PLGIKA V+AIYEPPQ      +E L    E  NQ+ +   D+++E+   LGL+ VGWIFTD  + +   G+V HY    D++F++A+ECITAA LQN+ PN+   S + ++GSKFVTVV +GDE+  ++F GYQVSNQC A+V  +IL PT   PEL Y+RE+  +   Y+ DV    K++YG  V K GRPLPVE+LLV + A  PKE  ++    T  +   ++F + NR+++G++Q   +  +Y  +F++ Q ++  +N H L YL +N+  Q+  E +K LC   +              ++     ++  ++  +W Q M   + +  G S   D+   P+        +  +   +W+C HCT+ NE +   C MCGLP
Sbjct:   13 DVDVFLSTQDGQIQRPKGPN-CRHPVRQKCTNCLPVDPFDEEYLKEKD--IKHMSFHAHVRKLLGSQ--GKGTTLKKPLENFRCSLKPNCDAHKPFPKGICTKCKPQVVTLNRQKFRHVDNIQIENQELVNQFLDYWRLSGHQRVGFLIGQYQPHLEVPLGIKATVAAIYEPPQHCREDGIEFL----EDKNQKTI---DNLLEM---LGLQRVGWIFTDCWTANSAEGTV-HYTRHKDSFFLSAEECITAAMLQNQHPNITEYSMDRHYGSKFVTVVASGDESMHVNFHGYQVSNQCAAMVEADILCPTLYTPELAYVRETPLSEEHYITDVQFSMKNEYGAEVMKNGRPLPVEYLLVDVPAGMPKEPHYTFHVGTSNKSKSAKFNVENRQAIGQLQGGANLIQYSSEFSKNQFLEQATNFHFLLYLVTNDQVQISDEWMKRLCDAVK--------------AQDRGTAMEWAQECEDWHQLMALAHAN--GGSGNDDIPVIPNGDPFSGSSSGGSGGAVWNCGHCTFQNEAARQDCSMCGLP 524          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Fly
Match: Npl4 (gene:FBgn0039348 transcript:FBtr0300730)

HSP 1 Score: 513.842 bits (1322), Expect = 1.209e-174
Identity = 271/646 (41.95%), Postives = 396/646 (61.30%), Query Frame = 3
Query:   87 KMIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDNYLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLK-LDKSKSQTNSYMELDGDIKKSNFELCSNKI-----VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAEND--IWSCVHCTYHNEISEASCQMCGLPQ 1997
            K++IR+ S  G KRI I  + ++ +LY+  +   K+D + L++  + +  + ++   L    L+HGD++YLK +  + S+  S   LD    K++     N       V E+D+D+ L+K DG I R+R+ + C H ++G+C+HC  LEPYDE YL+  +  I+ +SFH+Y+RK + G  QGK+   ++INC+IKPGC+EH PWP+GIC+KCQP+A+TL+ Q YRHVDN+MFEN  +++ FL+YWR TG QR+G ++G Y +    PLGI+A V+AIYEPPQ+STR S+ +         Q   F +D +  VA  LGL+ +GWIFTDL++ D   G+VK  RG I+++F+TAQECITA  LQN+ PN C  +  G FGSKFVT+ VTGD+   +H EGY VS QCMALVRD  L+PT DAPELGY+REST  QYVPDVF K+KD YGN V +L RPLPVE+LLV + A+ P +  ++ T        FPI NR   G +Q   + + Y+  + E + ++A+S+ HLL YLY  +   LR+ +  L    R            N ++ A+  +    K  E    ++ ++    GT+ Y    + +      +   + D   W+C HCT+ N     SC++C LP+
Sbjct:    5 KILIRVQSAEGIKRIEISPKSNLKHLYDSVQNALKVDGFGLFKERNFLTELQASGSQLVGTSLRHGDMVYLKQMAGTSSRRTSTTVLDSQAFKTSTISNPNSARPSFNVIEDDVDQALSKADGTIKRERDSKLCHHNANGRCVHCSALEPYDESYLKEHN--IKHLSFHSYIRKQTSGMDQGKYFVFDDINCRIKPGCREHPPWPKGICSKCQPSAITLNRQTYRHVDNVMFENTKIVERFLNYWRTTGHQRMGYLYGTYEQHTDVPLGIRAKVAAIYEPPQESTRDSINI---------QPDEFADD-VDAVASALGLKKIGWIFTDLITDDASIGTVKQIRG-IESHFITAQECITAGELQNRHPNPCKYASNGVFGSKFVTICVTGDKTKQVHMEGYAVSAQCMALVRDNCLIPTKDAPELGYVRESTDKQYVPDVFYKEKDLYGNEVQRLARPLPVEYLLVDVPASTPLQPIYTFTEYDKR-QPFPIENRYIDGHLQDFNALSCYLSAWGEEEFLEAISDFHLLVYLYKMDMLPLRQHMGPLLEAVR----------TKNPNQAAQFKVVDVWKLLE--SLIQASSGGSGGTTSYPSGGASASAGASGSEAMDLDANTWTCNHCTFINRGELTSCEICSLPR 624          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Fly
Match: Npl4 (gene:FBgn0039348 transcript:FBtr0084892)

HSP 1 Score: 513.842 bits (1322), Expect = 1.209e-174
Identity = 271/646 (41.95%), Postives = 396/646 (61.30%), Query Frame = 3
Query:   87 KMIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDNYLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLK-LDKSKSQTNSYMELDGDIKKSNFELCSNKI-----VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAEND--IWSCVHCTYHNEISEASCQMCGLPQ 1997
            K++IR+ S  G KRI I  + ++ +LY+  +   K+D + L++  + +  + ++   L    L+HGD++YLK +  + S+  S   LD    K++     N       V E+D+D+ L+K DG I R+R+ + C H ++G+C+HC  LEPYDE YL+  +  I+ +SFH+Y+RK + G  QGK+   ++INC+IKPGC+EH PWP+GIC+KCQP+A+TL+ Q YRHVDN+MFEN  +++ FL+YWR TG QR+G ++G Y +    PLGI+A V+AIYEPPQ+STR S+ +         Q   F +D +  VA  LGL+ +GWIFTDL++ D   G+VK  RG I+++F+TAQECITA  LQN+ PN C  +  G FGSKFVT+ VTGD+   +H EGY VS QCMALVRD  L+PT DAPELGY+REST  QYVPDVF K+KD YGN V +L RPLPVE+LLV + A+ P +  ++ T        FPI NR   G +Q   + + Y+  + E + ++A+S+ HLL YLY  +   LR+ +  L    R            N ++ A+  +    K  E    ++ ++    GT+ Y    + +      +   + D   W+C HCT+ N     SC++C LP+
Sbjct:    5 KILIRVQSAEGIKRIEISPKSNLKHLYDSVQNALKVDGFGLFKERNFLTELQASGSQLVGTSLRHGDMVYLKQMAGTSSRRTSTTVLDSQAFKTSTISNPNSARPSFNVIEDDVDQALSKADGTIKRERDSKLCHHNANGRCVHCSALEPYDESYLKEHN--IKHLSFHSYIRKQTSGMDQGKYFVFDDINCRIKPGCREHPPWPKGICSKCQPSAITLNRQTYRHVDNVMFENTKIVERFLNYWRTTGHQRMGYLYGTYEQHTDVPLGIRAKVAAIYEPPQESTRDSINI---------QPDEFADD-VDAVASALGLKKIGWIFTDLITDDASIGTVKQIRG-IESHFITAQECITAGELQNRHPNPCKYASNGVFGSKFVTICVTGDKTKQVHMEGYAVSAQCMALVRDNCLIPTKDAPELGYVRESTDKQYVPDVFYKEKDLYGNEVQRLARPLPVEYLLVDVPASTPLQPIYTFTEYDKR-QPFPIENRYIDGHLQDFNALSCYLSAWGEEEFLEAISDFHLLVYLYKMDMLPLRQHMGPLLEAVR----------TKNPNQAAQFKVVDVWKLLE--SLIQASSGGSGGTTSYPSGGASASAGASGSEAMDLDANTWTCNHCTFINRGELTSCEICSLPR 624          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Fly
Match: Npl4 (gene:FBgn0039348 transcript:FBtr0084893)

HSP 1 Score: 511.531 bits (1316), Expect = 2.655e-173
Identity = 269/647 (41.58%), Postives = 396/647 (61.21%), Query Frame = 3
Query:   84 RKMIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDNYLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLK-LDKSKSQTNSYMELDGDIKKSNFELCSNKI-----VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAEND--IWSCVHCTYHNEISEASCQMCGLPQ 1997
            ++ +IR+ S  G KRI I  + ++ +LY+  +   K+D + L++  + +  + ++   L    L+HGD++YLK +  + S+  S   LD    K++     N       V E+D+D+ L+K DG I R+R+ + C H ++G+C+HC  LEPYDE YL+  +  I+ +SFH+Y+RK + G  QGK+   ++INC+IKPGC+EH PWP+GIC+KCQP+A+TL+ Q YRHVDN+MFEN  +++ FL+YWR TG QR+G ++G Y +    PLGI+A V+AIYEPPQ+STR S+   N+  ++         D +  VA  LGL+ +GWIFTDL++ D   G+VK  RG I+++F+TAQECITA  LQN+ PN C  +  G FGSKFVT+ VTGD+   +H EGY VS QCMALVRD  L+PT DAPELGY+REST  QYVPDVF K+KD YGN V +L RPLPVE+LLV + A+ P +  ++ T        FPI NR   G +Q   + + Y+  + E + ++A+S+ HLL YLY  +   LR+ +  L    R            N ++ A+  +    K  E    ++ ++    GT+ Y    + +      +   + D   W+C HCT+ N     SC++C LP+
Sbjct:   32 KQSLIRVQSAEGIKRIEISPKSNLKHLYDSVQNALKVDGFGLFKERNFLTELQASGSQLVGTSLRHGDMVYLKQMAGTSSRRTSTTVLDSQAFKTSTISNPNSARPSFNVIEDDVDQALSKADGTIKRERDSKLCHHNANGRCVHCSALEPYDESYLKEHN--IKHLSFHSYIRKQTSGMDQGKYFVFDDINCRIKPGCREHPPWPKGICSKCQPSAITLNRQTYRHVDNVMFENTKIVERFLNYWRTTGHQRMGYLYGTYEQHTDVPLGIRAKVAAIYEPPQESTRDSI---NIQPDE-------FADDVDAVASALGLKKIGWIFTDLITDDASIGTVKQIRG-IESHFITAQECITAGELQNRHPNPCKYASNGVFGSKFVTICVTGDKTKQVHMEGYAVSAQCMALVRDNCLIPTKDAPELGYVRESTDKQYVPDVFYKEKDLYGNEVQRLARPLPVEYLLVDVPASTPLQPIYTFTEYDKR-QPFPIENRYIDGHLQDFNALSCYLSAWGEEEFLEAISDFHLLVYLYKMDMLPLRQHMGPLLEAVR----------TKNPNQAAQFKVVDVWKLLE--SLIQASSGGSGGTTSYPSGGASASAGASGSEAMDLDANTWTCNHCTFINRGELTSCEICSLPR 652          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Zebrafish
Match: nploc4 (NPL4 homolog, ubiquitin recognition factor [Source:ZFIN;Acc:ZDB-GENE-030131-5658])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 297/656 (45.27%), Postives = 416/656 (63.41%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKI--DNYLLYRTVSDVEPILSNSKHLANIGLKHGDVIYL----------KLDKSKSQTNSYMELDGDIKKSNFELCSNKI---VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQ-FNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +I+RI SP G K+I+    ++     +K   EF    + + +Y   +    ILS +K L+ + +KHGD+++L           +D ++  T+S          S+  L  +     + E+DID+ L+K +G+IYR R+ Q CRHG+ GKC+HCVPLEP+DE+YL HLDPP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ H PWPEGICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG QR+G ++G YT+    PLGI+A V+AIYEPPQ +T+ S+EL+   +           D++ E+A  LGLR VGWIFTDL+S+D + G+V++ R   D+YF++A+ECITA + QN+  N+C LSP+G+FGSKFVTVV TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K KDK+GN +T L RPLPVE+L++ ++  FPK+  F+ +    +  RFPI NR+++GE Q   S   Y+ Q  +    +D +S+ HLL +L +N    L++ I  L    + S     Q               ++KKS +W   +Q          G+  Y+    P  Q       + + +WSC+HCT+ N+     C+MC LP+
Sbjct:    5 IIVRIQSPDGMKKISSTKHETAAAFLKKVAKEFGFSSNGFSVYLNRNKTGEILSQNKALSLLKIKHGDMLFLYPSSAGPSSENMDTAQPHTSSSFPSFPSSSSSSSSLSRSHSAPQIPEDDIDQYLSKQEGKIYRNRDPQLCRHGAMGKCVHCVPLEPFDEDYLNHLDPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKTGNQRMGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIATQNSLELIEDPKA----------DAVEEIAAKLGLRKVGWIFTDLLSEDTRIGTVRYTRNK-DSYFLSAEECITAGHFQNQQANMCRLSPDGHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPELGYAKESSTEQYVPDVFYKDKDKFGNDITHLARPLPVEYLIIDITTTFPKDPVFTFS----STFRFPIENRDALGETQDFHSLATYLSQCTSSTSFLDIVSDFHLLLFLVTNEVMPLQDSIGLLLDAVKTSNEELAQ---------------TWKKSEQWATIEQLCSTVGGQSSGSLDYAMGGPPLPQ-------SSSAVWSCLHCTFMNQPGTEHCEMCSLPR 623          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Xenopus
Match: hlx (H2.0 like homeobox [Source:Xenbase;Acc:XB-GENE-483226])

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 300/649 (46.22%), Postives = 410/649 (63.17%), Query Frame = 3
Query:   87 KMIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN-----YLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKS---QTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            K  IRI SP G KRI    R+S     +K   EF   N     Y+      ++    + S H   I  KHGD+++L    S      ++  M+    +  S     S ++V++E ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HLDPP++ MSFHA +RKL+GG  +GKF  LENI+CKIK GC+ H PWPEGICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG QRIG ++G YT+    PLG++A V+AIYEPPQ  T+ S++LL+  + K           + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++A+ECIT+ + QNK PN+C LSP+G+FGSKFVTVV TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++A FPK+  ++ +    + + F I NR+++GE Q   S   Y+ Q      ++ +S+ HLL +L +N+   L+E I  L    R           + + + A+    ++KKS +W   +Q        P     Y  +        G ++ A + +WSCVHCT+ N+     C+MC LP+
Sbjct:    4 KKTIRIQSPDGVKRINASKRESAATFLKKVAKEFGFRNNGFSVYVNRNRTGEISATQNKSLHFLKI--KHGDMLFLFPSSSAGLAGPSSDVMDTSATVSGSR----SPQVVEDE-IDQYLSKQDGKIYRNRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLDPPVKHMSFHANIRKLTGGADKGKFVALENISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKTGNQRIGYLYGRYTEHKDIPLGLRAEVAAIYEPPQIGTQNSLQLLDDPKAK----------VVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSAEECITSGFFQNKHPNLCRLSPDGHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITATFPKDPVYTFS---TSSNLFSIENRDALGETQDFHSLATYLSQNLSSVFLEIISDFHLLLFLVTNDVMPLQESIGLLLDAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGHQPSELHDYGAI-------GGASHAASSSMWSCVHCTFMNQAGTDHCEMCRLPR 609          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Xenopus
Match: hlx (H2.0 like homeobox [Source:Xenbase;Acc:XB-GENE-483226])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 299/648 (46.14%), Postives = 410/648 (63.27%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN-----YLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKS---QTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            + IRI SP G KRI    R+S     +K   EF   N     Y+      ++    + S H   I  KHGD+++L    S      ++  M+    +  S     S ++V++E ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HLDPP++ MSFHA +RKL+GG  +GKF  LENI+CKIK GC+ H PWPEGICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG QRIG ++G YT+    PLG++A V+AIYEPPQ  T+ S++LL+  + K           + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++A+ECIT+ + QNK PN+C LSP+G+FGSKFVTVV TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++A FPK+  ++ +    + + F I NR+++GE Q   S   Y+ Q      ++ +S+ HLL +L +N+   L+E I  L    R           + + + A+    ++KKS +W   +Q        P     Y  +        G ++ A + +WSCVHCT+ N+     C+MC LP+
Sbjct:    5 ITIRIQSPDGVKRINASKRESAATFLKKVAKEFGFRNNGFSVYVNRNRTGEISATQNKSLHFLKI--KHGDMLFLFPSSSAGLAGPSSDVMDTSATVSGSR----SPQVVEDE-IDQYLSKQDGKIYRNRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLDPPVKHMSFHANIRKLTGGADKGKFVALENISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKTGNQRIGYLYGRYTEHKDIPLGLRAEVAAIYEPPQIGTQNSLQLLDDPKAK----------VVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSAEECITSGFFQNKHPNLCRLSPDGHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITATFPKDPVYTFS---TSSNLFSIENRDALGETQDFHSLATYLSQNLSSVFLEIISDFHLLLFLVTNDVMPLQESIGLLLDAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGHQPSELHDYGAI-------GGASHAASSSMWSCVHCTFMNQAGTDHCEMCRLPR 609          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Xenopus
Match: hlx (H2.0 like homeobox [Source:Xenbase;Acc:XB-GENE-483226])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 299/648 (46.14%), Postives = 410/648 (63.27%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN-----YLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKS---QTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            + IRI SP G KRI    R+S     +K   EF   N     Y+      ++    + S H   I  KHGD+++L    S      ++  M+    +  S     S ++V++E ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HLDPP++ MSFHA +RKL+GG  +GKF  LENI+CKIK GC+ H PWPEGICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG QRIG ++G YT+    PLG++A V+AIYEPPQ  T+ S++LL+  + K           + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++A+ECIT+ + QNK PN+C LSP+G+FGSKFVTVV TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++A FPK+  ++ +    + + F I NR+++GE Q   S   Y+ Q      ++ +S+ HLL +L +N+   L+E I  L    R           + + + A+    ++KKS +W   +Q        P     Y  +        G ++ A + +WSCVHCT+ N+     C+MC LP+
Sbjct:    5 ITIRIQSPDGVKRINASKRESAATFLKKVAKEFGFRNNGFSVYVNRNRTGEISATQNKSLHFLKI--KHGDMLFLFPSSSAGLAGPSSDVMDTSATVSGSR----SPQVVEDE-IDQYLSKQDGKIYRNRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLDPPVKHMSFHANIRKLTGGADKGKFVALENISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKTGNQRIGYLYGRYTEHKDIPLGLRAEVAAIYEPPQIGTQNSLQLLDDPKAK----------VVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSAEECITSGFFQNKHPNLCRLSPDGHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITATFPKDPVYTFS---TSSNLFSIENRDALGETQDFHSLATYLSQNLSSVFLEIISDFHLLLFLVTNDVMPLQESIGLLLDAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGHQPSELHDYGAI-------GGASHAASSSMWSCVHCTFMNQAGTDHCEMCRLPR 609          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Xenopus
Match: hlx (H2.0 like homeobox [Source:Xenbase;Acc:XB-GENE-483226])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 299/646 (46.28%), Postives = 409/646 (63.31%), Query Frame = 3
Query:   96 IRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN-----YLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKS---QTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            IRI SP G KRI    R+S     +K   EF   N     Y+      ++    + S H   I  KHGD+++L    S      ++  M+    +  S     S ++V++E ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HLDPP++ MSFHA +RKL+GG  +GKF  LENI+CKIK GC+ H PWPEGICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG QRIG ++G YT+    PLG++A V+AIYEPPQ  T+ S++LL+  + K           + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++A+ECIT+ + QNK PN+C LSP+G+FGSKFVTVV TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++A FPK+  ++ +    + + F I NR+++GE Q   S   Y+ Q      ++ +S+ HLL +L +N+   L+E I  L    R           + + + A+    ++KKS +W   +Q        P     Y  +        G ++ A + +WSCVHCT+ N+     C+MC LP+
Sbjct:    9 IRIQSPDGVKRINASKRESAATFLKKVAKEFGFRNNGFSVYVNRNRTGEISATQNKSLHFLKI--KHGDMLFLFPSSSAGLAGPSSDVMDTSATVSGSR----SPQVVEDE-IDQYLSKQDGKIYRNRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLDPPVKHMSFHANIRKLTGGADKGKFVALENISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKTGNQRIGYLYGRYTEHKDIPLGLRAEVAAIYEPPQIGTQNSLQLLDDPKAK----------VVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSAEECITSGFFQNKHPNLCRLSPDGHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITATFPKDPVYTFS---TSSNLFSIENRDALGETQDFHSLATYLSQNLSSVFLEIISDFHLLLFLVTNDVMPLQESIGLLLDAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGHQPSELHDYGAI-------GGASHAASSSMWSCVHCTFMNQAGTDHCEMCRLPR 611          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Xenopus
Match: hlx (H2.0 like homeobox [Source:Xenbase;Acc:XB-GENE-483226])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 297/646 (45.98%), Postives = 408/646 (63.16%), Query Frame = 3
Query:   96 IRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN-----YLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKS---QTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            I+I   YG KRI    R+S     +K   EF   N     Y+      ++    + S H   I  KHGD+++L    S      ++  M+    +  S     S ++V++E ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HLDPP++ MSFHA +RKL+GG  +GKF  LENI+CKIK GC+ H PWPEGICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG QRIG ++G YT+    PLG++A V+AIYEPPQ  T+ S++LL+  + K           + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++A+ECIT+ + QNK PN+C LSP+G+FGSKFVTVV TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++A FPK+  ++ +    + + F I NR+++GE Q   S   Y+ Q      ++ +S+ HLL +L +N+   L+E I  L    R           + + + A+    ++KKS +W   +Q        P     Y  +        G ++ A + +WSCVHCT+ N+     C+MC LP+
Sbjct:    5 IQINLFYGVKRINASKRESAATFLKKVAKEFGFRNNGFSVYVNRNRTGEISATQNKSLHFLKI--KHGDMLFLFPSSSAGLAGPSSDVMDTSATVSGSR----SPQVVEDE-IDQYLSKQDGKIYRNRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLDPPVKHMSFHANIRKLTGGADKGKFVALENISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKTGNQRIGYLYGRYTEHKDIPLGLRAEVAAIYEPPQIGTQNSLQLLDDPKAK----------VVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSAEECITSGFFQNKHPNLCRLSPDGHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITATFPKDPVYTFS---TSSNLFSIENRDALGETQDFHSLATYLSQNLSSVFLEIISDFHLLLFLVTNDVMPLQESIGLLLDAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGHQPSELHDYGAI-------GGASHAASSSMWSCVHCTFMNQAGTDHCEMCRLPR 607          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Mouse
Match: Nploc4 (NPL4 homolog, ubiquitin recognition factor [Source:MGI Symbol;Acc:MGI:2679787])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 299/643 (46.50%), Postives = 409/643 (63.61%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDV-EPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +IIR+ SP G KRIT   R++     +K   EF   N  + +Y   +   E   S+SK L  + +KHGD+++L    S +  +S ME    +    F   +   V E++ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HL+PP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ HLPWP GICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG Q  G ++G YT+    PLGI+A V+AIYEPPQ  T+ S+ELL   +           + + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++++ECITA   QNK PN+C LSP+G+FGSKFVT V TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++  FPK+  ++ +   ++ + FPI NR+ +GE Q   S   Y+ Q      +D +S+ HLL +L +N    L++ I  L    R           + + + A+    ++KKS +W   +Q      +  PG   +  V        G    A + +W+C HCT+ N+     C+MC LP+
Sbjct:    5 IIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIKHGDLLFL-FPSSLAGPSSEMETSTSVGLKAFGAPN---VVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKA----------EVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSSEECITAGDFQNKHPNICRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFS---ISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGVQLPGLHEFGAV-------GGSARAATSAMWACQHCTFMNQPGTGHCEMCSLPR 607          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Mouse
Match: Nploc4 (NPL4 homolog, ubiquitin recognition factor [Source:MGI Symbol;Acc:MGI:2679787])

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 289/645 (44.81%), Postives = 385/645 (59.69%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN-----YLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +IIR+ SP G KRIT   R++     +K   EF   N     Y+      ++    S S HL  I  KHGD+++L    S +  +S ME    +    F       V E++ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HL+PP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ HLPWP GICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG Q  G ++G YT+    PLGI+A V+AIYEPPQ  T+ S+ELL   +           + + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++++ECITA   QNK PN+C LSP+G+FGSKFVT V TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++         + F                           S   Y+ Q      +D +S+ HLL +L +N    L++ I  L    R           + + + A+    ++KKS +W   +Q      +  PG   +  V        G    A + +W+C HCT+ N+     C+MC LP+
Sbjct:    5 IIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKI--KHGDLLFL-FPSSLAGPSSEMETSTSVGLKAF---GAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKA----------EVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSSEECITAGDFQNKHPNICRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLII---------DDF--------------------------HSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGVQLPGLHEFGAV-------GGSARAATSAMWACQHCTFMNQPGTGHCEMCSLPR 575          
BLAST of nuclear protein localization protein 4 homolog vs. UniProt/SwissProt
Match: sp|Q9ES54|NPL4_RAT (Nuclear protein localization protein 4 homolog OS=Rattus norvegicus OX=10116 GN=Nploc4 PE=1 SV=3)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 299/643 (46.50%), Postives = 408/643 (63.45%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDV-EPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +IIR+ SP G KRIT   R++     +K   EF   N  + +Y   +   E   S+SK L  + +KHGD+++L    S +  +S ME    +    F       V E++ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HL+PP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ HLPWP GICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG Q  G ++G YT+    PLGI+A V+AIYEPPQ  T+ S+ELL   +           + + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++++ECITA   QNK PN+C LSP+G+FGSKFVT V TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++  FPK+  ++ +   ++ + FPI NR+ +GE Q   S   Y+ Q      +D +S+ HLL +L +N    L++ I  L    R           + + + A+    ++KKS +W   +Q      +  PG   +  V        G    A + +W+C HCT+ N+     C+MC LP+
Sbjct:    5 IIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIKHGDLLFL-FPSSLAGPSSEMETSTSVGLKAF---GAPHVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKA----------EVVDEIASKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSSEECITAGDFQNKHPNICRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFS---ISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGVQLPGLHEFGAV-------GGSARAATSAMWACQHCTFMNQPGTGHCEMCSLPR 607          
BLAST of nuclear protein localization protein 4 homolog vs. UniProt/SwissProt
Match: sp|P60670|NPL4_MOUSE (Nuclear protein localization protein 4 homolog OS=Mus musculus OX=10090 GN=Nploc4 PE=1 SV=3)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 299/643 (46.50%), Postives = 409/643 (63.61%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDV-EPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +IIR+ SP G KRIT   R++     +K   EF   N  + +Y   +   E   S+SK L  + +KHGD+++L    S +  +S ME    +    F   +   V E++ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HL+PP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ HLPWP GICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG Q  G ++G YT+    PLGI+A V+AIYEPPQ  T+ S+ELL   +           + + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++++ECITA   QNK PN+C LSP+G+FGSKFVT V TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++  FPK+  ++ +   ++ + FPI NR+ +GE Q   S   Y+ Q      +D +S+ HLL +L +N    L++ I  L    R           + + + A+    ++KKS +W   +Q      +  PG   +  V        G    A + +W+C HCT+ N+     C+MC LP+
Sbjct:    5 IIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIKHGDLLFL-FPSSLAGPSSEMETSTSVGLKAFGAPN---VVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKA----------EVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSSEECITAGDFQNKHPNICRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFS---ISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGVQLPGLHEFGAV-------GGSARAATSAMWACQHCTFMNQPGTGHCEMCSLPR 607          
BLAST of nuclear protein localization protein 4 homolog vs. UniProt/SwissProt
Match: sp|Q8TAT6|NPL4_HUMAN (Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 298/643 (46.35%), Postives = 408/643 (63.45%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDVEPILSNS-KHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +IIR+ SP G KRIT   R++     +K   EF   N  + +Y   +    I ++S K L  + +KHGD+++L    S +  +S ME         F++     V E++ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HL+PP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ HLPWP GICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG Q  G ++G YT+    PLGI+A V+AIYEPPQ  T+ S+ELL   +           + + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++++ECITA   QNK PN+C LSP+G+FGSKFVT V TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++  FPK+  ++ +   ++ + FPI NR+ +GE Q   S   Y+ Q      +D +S+ HLL +L +N    L++ I  L    R           + + + A+    ++K+S +W   +Q         PG   Y  V        G  + A   +W+C HCT+ N+     C+MC LP+
Sbjct:    5 IIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFL-FPSSLAGPSSEMETS---VPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKA----------EVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSSEECITAGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFS---ISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVR-----------TRNEELAQ----TWKRSEQWATIEQLCSTVGGQLPGLHEYGAV-------GGSTHTATAAMWACQHCTFMNQPGTGHCEMCSLPR 607          
BLAST of nuclear protein localization protein 4 homolog vs. UniProt/SwissProt
Match: sp|Q9VBP9|NPL4_DROME (Nuclear protein localization protein 4 homolog OS=Drosophila melanogaster OX=7227 GN=Npl4 PE=1 SV=3)

HSP 1 Score: 511.531 bits (1316), Expect = 2.662e-172
Identity = 269/647 (41.58%), Postives = 396/647 (61.21%), Query Frame = 3
Query:   84 RKMIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDNYLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLK-LDKSKSQTNSYMELDGDIKKSNFELCSNKI-----VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAEND--IWSCVHCTYHNEISEASCQMCGLPQ 1997
            ++ +IR+ S  G KRI I  + ++ +LY+  +   K+D + L++  + +  + ++   L    L+HGD++YLK +  + S+  S   LD    K++     N       V E+D+D+ L+K DG I R+R+ + C H ++G+C+HC  LEPYDE YL+  +  I+ +SFH+Y+RK + G  QGK+   ++INC+IKPGC+EH PWP+GIC+KCQP+A+TL+ Q YRHVDN+MFEN  +++ FL+YWR TG QR+G ++G Y +    PLGI+A V+AIYEPPQ+STR S+   N+  ++         D +  VA  LGL+ +GWIFTDL++ D   G+VK  RG I+++F+TAQECITA  LQN+ PN C  +  G FGSKFVT+ VTGD+   +H EGY VS QCMALVRD  L+PT DAPELGY+REST  QYVPDVF K+KD YGN V +L RPLPVE+LLV + A+ P +  ++ T        FPI NR   G +Q   + + Y+  + E + ++A+S+ HLL YLY  +   LR+ +  L    R            N ++ A+  +    K  E    ++ ++    GT+ Y    + +      +   + D   W+C HCT+ N     SC++C LP+
Sbjct:   32 KQSLIRVQSAEGIKRIEISPKSNLKHLYDSVQNALKVDGFGLFKERNFLTELQASGSQLVGTSLRHGDMVYLKQMAGTSSRRTSTTVLDSQAFKTSTISNPNSARPSFNVIEDDVDQALSKADGTIKRERDSKLCHHNANGRCVHCSALEPYDESYLKEHN--IKHLSFHSYIRKQTSGMDQGKYFVFDDINCRIKPGCREHPPWPKGICSKCQPSAITLNRQTYRHVDNVMFENTKIVERFLNYWRTTGHQRMGYLYGTYEQHTDVPLGIRAKVAAIYEPPQESTRDSI---NIQPDE-------FADDVDAVASALGLKKIGWIFTDLITDDASIGTVKQIRG-IESHFITAQECITAGELQNRHPNPCKYASNGVFGSKFVTICVTGDKTKQVHMEGYAVSAQCMALVRDNCLIPTKDAPELGYVRESTDKQYVPDVFYKEKDLYGNEVQRLARPLPVEYLLVDVPASTPLQPIYTFTEYDKR-QPFPIENRYIDGHLQDFNALSCYLSAWGEEEFLEAISDFHLLVYLYKMDMLPLRQHMGPLLEAVR----------TKNPNQAAQFKVVDVWKLLE--SLIQASSGGSGGTTSYPSGGASASAGASGSEAMDLDANTWTCNHCTFINRGELTSCEICSLPR 652          
BLAST of nuclear protein localization protein 4 homolog vs. UniProt/SwissProt
Match: sp|Q95QZ9|NPL42_CAEEL (Nuclear protein localization protein 4 homolog 2 OS=Caenorhabditis elegans OX=6239 GN=npl-4.2 PE=1 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 4.677e-133
Identity = 223/544 (40.99%), Postives = 323/544 (59.38%), Query Frame = 3
Query:  405 DIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTL----ENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRES--TGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSM---THRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLR-EQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDV-TSPSDQ--CKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLP 1994
            D+D  L+  DG+I R +    CRH    KC +C+P++P+DEEYL+  D  I+ MSFHA++RKL G Q  GK TTL    EN  C +KP C  H P+P+GICTKC+P  VTL+ QK+RHVDNI  EN  L++ FLDYWR +G QR+G + G Y    + PLGIKA V+AIYEPPQ      +E L    E  NQ+ +   D+++E+   LGL+ VGWIFTD  + +   G+V HY    D++F++A+ECITAA LQN+ PN+   S + ++GSKFVTVV +GDE+  ++F GYQVSNQC A+V  +IL PT   PEL Y+RE+  +   Y+ DV    K++YG  V K GRPLPVE+LLV + A  PKE  ++    T  +   ++F + NR+++G++Q   +  +Y  +F+  Q ++  +N H L YL +N+  Q+  E +K LC   +              ++     ++  ++  +W Q M   + +    +  SD+   P+        +  +   +WSC HCT+ NE     C MCGLP
Sbjct:   13 DVDVFLSTQDGQIQRPKGPN-CRHPVRQKCTNCLPVDPFDEEYLKEKD--IKHMSFHAHVRKLLGSQ--GKGTTLKKPLENFRCSLKPNCDAHKPFPKGICTKCKPQVVTLNRQKFRHVDNIQIENQELVNQFLDYWRLSGHQRVGFLIGQYQPHLEVPLGIKATVAAIYEPPQHCREDGIEFL----EDKNQKTI---DNLLEM---LGLQRVGWIFTDCWTANSAEGTV-HYTRHKDSFFLSAEECITAAMLQNQHPNITEYSMDRHYGSKFVTVVASGDESMHVNFHGYQVSNQCAAMVEADILCPTLYTPELAYVRETPLSEEHYITDVQFSMKNEYGAEVMKNGRPLPVEYLLVDVPAGMPKEPHYTFHVGTSNKSKSAKFNVENRQAIGQLQGGANLIQYSSEFSTNQFLEQATNFHFLLYLVTNDQVQISDEWMKRLCDAVK--------------AQDRGTAMEWAQECEDWHQLMALAHANGGSGNDVSDIPVIPNGDPFSGSSSGGSRGAVWSCGHCTFQNEAGRQDCSMCGLP 526          
BLAST of nuclear protein localization protein 4 homolog vs. TrEMBL
Match: A0A4S2MEZ2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000522 PE=4 SV=1)

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 328/694 (47.26%), Postives = 433/694 (62.39%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN---YLLYRTVSDVEPILSNSK-HLANIGLKHGDVIYLKLDKSKSQT--NSYMELDGDI----KKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQA---PLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKD-PKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNIS---RFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLL-WYLYSNNSQLREQIKS------LCALFRP--SIASKYQQSVSNHSKTAKVNIDSFKK-STEW---QQFMRNTNMDPPGT-----------------------SFYSDVTSPSDQCKGVNN-----KAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            MI+R+ SP GTK+  + D D++  L +   +EFK+ +   + L  +  D   I       L ++G++HGD+++L +DKS+S    +S    D +      KS+    + ++V E+ ID+ LAKMDG+I R+RNEQ C H  SGKCIHCVPLEP+D  YLEHLDPP++FMSFHAYLRKLSGGQ  GK+ TLEN++CK++ GC+ H PWPEGICTKCQPN VTL IQ YRHVD + FEN  LM+ FLDYWR+TG QRIGI+ G Y  FD A   PL IKAVV+AIYEP Q+ST +SV+L       +      L D + EV   LGL+P+GWIFTDLV++D P  G+VKHYRGT+DT+F++A+EC+TAA LQN +PN C  S +G FGSKFVTVVVTGD +N IHFE YQVSNQ MALVRD IL+PTYDAPE GYIRE+T +Q+VP+VF    DKYGN VT++ RPLPVE+LLV M AAFP E  ++M     ++    RFP+ NRE++G++Q    F K +K+F+   L   L+N HLL W+  ++   LR Q  S      L  L     S+ +    S +     A+  +  +   S  W   Q+  +  + DP  +                       S  SD    +      NN         D W+C HCT+HN +  + C+MCGLP+
Sbjct:    1 MIVRVQSPVGTKKFDVLDSDNLEKLLQCVASEFKLTDKGAWFLSTSRDDTGRIKGTRNIKLKSLGIRHGDMLFL-IDKSRSAAPGDSVTPTDDNSLNNGSKSSARPGNREMVVEDKIDQELAKMDGQIRRKRNEQLCHHPESGKCIHCVPLEPFDAAYLEHLDPPVKFMSFHAYLRKLSGGQGMGKYVTLENLSCKVRSGCQGHPPWPEGICTKCQPNPVTLEIQPYRHVDYVQFENGQLMETFLDYWRQTGEQRIGILLGRYAHFDTAGSPPLAIKAVVAAIYEPLQESTTRSVKL-------TAPLDALLPDHVAEVTKRLGLQPIGWIFTDLVAEDQPGKGAVKHYRGTMDTFFLSAEECVTAACLQNLYPNKCRYSSDGCFGSKFVTVVVTGDASNDIHFEAYQVSNQAMALVRDNILVPTYDAPEFGYIRETTKDQFVPEVFYTLTDKYGNRVTRVARPLPVEYLLVDMPAAFPIEPVYTMAKIPADLPMDCRFPVENREALGQIQNFSGFAKLLKRFSNRPLYSLLANFHLLTWFAGNDVFPLRLQSASDTDPHGLSGLLDAISSVNNLSGLSTAERQTLAEAAVAKWASDSPAWNTVQELAKAFSGDPSSSPHPKPKSDTLFRPSGTRGTTSAVSIGSDPMDTTTATTITNNPERRSSTNKDFWACAHCTFHNHLDVSECEMCGLPK 686          
BLAST of nuclear protein localization protein 4 homolog vs. TrEMBL
Match: A0A1S3JF30 (nuclear protein localization protein 4 homolog OS=Lingula unguis OX=7574 GN=LOC106172374 PE=4 SV=1)

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 311/659 (47.19%), Postives = 425/659 (64.49%), Query Frame = 3
Query:   84 RKMIIRIFSP-YGTKRITIDDRDSVMNLYEKTKAEFKID--NYLLYRTVSDVEPIL-SNSKHLANIGLKHGDVIYLKLD---KSKSQTNSYMELDGD-IKKSNFELCSNKI----VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGT-----SFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +++I+RI SP +GTKR+ +   + +++  EK   EF +   ++ +Y+     E +  S S+ L +  LKHGD++YL      + +     + E+    +  +N    S  +    V E+++D++L KMDG+IYR +NEQ C HGSSGKC+HCVPLEPYDE+YL+  DPPI+F+SFH+ +R++  G  +GKF TLEN++CKIKPGCKEH PWP GICTKCQP+AVTLS QK+RHVD IMFEN +L+D+F +YWR +G QRIG ++G Y      PLGI+A VSAIYEPPQ S R SVELL   +E          + +  +A  LGL+ VGWIFTDL++KD K G+VKHYRGT+DT+F++A+ECI AA  QNK PN C LSP+G+FGSKFVTVVVTGD +  IHFEGYQVS+QCMALVRD+  +PT DAPELG+I+ES+  QYVPDVF K KD+YGN V +L RPLPVE+LL+ M+AAFP E+Q++  +R   I  FPI NR  +GE+Q   +   YM QF     ++A+S+ HLL +L + +   L++ + SL    R        +++++H            K+ EW   +Q M   N+  P       SF      P    +G         W C HCT+ N+     C+MC LP+
Sbjct:    3 KQLILRIQSPEHGTKRLQVTTSEKIIDFVEKVCKEFGVSRADWSVYKGRDKTEELKGSRSRSLVSYNLKHGDMLYLFPTCGARVEGDHTPFPEVSSSPVPAANVPDDSRPVLGSDVVEDEVDQLLEKMDGKIYRSKNEQLCHHGSSGKCLHCVPLEPYDEQYLKQADPPIKFLSFHSNIRRMKSGVDKGKFATLENLSCKIKPGCKEHPPWPGGICTKCQPSAVTLSRQKFRHVDYIMFENHALVDNFFNYWRSSGNQRIGFLYGKYEHHKDIPLGIRATVSAIYEPPQVSGRDSVELLPDEKE----------ELVSNIAAQLGLQKVGWIFTDLIAKDLKTGTVKHYRGTVDTHFLSAEECIMAAEFQNKHPNPCKLSPDGHFGSKFVTVVVTGDASGQIHFEGYQVSDQCMALVRDDCFIPTKDAPELGFIKESSNKQYVPDVFYKDKDEYGNEVMQLARPLPVEYLLIDMAAAFPVEQQYTFFYRD-GIKPFPIENRAEVGEIQDFNALTSYMHQFTREDFLNAMSDFHLLIFLATCDMLPLKDHMNSLLEAVR-----NKDETLAHH----------LSKTEEWGTVEQLME-ANVPSPTPLPREGSFVGPNAEPLPPIRG---------WPCAHCTFFNQPGRGECEMCTLPR 625          
BLAST of nuclear protein localization protein 4 homolog vs. TrEMBL
Match: Q7SZT9 (Npl4 protein OS=Xenopus laevis OX=8355 GN=nploc4 PE=1 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 301/643 (46.81%), Postives = 414/643 (64.39%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDVEPI-LSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +IIRI SP G KRI    R++     +K   EF   N  + +Y   +    I  S +K L  + +KHGD+++L    S   +   M++   +  S   + S ++V +E ID+ L+K DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HLDPP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ H PWPEGICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG QRIG ++G YT+    PLG++A V+AIYEPPQ  T+ S++LL+  + K           + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++A+ECITA Y QNK+PN+C LSP+ +FGSKFVTVV TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++  FPK+  ++ +    + + FPI NR+ +GE Q   S   Y+ Q      ++ +S+ HLL +L +N+   L++ I  L    R           + + + A+    ++KKS +W   +Q      + P     Y  +        G ++ A + +WSCVHCT+ N+     C+MC LP 
Sbjct:    5 IIIRIQSPDGIKRINASKRETAATFLKKVAKEFGFRNNGFSVYVNRNRTGEISASQNKSLHFLKIKHGDMLFLFPSSSAGPSTEVMDISAAVPGSR-PISSPQVVDDE-IDQYLSKQDGKIYRNRDPQLCRHGPMGKCVHCVPLEPFDEDYLNHLDPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKTGNQRIGYLYGRYTEHKDIPLGLRAEVAAIYEPPQIGTQNSLQLLDDPKAK----------VVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNK-DTYFLSAEECITAGYFQNKYPNLCRLSPDAHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFS---TSSNLFPIENRDVLGETQDFHSLATYLSQNLSSVFLEIISDFHLLLFLVTNDVMSLQDSISLLLDAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGLQPSELHDYGAI-------GGASHAASSSMWSCVHCTFMNQAGTDHCEMCRLPH 609          
BLAST of nuclear protein localization protein 4 homolog vs. TrEMBL
Match: A0A0B7ASG5 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF134256 PE=4 SV=1)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 293/646 (45.36%), Postives = 421/646 (65.17%), Query Frame = 3
Query:   90 MIIRIFSP-YGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDVEPI-LSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFE---LCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQF--MRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            ++IRI SP +GTKR+  +  +++    E+ + EF + +  + LY+  +    +  S SK L++  +KHGD++Y+   +    + +    D   + SN E         + E+++D++L + DG++YR+RNEQ CRHG  GKC+HCVPLEPYD+E+L   DPPI+F+SFH+Y+RKL+GG  +GKF  LEN++CKIK GCKEH PWP GICTKCQPNAVTL+ Q+YRHVDNIMFEN ++ D FL++WR +GCQRIGI++G Y  F   PLGI+A V+AIYEPPQ++T   ++L    +E            ++  A+ +GL PVGWIFTDLV+ D   G+VK++RG ID++F++A+ECI AA  QN+FPN C LSP+G+FGSKFVTVVVTGD +N IHFEGYQVSNQCMALVRD+ LLPT D P+LGYI+ES+  QYVPDVF K KD YGN VT + RPLPVE+LLV + AAF  +  ++     + +  FP+ NR+ +G+ Q   +   Y++++   + ++A+S+ HLL +L S+    L+++I  +             ++V NH +   +    FKK+ EW     M + +   P        +   DQ  G+       +W+C HCT+ N+ +  +C MC LP+
Sbjct:    4 IVIRIQSPEHGTKRVETNTSENMTAFLERVQKEFGLGDTGWELYQDRNKKAFLRASRSKKLSDHNVKHGDMLYMDFSRKGKHSTTASTSDTQ-QSSNTETSLATGGPDIHEDEVDRLLKEEDGKMYRKRNEQLCRHGPQGKCLHCVPLEPYDKEFLNTCDPPIKFLSFHSYIRKLTGGVDRGKFVNLENLSCKIKSGCKEHPPWPGGICTKCQPNAVTLNRQEYRHVDNIMFENPAVADRFLNFWRFSGCQRIGILYGRYEMFKDVPLGIRARVAAIYEPPQETTVNKIKLKPDPKEA----------IVMAAAEKMGLHPVGWIFTDLVADDLSKGTVKNFRGNIDSHFLSAEECIMAADFQNRFPNSCRLSPDGHFGSKFVTVVVTGDNDNQIHFEGYQVSNQCMALVRDDCLLPTKDVPQLGYIKESSNEQYVPDVFYKDKDNYGNEVTHIARPLPVEYLLVTIPAAFASDFHYTFK-SNIQMESFPVENRDHVGQTQDFAALTTYLERYAPNKFLEAMSDFHLLMFLASSEMLPLKDKIDIVF------------EAVKNHDEKKAM---EFKKTEEWATVEEMMSAHESSPALQSAPRSSEDEDQPGGL-------MWTCAHCTFINQSTHVACDMCSLPR 615          
BLAST of nuclear protein localization protein 4 homolog vs. TrEMBL
Match: I3L829 (NPL4 homolog, ubiquitin recognition factor OS=Sus scrofa OX=9823 GN=NPLOC4 PE=1 SV=3)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 301/644 (46.74%), Postives = 411/644 (63.82%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLY--RTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +IIR+ SP G KRIT   R++     +K   EF   N  + +Y  R  +   P  SN K L  + +KHGD+++L    S +  ++ ME    +     + C    V E+DID+ L++ DG+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HL+PP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ HLPWP GICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG Q  G ++G YT+    PLGI+A V+AIYEPPQ  T+ S+ELL   +           + + E+A  LGLR VGWIFTDLVS+D + G+V++ R   DTYF++++ECITA   QNK PNVC LSP+G+FGSKFVT V TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K  DK+GN +T+L RPLPVE+L++ ++  FPK+  ++ +   ++ + FPI NR+ +GE Q   S   Y+ Q      +D +S+ HLL +L +N+   L++ I  L    R           + + + A+    ++KKS +W   +Q      +  PG   Y  V  P+       + A   +W+C HCT+ N+     C+MC LP+
Sbjct:  162 IIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEIPASSN-KSLNLLKIKHGDLLFL-FPSSLAGPSAEMETSAPLA---LKACGAPNVVEDDIDQFLSRQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKA----------EVVDEIAAKLGLRKVGWIFTDLVSEDARKGTVRYSRNK-DTYFLSSEECITAGDFQNKHPNVCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFS---ISQNPFPIENRDVLGETQDFHSLATYLSQSTSSVFLDTVSDFHLLLFLVTNDVMPLQDSISLLLEAVR-----------TRNEELAQ----TWKKSEQWATIEQLCSTVGVQLPGLQEYGAVGGPT-------HAASAAMWACQHCTFMNQPGTGHCEMCSLPR 764          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Cavefish
Match: nploc4 (NPL4 homolog, ubiquitin recognition factor [Source:ZFIN;Acc:ZDB-GENE-030131-5658])

HSP 1 Score: 532.717 bits (1371), Expect = 0.000e+0
Identity = 287/656 (43.75%), Postives = 402/656 (61.28%), Query Frame = 3
Query:   84 RKMIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKI---------VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQ--FNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAEND-IWSCVHCTYHNEISEASCQMCGLPQ 1997
            R +IIR+ SP G K+I+   R++     +K   EF  ++  + +Y   +    I+S +K L+ + +KHGD++YL    S   ++  M+       S+    S+           + E++ID+ L+K +G+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HLDPP++ MSFHAY+RKL+GG  +GKF  LENI+CKIK GC+ HLPWPEGICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG QR+G ++G YT+    PLGI+A VSAIYEPPQ  T+ S+EL+       + R   + +   +    LGLR VGWIFTDL+S+D + G+VK+ R   D+YF++A+ECIT+ + QN  PN C LSP+G+FGSK+VTVV TG  +           NQCMALVRDE LLP  DA ELGY +ES+  QYVPDVF K KDK+GN +T L RPLPVE+L++ ++  FPK+  F+ +    +  RFPI NR+++GE Q   S   Y+ Q   +    ++ +S+ HLL +L +N    LR+ I  L    + S     Q               ++KKS +W   +Q          G+  Y+          G +  A +  +WSC+HCT+ N+     C+MC LP+
Sbjct:    3 RSVIIRVQSPEGMKKISSTKRETAAAFLKKVAKEFGFNSNGFSVYLNRNKTGEIISQNKTLSLLKIKHGDMLYL-FPSSAGPSSETMDTQPHSSSSSSSSSSSSSLSRSHSSPQIPEDEIDQYLSKQEGKIYRNRDPQLCRHGPMGKCVHCVPLEPFDEDYLNHLDPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKTGNQRMGYLYGRYTEHKDIPLGIRAEVSAIYEPPQIGTQNSLELIE------DPRAAAVEEVAAK----LGLRKVGWIFTDLLSEDTRIGTVKYSRNK-DSYFLSAEECITSGHFQNHHPNPCRLSPDGHFGSKYVTVVATGGPD-----------NQCMALVRDECLLPCRDASELGYAKESSSEQYVPDVFYKDKDKFGNDITYLARPLPVEYLIIDITTTFPKDPVFTFS----STLRFPIENRDALGETQDFHSLATYLSQCPSSSSSFLNIVSDFHLLIFLVTNEVMPLRDSIGLLLDAVKTSNEELAQ---------------TWKKSEQWATIEQLCSTVGGQQAGSLDYA--------MGGASVPASSSAMWSCLHCTFMNQPGTEHCEMCSLPR 608          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Sea Lamprey
Match: nploc4 (NPL4 homolog, ubiquitin recognition factor [Source:ZFIN;Acc:ZDB-GENE-030131-5658])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 290/668 (43.41%), Postives = 412/668 (61.68%), Query Frame = 3
Query:   93 IIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKI-DNYLLYRTVSDVEPILS--NSKHLANIGLKHGDVIYLKLDKSKSQTNS-YMELDGDI-----------------------KKSNF--ELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            IIR+ SP GT+R+ +  R++  +  +K  +EF   +N  +  T  D    ++  + + L  + +KHGD++YL  D +   T++  M+    +                       K+  F     S + + EE+ID+ L+K +G+IYR R+ Q CRHG  GKC+HCVPLEP+DE+YL HLDPP++ M FHAY+RKL+GG  +GKF  LENI+CKIK GC+ H PWP+GICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FL+ WR TG QR+G+++G Y +    PL I+A V+AIYEPPQK +  S+ELL       + R     D + E+A  LGLR VGWIFTDL+ +D + G+VK+ R   D++FM+A+ECI A   QN  PN C LSP+G+FGSKFVTVV TG  +N +HFEGYQV+NQCMALVRD+ LLPT DA ELG+++ES+  QYVPDVF K  DK+GN +T+L RPLP+E+L++ +   FP+E Q++ +      ++FPI NRE  GE Q   S   Y+ Q     L++ L+N HLL +L +N+   LR+ +  L    + +      +++++H          F +S  W    Q  +N  + P G  F S          G +  +   +W+C HCTY+N    A C++C LP+
Sbjct:    1 IIRVQSPDGTRRVPVTRRETAADFLKKVSSEFGFSENGFVICTNRDKSGEINGKSRQSLNALNIKHGDMVYLFPDSAMPSTSAEAMDTGAAVGSVRGSVSLLAQAGPSTSTTLVAKRQGFPNAQASTQGIVEEEIDQYLSKQEGKIYRNRDTQLCRHGPMGKCVHCVPLEPFDEDYLNHLDPPVKHMPFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHPPWPDGICTKCQPSAITLNRQKYRHVDNIMFENHTIADCFLNCWRNTGQQRVGLLYGRYVEHKDIPLAIRAEVAAIYEPPQKGSENSLELL------PDPRA----DVVDEIAGKLGLRKVGWIFTDLLPEDTRKGTVKYIRHK-DSHFMSAEECIMAGEFQNANPNPCRLSPDGHFGSKFVTVVATGGPDNQVHFEGYQVTNQCMALVRDDCLLPTRDAAELGFVKESSSEQYVPDVFYKDIDKFGNEITQLARPLPLEYLIIDIPTTFPREPQYTFS---TITTQFPIENREITGETQDFSSLADYLAQPGSKSLLETLANFHLLIFLATNDVMPLRDHMDLLLDAVKMN-----DETLAHH----------FSESEHWATLDQLCKNVIVQPRGGEFES-----MGAAGGFSQSSSAAVWACKHCTYNNPPGTAQCEVCSLPR 634          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Yeast
Match: NPL4 (Substrate-recruiting cofactor of the Cdc48p-Npl4p-Ufd1p segregase; assists Cdc48p in the dislocation of misfolded, polyubiquitinated ERAD substrates that are subsequently delivered to the proteasome for degradation; also involved in the regulated destruction of resident ER membrane proteins, such as HMG-CoA reductase (Hmg1/2p) and cytoplasmic proteins (Fbp1p); role in mobilizing membrane bound transcription factors by regulated ubiquitin/proteasome-dependent processing (RUP) [Source:SGD;Acc:S000000374])

HSP 1 Score: 293.123 bits (749), Expect = 7.872e-91
Identity = 184/550 (33.45%), Postives = 298/550 (54.18%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFK----IDNYLLYRTVSDVEPILSN--SKHLANIGLKHGDVIYLKL-DKSKSQTNSYMELDGDIKKSNFELCSNKI----VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGK-----FTTLENINCKIKPGCKE-HLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRP-LPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYM------KQFNELQLVDALSNLHLLWYLYS 1667
            M+IR  S  GT R++  + D    + EK          +D + +          +S    + + ++GLKHGD++ L   DK  ++ +      G +   +  +  ++     ++E  +D+ L K DG I RQ++ + C+HG  G C +C PL P+D+EY  H    I+ +SFH+YL+KL+   ++ +      + L   + +I   C   H PWP GIC+KCQP+A+TL  Q++R VD++ F+ + ++++F+  WR TG QR G M+G Y+K+D  PLGIKAVV AIYEPPQ   +     L +  E+     L ++    E    +GL  +G IFTDL       GSV   R   D++F+++ E I AA  Q + PNV   S +G+F SKFVT V++G+    I    YQVS +  ALV  +++  +   P + YI ++T  +YVP++F  + ++YG +V +  +P  PV++LLV ++  FP  +      + ++ + FP  NR++MG+ Q  +   KY+        FN L   + +SN HLL Y+ S
Sbjct:    1 MLIRFRSKNGTHRVSCQENDLFGTVIEKLVGNLDPNADVDTFTVCEKPGQGIHAVSELADRTVMDLGLKHGDMLILNYSDKPANEKDGVNVEIGSVGIDSKGIRQHRYGPLRIKELAVDEELEKEDGLIPRQKS-KLCKHGDRGMCEYCSPLPPWDKEY--HEKNKIKHISFHSYLKKLNENANKKENGSSYISPLSEPDFRINKRCHNGHEPWPRGICSKCQPSAITLQQQEFRMVDHVEFQKSEIINEFIQAWRYTGMQRFGYMYGSYSKYDNTPLGIKAVVEAIYEPPQHDEQDG---LTMDVEQVKNEMLQIDRQAQE----MGLSRIGLIFTDLSDAGAGDGSVFCKRHK-DSFFLSSLEVIMAARHQTRHPNVSKYSEQGFFSSKFVTCVISGNLEGEIDISSYQVSTEAEALVTADMISGS-TFPSMAYINDTTDERYVPEIFYMKSNEYGITVKENAKPAFPVDYLLVTLTHGFPNTDT-ETNSKFVSSTGFPWSNRQAMGQSQDYQELKKYLFNVASSGDFNLLH--EKISNFHLLLYINS 535          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Nematostella
Match: EDO29888 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2C7])

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 288/648 (44.44%), Postives = 399/648 (61.57%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKID--NYLLYRTVSDVEPILSNS-KHLANIGLKHGDVIYL-KLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELL---NLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVT-GDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +IIR+ S  GT R+     +++     K   +  I    + +Y   S    I S+S K +A++ LKHGD++YL K     S   S + L  D K  N        V+E++ID +L+K DG I+R+R+   C HG + KC+HCVPLEPYDE +L+  DPPI+ MS HAY +K S G  +GKFT L++I+CKIK GC EH PWP GICTKCQP A+TL  Q YRHVDNI+FEN S++  FLDYWR+TG QR+G ++G Y +    PLGI+AVV+AIYEPPQ+ T  S+ELL   NL             D++ ++A  LGLR VGWIF+DLV  D K G+VKH R  I+T+F+TA+ECI A   QN++ + C  +  G FGSKFVTVVV+ G++ N I F+G+QVSNQCMALVRD+ L+PT D P LGYIRES+  QYVPDVF K  D YGN VT L RP+P+E+LLV +SAAFP +  ++ +    N + FPI NRE++GE+Q  ++  +++ Q+     + A+SN HLL +L +N+   L+  ++ LCA            ++ N    A    D ++K  +W   +Q +     D P    ++         + +   +    W+C HCT+ N  +  SC+MCGLPQ
Sbjct:    4 LIIRVQSCEGTIRVKTSSGETLSTFLSKVAEQLSIPKRGWSVYTDRSKSTRIESSSRKTVASVPLKHGDMVYLFKTGAGVSNVTSEVSLQ-DTKPEN-------QVEEDEIDVLLSKQDGLIHRKRDPHMCHHGDNSKCVHCVPLEPYDETFLKEHDPPIKHMSLHAYFKKWSHGIDKGKFTMLKDISCKIKEGCAEHPPWPGGICTKCQPTAITLKRQDYRHVDNILFENPSIVQPFLDYWRRTGNQRLGFLYGRYEEHKDVPLGIRAVVAAIYEPPQEGTPDSLELLPNPNL-------------DTVNKLAADLGLRIVGWIFSDLVPDDVKKGTVKHLR-DINTHFLTAEECIMAGDFQNQYVSPCRYASSGKFGSKFVTVVVSEGNDENQIGFDGFQVSNQCMALVRDDCLVPTLDDPGLGYIRESSSEQYVPDVFYKDTDSYGNEVTLLARPMPIEYLLVQVSAAFPVQPVYTFSPPPSNGAVFPIENRENIGELQDFDAVRRHLSQYPPGNFLSAMSNFHLLVFLATNDMLPLKTHMEELCA------------AIKNKDAEA---CDGWRKGEQWGTVEQIIAAHGKDAPSPGPFTHGPIGDVDMEDMTQASRVSSWTCKHCTFINH-AMGSCEMCGLPQ 613          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Nematostella
Match: EDO30963 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZA1])

HSP 1 Score: 516.153 bits (1328), Expect = 3.593e-177
Identity = 259/542 (47.79%), Postives = 353/542 (65.13%), Query Frame = 3
Query:  393 VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELL---NLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNS-QLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            V+E++ID +L+K DG I+R+R+   C HG + KC+HCVPLEPYDE YL+  DPPI+ MS HAY +K S G  +GKFT L++I+CKIK GC EH PWP GICTKCQP A+TL  Q YRHVDNI+FEN S++  FLDYWR+TG QR+G ++G Y +    PLGI+AVV+AIYEPPQ+ T  S+ELL   NL             D++ ++A  LGLR VGWIF+DLV  D K G+VKH R  I+T+F+TA+ECI A   QN++ + C  +  G FGSKFVTVVV+G++ N I F+G+QVSNQCMALVRD+ L+PT D P LGYIRES+  QYVPDVF K  D YGN VT L RP+P+E+LLV +SAAFP +  ++ +    N + FPI NRE++GE+Q  ++  +++ Q+     + A+SN HLL +L +N+   L+  ++ LCA            ++ N    A    D ++K  +W   +Q +     D P    ++         + +   +    W+C HCT+ N  +  SC+MCGLPQ
Sbjct:   29 VEEDEIDVLLSKQDGLIHRKRDPHMCHHGDNSKCVHCVPLEPYDETYLKEHDPPIKHMSLHAYFKKWSHGIDKGKFTMLKDISCKIKEGCAEHPPWPGGICTKCQPTAITLKRQDYRHVDNILFENPSIVQPFLDYWRRTGNQRLGFLYGRYEEHKDVPLGIRAVVAAIYEPPQEGTPDSLELLPNTNL-------------DTVNKLAADLGLRIVGWIFSDLVPDDVKKGTVKHLR-DINTHFLTAEECIMAGDFQNQYVSPCRYASSGKFGSKFVTVVVSGNDENQIGFDGFQVSNQCMALVRDDCLVPTLDDPGLGYIRESSSEQYVPDVFYKDTDSYGNEVTLLARPMPIEYLLVQVSAAFPVQPVYTFSPPPSNGAVFPIENRENIGELQDFDAVRRHLSQYPPGDFLSAMSNFHLLVFLATNDMLPLKTHMEELCA------------AIKNKDAEA---CDGWRKGEQWGTVEQIIAAHGKDAPSPGPFTHGPIGDVDMEDMTQASRVSSWTCKHCTFINH-AMGSCEMCGLPQ 540          
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Medaka
Match: nploc4 (NPL4 homolog, ubiquitin recognition factor [Source:NCBI gene;Acc:101163208])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 301/658 (45.74%), Postives = 412/658 (62.61%), Query Frame = 3
Query:   90 MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDN--YLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKI----------------VQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQ-LREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEW---QQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            +IIR+ SP G ++I    R++     +K   EF  ++  + +Y   +    ILS +K L+ + +KHGD+++L    S S   S  ++D  I  S+  L S                   VQE++ID+ LAK DG+IYR R+ Q CRHG+ GKC+HCVPLEP+DE+YL HLDPP++ MSFHA LRKL+GG  +GKF  LENI+CKIK GC+ H PWP+GICTKCQP+A+TL+ QKYRHVDNIMFEN ++ D FLD+WRKTG QR+G ++G YT+    PLGI+A V+AIYEPPQ + + S+ELL   +            ++ E+A  LGL  VGWIFTDL+S+D + G+V++ R   D+Y+++A+ECIT+ Y QN+ PN C LS +G+FGSKFVTVV TG  +N +HFEGYQVSNQCMALVRDE LLP  DAPELGY +ES+  QYVPDVF K KDK+GN VT L RPLPVE+L++ ++  FPK+ Q++ T    +  RFPI NR+ +GE Q   S   Y+ Q +    +D +S+ HLL +L +N    LR+ I  L    + S     Q               ++KKS +W   +Q        P  +  Y  +   S         + + +WSC+HCT+ N+     C+MC LP+
Sbjct:    5 IIIRVQSPDGMRKIPSTKRETAAAFLKKVAKEFGFNSNGFSVYLNRNKTGEILSQNKTLSLLKIKHGDMLFLFPSTSSS---SGEKMDTAIPHSSSSLPSLSSSSSSSSLIPRSSSAPQVQEDEIDQYLAKQDGKIYRNRDPQLCRHGALGKCVHCVPLEPFDEDYLNHLDPPVKHMSFHANLRKLTGGADKGKFAALENISCKIKSGCEGHPPWPDGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKTGSQRVGYLYGRYTEHKDIPLGIRAEVAAIYEPPQTANQNSLELLEDPKAA----------AVDEIAAKLGLCKVGWIFTDLLSEDTRIGTVRYLRNQ-DSYYLSAEECITSGYFQNQHPNPCRLSRDGFFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSPEQYVPDVFFKDKDKFGNDVTFLARPLPVEYLIIDITTTFPKDPQYTFT----STQRFPIENRDILGETQDFHSLATYLSQCSSTSFLDIVSDFHLLLFLVTNEVMPLRDSIGLLLDAVKTSNEDLAQ---------------TWKKSEQWATIEQLCSTVGGQPSSSLGYGAMGGASVPA------SSSAMWSCLHCTFMNQPGTEHCEMCSLPR 623          
BLAST of nuclear protein localization protein 4 homolog vs. Planmine SMEST
Match: SMESG000025775.1 (SMESG000025775.1)

HSP 1 Score: 1331.24 bits (3444), Expect = 0.000e+0
Identity = 634/635 (99.84%), Postives = 634/635 (99.84%), Query Frame = 3
Query:   93 IIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDNYLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 1997
            IIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDNYLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRG FLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ
Sbjct:    9 IIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDNYLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGSFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYLYSNNSQLREQIKSLCALFRPSIASKYQQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDVTSPSDQCKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ 643          
BLAST of nuclear protein localization protein 4 homolog vs. Planmine SMEST
Match: SMESG000054401.1 (SMESG000054401.1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 289/563 (51.33%), Postives = 392/563 (69.63%), Query Frame = 3
Query:   87 KMI-IRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDNYLLYRTVSDVEPILSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNKIVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLEHLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEGICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMFGYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLNDSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECITAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCMALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRPLPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFNKYMKQFNELQLVDALSNLHLLWYL-YSNNSQLREQIKSLCALFRPSIASKYQQSVSNHSKT 1769
            KMI IRI SP GT+RI ++++++V  LY     +  + N++L +       +  + K +    + HGD+I+L  +K      S  +L   I  S         + E+DIDK+++  DG+I+R+ N Q CRHG +GKCI+C+PLEPYDE+YLE+ DPPI+FMSFHAYLRK+   ++ GK+  L+N NC+I   C  HLPWP+GICTKCQP A+TL +QKYRHVDNIMFEN+ +M+DFLDYWRKTGCQRIGI+ GYYT +DQ+PLGIKAVVSAIYEP Q S   +  L+       +++   ++DS +E+   LGL+PVGW+FTDL  ++P+ GSVKHYRGT +T+F+TA+ECITAA+ QN FPN C LS EG FGSKFVT+VV+GD+ N I F+GYQ +NQCM LV+D IL+PT ++PEL Y+RES+  Q++PD+F  + DKY N++ K+GRPLPVEFLLV +S  F  EE F+  +  +N +RF I NRE   E Q+ ES   Y+K FNE QL   LSNLHLL YL  S++ Q +++I  LC L        ++QS ++ +K 
Sbjct:    4 KMITIRIVSPKGTQRIEVEEKNNVTVLYNLVAEKLNMKNFILCKDRKGKNKLKKSKKQIKTERINHGDMIFLIENKELEAEMSDCDLAVKIIGST--------IVEDDIDKVISTKDGKIFRKPN-QDCRHGLNGKCINCLPLEPYDEQYLENCDPPIKFMSFHAYLRKIQR-KNDGKYLRLKNTNCRIINKCNNHLPWPKGICTKCQPPALTLDMQKYRHVDNIMFENSVMMNDFLDYWRKTGCQRIGILIGYYTPYDQSPLGIKAVVSAIYEPKQVSALSTANLI------FDEKNSLISDSELEMFSNLGLKPVGWVFTDLQVENPENGSVKHYRGTSETFFLTAEECITAAHFQNMFPNPCKLSNEGEFGSKFVTLVVSGDKENKISFQGYQATNQCMGLVKDNILMPTINSPELAYVRESSNEQFIPDIFYTETDKYKNTIIKIGRPLPVEFLLVDLSVGFSVEENFTFRYCSINPNRFSIENREKANEKQSIESIIDYLKSFNEDQLEKGLSNLHLLIYLNNSDHFQRKDKIVELCKL-------NFKQSFTDENKV 543          
The following BLAST results are available for this feature:
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPLOC40.000e+046.35NPL4 homolog, ubiquitin recognition factor [Source... [more]
NPLOC40.000e+050.46NPL4 homolog, ubiquitin recognition factor [Source... [more]
NPLOC41.320e-1334.62NPL4 homolog, ubiquitin recognition factor [Source... [more]
NPLOC41.630e-1163.41NPL4 homolog, ubiquitin recognition factor [Source... [more]
NPLOC41.105e-1033.59NPL4 homolog, ubiquitin recognition factor [Source... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
npl-4.23.677e-13440.99Nuclear protein localization protein 4 homolog 2 ... [more]
npl-4.19.577e-13440.81Nuclear protein localization protein 4 homolog 1 ... [more]
npl-4.29.591e-13441.18Nuclear protein localization protein 4 homolog 2 ... [more]
npl-4.12.967e-13340.99Nuclear protein localization protein 4 homolog 1 ... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Npl41.209e-17441.95gene:FBgn0039348 transcript:FBtr0300730[more]
Npl41.209e-17441.95gene:FBgn0039348 transcript:FBtr0084892[more]
Npl42.655e-17341.58gene:FBgn0039348 transcript:FBtr0084893[more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nploc40.000e+045.27NPL4 homolog, ubiquitin recognition factor [Source... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hlx0.000e+046.22H2.0 like homeobox [Source:Xenbase;Acc:XB-GENE-483... [more]
hlx0.000e+046.14H2.0 like homeobox [Source:Xenbase;Acc:XB-GENE-483... [more]
hlx0.000e+046.14H2.0 like homeobox [Source:Xenbase;Acc:XB-GENE-483... [more]
hlx0.000e+046.28H2.0 like homeobox [Source:Xenbase;Acc:XB-GENE-483... [more]
hlx0.000e+045.98H2.0 like homeobox [Source:Xenbase;Acc:XB-GENE-483... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nploc40.000e+046.50NPL4 homolog, ubiquitin recognition factor [Source... [more]
Nploc40.000e+044.81NPL4 homolog, ubiquitin recognition factor [Source... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ES54|NPL4_RAT0.000e+046.50Nuclear protein localization protein 4 homolog OS=... [more]
sp|P60670|NPL4_MOUSE0.000e+046.50Nuclear protein localization protein 4 homolog OS=... [more]
sp|Q8TAT6|NPL4_HUMAN0.000e+046.35Nuclear protein localization protein 4 homolog OS=... [more]
sp|Q9VBP9|NPL4_DROME2.662e-17241.58Nuclear protein localization protein 4 homolog OS=... [more]
sp|Q95QZ9|NPL42_CAEEL4.677e-13340.99Nuclear protein localization protein 4 homolog 2 O... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MEZ20.000e+047.26Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S3JF300.000e+047.19nuclear protein localization protein 4 homolog OS=... [more]
Q7SZT90.000e+046.81Npl4 protein OS=Xenopus laevis OX=8355 GN=nploc4 P... [more]
A0A0B7ASG50.000e+045.36Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
I3L8290.000e+046.74NPL4 homolog, ubiquitin recognition factor OS=Sus ... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nploc40.000e+043.75NPL4 homolog, ubiquitin recognition factor [Source... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nploc40.000e+043.41NPL4 homolog, ubiquitin recognition factor [Source... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NPL47.872e-9133.45Substrate-recruiting cofactor of the Cdc48p-Npl4p-... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO298880.000e+044.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309633.593e-17747.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nploc40.000e+045.74NPL4 homolog, ubiquitin recognition factor [Source... [more]
back to top
BLAST of nuclear protein localization protein 4 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000025775.10.000e+099.84SMESG000025775.1[more]
SMESG000054401.10.000e+051.33SMESG000054401.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004289 ID=SMED30004289|Name=nuclear protein localization protein 4 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=2118bp
TCAATAGTATGAAGATATATTAAATAATTTTTAATTAATCATTTATTATT
GATATAGATTTTAATTTTGTAAATTTCTAAATTCGTAAAATGATTATTCG
AATATTTTCTCCTTATGGAACTAAACGAATAACTATTGACGACAGAGATT
CAGTAATGAACCTTTATGAAAAAACCAAGGCTGAATTCAAAATTGATAAT
TATCTACTATACCGAACCGTAAGTGACGTGGAACCAATTTTGAGCAATTC
AAAACACCTGGCAAATATTGGACTTAAACATGGGGATGTAATTTATTTGA
AGCTTGATAAATCTAAAAGCCAAACGAATTCCTACATGGAACTGGATGGG
GATATTAAGAAGAGCAATTTCGAATTATGCTCTAACAAAATTGTTCAAGA
AGAGGATATAGATAAGATCTTAGCGAAAATGGACGGCAGAATCTATCGTC
AACGAAACGAACAATATTGTCGTCACGGATCTTCTGGGAAATGTATTCAC
TGTGTTCCTTTAGAGCCGTACGACGAAGAGTATTTGGAGCATCTTGATCC
TCCTATTCAATTCATGTCTTTTCATGCTTATCTTCGAAAATTGAGTGGAG
GCCAACATCAAGGAAAATTCACGACTTTAGAAAATATCAACTGTAAAATT
AAACCCGGATGCAAGGAACATTTGCCGTGGCCAGAGGGTATTTGTACCAA
ATGTCAACCGAATGCAGTAACTCTCAGTATCCAAAAATATCGACATGTCG
ATAACATAATGTTTGAGAATGCGTCTCTTATGGATGACTTTTTGGATTAT
TGGAGAAAAACCGGATGCCAAAGAATCGGAATCATGTTTGGTTATTATAC
GAAATTCGACCAAGCTCCATTGGGCATTAAAGCAGTCGTTAGTGCAATTT
ATGAGCCTCCACAGAAATCTACAAGAAAAAGTGTCGAATTATTAAATCTA
AGTGAAGAGAAATCAAACCAACGCGGCTTGTTTCTTAATGACTCAATTGT
CGAGGTAGCAGATTGTCTCGGACTGCGACCGGTCGGGTGGATATTTACAG
ATCTGGTAAGCAAAGATCCGAAAGCAGGATCGGTGAAGCATTATCGAGGC
ACAATCGATACATATTTTATGACTGCTCAAGAATGCATTACTGCAGCATA
TTTGCAAAATAAATTCCCAAATGTATGTAATCTTAGTCCCGAGGGTTATT
TCGGCTCAAAATTTGTCACTGTTGTCGTCACTGGAGACGAAAACAACACA
ATCCATTTCGAGGGTTATCAGGTTTCGAATCAATGCATGGCCCTTGTCAG
GGATGAAATCCTGCTTCCCACCTATGATGCTCCAGAATTGGGTTACATTC
GAGAATCTACCGGAAATCAATATGTGCCAGATGTCTTTTGTAAGCAAAAG
GATAAATATGGCAATTCGGTTACAAAATTAGGCCGACCATTGCCAGTCGA
ATTCCTATTGGTTCACATGAGTGCCGCGTTTCCTAAAGAAGAACAATTTT
CCATGACTCATCGGCGGTTAAACATTTCACGATTTCCTATTGGAAACCGT
GAAAGCATGGGTGAAGTTCAAACCAACGAATCATTCAATAAATATATGAA
ACAGTTCAATGAGTTGCAATTGGTCGATGCATTATCCAATCTGCATTTAT
TATGGTATTTATACTCCAATAATTCTCAGCTGAGAGAGCAAATCAAAAGT
CTTTGTGCATTATTTCGTCCGTCAATTGCTAGTAAATATCAGCAGTCTGT
TAGCAATCACAGCAAGACTGCAAAGGTCAATATAGACTCGTTTAAAAAAT
CTACTGAATGGCAACAATTCATGAGAAATACCAATATGGACCCACCGGGA
ACGTCTTTTTATTCCGATGTAACTAGTCCATCAGATCAATGCAAAGGCGT
GAACAACAAAGCAGAGAATGATATCTGGAGCTGTGTGCACTGTACTTACC
ACAATGAAATATCAGAAGCTTCTTGTCAAATGTGTGGTCTGCCTCAATAG
AAATATAAATCTCATTGGAAAAGGTTTATTCGTATAGTTTGATTGAATTC
TGTTGGATTTTAATTCAAAATAAATTTGCAAGATAAAATATTTTGTTTAC
TTTTTCCATTTTAAAGAT
back to top

protein sequence of SMED30004289-orf-1

>SMED30004289-orf-1 ID=SMED30004289-orf-1|Name=SMED30004289-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=637bp
MIIRIFSPYGTKRITIDDRDSVMNLYEKTKAEFKIDNYLLYRTVSDVEPI
LSNSKHLANIGLKHGDVIYLKLDKSKSQTNSYMELDGDIKKSNFELCSNK
IVQEEDIDKILAKMDGRIYRQRNEQYCRHGSSGKCIHCVPLEPYDEEYLE
HLDPPIQFMSFHAYLRKLSGGQHQGKFTTLENINCKIKPGCKEHLPWPEG
ICTKCQPNAVTLSIQKYRHVDNIMFENASLMDDFLDYWRKTGCQRIGIMF
GYYTKFDQAPLGIKAVVSAIYEPPQKSTRKSVELLNLSEEKSNQRGLFLN
DSIVEVADCLGLRPVGWIFTDLVSKDPKAGSVKHYRGTIDTYFMTAQECI
TAAYLQNKFPNVCNLSPEGYFGSKFVTVVVTGDENNTIHFEGYQVSNQCM
ALVRDEILLPTYDAPELGYIRESTGNQYVPDVFCKQKDKYGNSVTKLGRP
LPVEFLLVHMSAAFPKEEQFSMTHRRLNISRFPIGNRESMGEVQTNESFN
KYMKQFNELQLVDALSNLHLLWYLYSNNSQLREQIKSLCALFRPSIASKY
QQSVSNHSKTAKVNIDSFKKSTEWQQFMRNTNMDPPGTSFYSDVTSPSDQ
CKGVNNKAENDIWSCVHCTYHNEISEASCQMCGLPQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR037518MPN
IPR036443Znf_RanBP2_sf
IPR001876Znf_RanBP2
IPR016563Npl4
IPR007716NPL4_Zn-bd_put
IPR024682Npl4_Ub-like_dom
IPR007717NPL4_C
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0031625ubiquitin protein ligase binding
GO:0032403protein complex binding
GO:0043130ubiquitin binding
GO:0046872metal ion binding
GO:0051117ATPase binding
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0007030Golgi organization
GO:0030970retrograde protein transport, ER to cytosol
GO:0032480negative regulation of type I interferon production
GO:0039536negative regulation of RIG-I signaling pathway
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005829cytosol
GO:0034098VCP-NPL4-UFD1 AAA ATPase complex
GO:0036501UFD1-NPL4 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001876Zinc finger, RanBP2-typeSMARTSM00547zf_4coord: 611..635
e-value: 0.003
score: 26.8
IPR001876Zinc finger, RanBP2-typePROSITEPS01358ZF_RANBP2_1coord: 613..632
IPR001876Zinc finger, RanBP2-typePROSITEPS50199ZF_RANBP2_2coord: 609..636
score: 8.05
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 1..71
e-value: 8.1E-15
score: 57.1
NoneNo IPR availablePANTHERPTHR12710NUCLEAR PROTEIN LOCALIZATION 4coord: 1..560
NoneNo IPR availableCDDcd17055Ubl_AtNPL4_likecoord: 1..70
e-value: 4.65707E-11
score: 56.8395
IPR024682Nuclear pore localisation protein Npl4, ubiquitin-like domainPFAMPF11543UN_NPL4coord: 1..71
e-value: 2.3E-15
score: 56.8
IPR016563Nuclear protein localization protein 4PIRSFPIRSF010052Polyub_prc_Npl4coord: 1..567
e-value: 3.7E-169
score: 561.8
IPR007716NPL4, zinc-binding putativePFAMPF05020zf-NPL4coord: 102..242
e-value: 1.2E-58
score: 197.4
IPR007717Nuclear pore localisation protein NPL4, C-terminalPFAMPF05021NPL4coord: 245..555
e-value: 3.8E-97
score: 325.4
IPR007717Nuclear pore localisation protein NPL4, C-terminalCDDcd08061MPN_NPL4coord: 211..524
e-value: 5.77269E-113
score: 337.794
IPR037518MPN domainPROSITEPS50249MPNcoord: 223..371
score: 14.807
IPR036443Zinc finger, RanBP2-type superfamilySUPERFAMILYSSF90209Ran binding protein zinc finger-likecoord: 609..635
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 1..76