Innexin

Overview
NameInnexin
Smed IDSMED30004284
Length (bp)1721
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30004284) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30004284) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30004284) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30004284) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004284

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004284SMESG000048827.1 SmedASXL_015360SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30004284SMESG000048827.1 dd_Smed_v4_13392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004284SMESG000048827.1 dd_Smed_v4_13392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30004284SMESG000048827.1 dd_Smed_v6_13392_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 286.96 bits (733), Expect = 1.444e-91
Identity = 138/377 (36.60%), Postives = 227/377 (60.21%), Query Frame = 1
Query:  328 HLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKV-DRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSC-SFYSIYNLPKLISVTEDT--LDTEA-SKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWN 1443
            H R DDD  D+LNY  +S ++F F  ++  +QYVG PIQCW+P +FT  WE+Y+ENYCW+ +TY+ P++   P +  DR+ R I YYQW P +LAL+   FY+P ++W+    ++S  N+  L  +  D   +D +A + T+   A +++  ++ Q+++   S  C++                        + + N++  LY F+K+LY+ N++ Q++++    G+   F+G  IL DL+ G EW+ SGNFPRVT CD E + LG  + +TVQCVL +N+F EKI+LFLWFW+ ++  +++ S+F W +      + +K IRKYL+  +    TD+ + +KFV K+L  DGVF + M++   G+I+A  ++  LW+
Sbjct:   14 HPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQ------------------------KRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLA--TDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 286.96 bits (733), Expect = 1.444e-91
Identity = 138/377 (36.60%), Postives = 227/377 (60.21%), Query Frame = 1
Query:  328 HLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKV-DRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSC-SFYSIYNLPKLISVTEDT--LDTEA-SKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWN 1443
            H R DDD  D+LNY  +S ++F F  ++  +QYVG PIQCW+P +FT  WE+Y+ENYCW+ +TY+ P++   P +  DR+ R I YYQW P +LAL+   FY+P ++W+    ++S  N+  L  +  D   +D +A + T+   A +++  ++ Q+++   S  C++                        + + N++  LY F+K+LY+ N++ Q++++    G+   F+G  IL DL+ G EW+ SGNFPRVT CD E + LG  + +TVQCVL +N+F EKI+LFLWFW+ ++  +++ S+F W +      + +K IRKYL+  +    TD+ + +KFV K+L  DGVF + M++   G+I+A  ++  LW+
Sbjct:   14 HPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQ------------------------KRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLA--TDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 286.189 bits (731), Expect = 8.903e-91
Identity = 142/401 (35.41%), Postives = 238/401 (59.35%), Query Frame = 1
Query:  328 HLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKV-DRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSC-SFYSIYNLPKLISVTEDT--LDTEA-SKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESYPMDKVIKNSLTHIP 1515
            H R DDD  D+LNY  +S ++F F  ++  +QYVG PIQCW+P +FT  WE+Y+ENYCW+ +TY+ P++   P +  DR+ R I YYQW P +LAL+   FY+P ++W+    ++S  N+  L  +  D   +D +A + T+   A +++  ++ Q+++   S  C++                        + + N++  LY F+K+LY+ N++ Q++++    G+   F+G  IL DL+ G EW+ SGNFPRVT CD E + LG  + +TVQCVL +N+F EKI+LFLWFW+ ++  +++ S+F W +      + +K IRKYL+  +    TD+ + +KFV K+L  DGVF + M++   G+I+A  ++  LW+ +  + V   P++ + +  +T  P
Sbjct:   14 HPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQ------------------------KRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLA--TDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDR-VRKSPIE-MFEGGVTQSP 386          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 272.322 bits (695), Expect = 6.450e-86
Identity = 142/379 (37.47%), Postives = 212/379 (55.94%), Query Frame = 1
Query:  322 SRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSK-VDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDT--LDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIY 1449
            S     DDD+ D+LNY  ++ ++  F  L+  +QYVG PIQCW+P  FT   E+Y+ENYCW+ +TYF P+ + +P    +R+ R IGYYQW P +LAL+  LFY+P ++W+  S+ S  ++  L+ +  D+  LD E+      A + I   ++    +K       +        CT+     V+               LY  VKILY  N++GQ++L+    G+   ++G+++L DL+ G EW+ SG+FPRVT CD E K LG  + +TVQCVL +N+F EKI+LFLWFW+ +L   T  SLF+W        R+L  + KYL         D  + R+FV  +L+ DGVFL+ M+A   GE+    +   LWN Y
Sbjct:   14 SIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNR---ALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTF--------------LYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-18 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8])

HSP 1 Score: 267.7 bits (683), Expect = 9.928e-84
Identity = 139/392 (35.46%), Postives = 219/392 (55.87%), Query Frame = 1
Query:  334 RSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVD-RQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYN---LPKLISVTEDTLDTEASKTIVFAARYID--LCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSK-SFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESYPMDKV 1488
            R DDD  DRL+Y  +S ++  F  L+  +QYVG PI+C++P +FTR  E+Y+ENYCW+ +TY+ P  + +P ++D R++R IGYYQW P +LA+    F++P  +W+  +  S  N   + +L+   E+       KT+   AR+ID  L  QR    +R S                         F +G+ YG ++ S+Y F+K L++ N+I Q  L+     +S    FG  +L DL  G EW+ SG FPRVT CD E + LG  + +TVQCVL +N+  EKI++FLW W  +L I+T+ +L +WF+ + +   R   + K+L  Q+           +FV ++L+ DGVFL+ M+A   G ++AA +  +LW I+  +  +    DK+
Sbjct:   22 RVDDDFVDRLHYLYTSTMVLMFAVLVSAKQYVGHPIECFVPAQFTRAMEQYTENYCWVQNTYWVPFQDLIPHRLDDRERRQIGYYQWVPFVLAVAALTFHIPSSVWRMLAGQSGLNAGLVLQLVCGDENVDPVVRDKTVDIVARHIDDALMYQRDHGARRHSVYIFAI-------------------FKLGKFYGAYVSSVYIFIKALHLANVILQFMLLNSFLQTSDYPMFGAHVLYDLFMGREWRDSGKFPRVTLCDFEIRVLGNVHRHTVQCVLVINMLTEKIFIFLWLWLTVLAIVTALNLIFWFIALVSNSCREHFVSKHLDIQS-------DQISRFVHRFLRADGVFLLQMIASHSGNLMAAKVTEQLWMIFVRRSGKPVIEDKI 387          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 93.9745 bits (232), Expect = 1.718e-20
Identity = 90/335 (26.87%), Postives = 139/335 (41.49%), Query Frame = 1
Query:  343 DDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAP-----------VSEKLPSKVDRQKRL--IGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRM-YGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGN-------FPRVTFCDIET-KKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIR 1281
            D+   R++YK + +++  F  L+  RQY+G PI C I  E   G     + YCWI ST+  P           V   + S V+ +  +    YYQW   +L  Q  LFY+P  +WKS   +    L  L+         + +  IV      D C   +KK                          + + + IG +   NF    ++  + L   N+IGQ+Y ++       S +G     D+++  E +           FP+VT C        G    +   CVLP+NI  EKIY+FLWFW +IL I++  SL +    +   K R   +R
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS---WEGGRLKMLV--------MDLNSPIVN-----DECKNDRKK--------------------------ILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGS----DVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLR 304          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 93.9745 bits (232), Expect = 1.718e-20
Identity = 90/335 (26.87%), Postives = 139/335 (41.49%), Query Frame = 1
Query:  343 DDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAP-----------VSEKLPSKVDRQKRL--IGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRM-YGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGN-------FPRVTFCDIET-KKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIR 1281
            D+   R++YK + +++  F  L+  RQY+G PI C I  E   G     + YCWI ST+  P           V   + S V+ +  +    YYQW   +L  Q  LFY+P  +WKS   +    L  L+         + +  IV      D C   +KK                          + + + IG +   NF    ++  + L   N+IGQ+Y ++       S +G     D+++  E +           FP+VT C        G    +   CVLP+NI  EKIY+FLWFW +IL I++  SL +    +   K R   +R
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS---WEGGRLKMLV--------MDLNSPIVN-----DECKNDRKK--------------------------ILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGS----DVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLR 304          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 93.9745 bits (232), Expect = 1.718e-20
Identity = 90/335 (26.87%), Postives = 139/335 (41.49%), Query Frame = 1
Query:  343 DDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAP-----------VSEKLPSKVDRQKRL--IGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRM-YGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGN-------FPRVTFCDIET-KKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIR 1281
            D+   R++YK + +++  F  L+  RQY+G PI C I  E   G     + YCWI ST+  P           V   + S V+ +  +    YYQW   +L  Q  LFY+P  +WKS   +    L  L+         + +  IV      D C   +KK                          + + + IG +   NF    ++  + L   N+IGQ+Y ++       S +G     D+++  E +           FP+VT C        G    +   CVLP+NI  EKIY+FLWFW +IL I++  SL +    +   K R   +R
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS---WEGGRLKMLV--------MDLNSPIVN-----DECKNDRKK--------------------------ILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGS----DVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLR 304          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 93.9745 bits (232), Expect = 1.718e-20
Identity = 90/335 (26.87%), Postives = 139/335 (41.49%), Query Frame = 1
Query:  343 DDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAP-----------VSEKLPSKVDRQKRL--IGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRM-YGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGN-------FPRVTFCDIET-KKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIR 1281
            D+   R++YK + +++  F  L+  RQY+G PI C I  E   G     + YCWI ST+  P           V   + S V+ +  +    YYQW   +L  Q  LFY+P  +WKS   +    L  L+         + +  IV      D C   +KK                          + + + IG +   NF    ++  + L   N+IGQ+Y ++       S +G     D+++  E +           FP+VT C        G    +   CVLP+NI  EKIY+FLWFW +IL I++  SL +    +   K R   +R
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS---WEGGRLKMLV--------MDLNSPIVN-----DECKNDRKK--------------------------ILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGS----DVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLR 304          
BLAST of Innexin vs. Ensembl Fly
Match: Inx3 (gene:FBgn0265274 transcript:FBtr0085350)

HSP 1 Score: 94.3597 bits (233), Expect = 1.812e-20
Identity = 88/374 (23.53%), Postives = 151/374 (40.37%), Query Frame = 1
Query:  343 DDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQC----WIPQEFTRGWEEYSENYCWIASTYFAP-----------VSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGN-----FPRVTFCDIET-KKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVT---KYLQIDGVFLVHMLA 1392
            D+M  R +Y++++ ++F    ++     +G PI C     IP             +CWI  TY  P               L ++  ++KR   YYQW P +L  QG +FY+P+ +WK                     + E  K      R I   ++    +     +  +    K F        V SL+ H G  +       Y+F ++L   N+I  +++++K  G +   +G  +L      M+  +  +     FPR+T C        G    +   CVL +NI  EKIY+FLWFW +IL  I+  ++ +  V I     R   I++          + +S  RK +    + L+I    ++H L+
Sbjct:   26 DNMVFRCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIPMHVI-------NTFCWITYTYTIPGQQHRQIGTDVAGPGLGNEYGQEKRYHSYYQWVPFVLFFQGLMFYVPHWVWK---------------------NMEDGKI-----RMITDGLRGMVSVPDDYRRDRQDRILKYF--------VNSLNTHNGYSFA------YFFCELLNFINVIVNIFMVDKFLGGAFMSYGTDVL--KFSNMDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMMPTTRETIIKR----------SYRSAQRKEIAGLVRRLEIGDFLILHFLS 340          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 8.205e-85
Identity = 142/379 (37.47%), Postives = 212/379 (55.94%), Query Frame = 1
Query:  322 SRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSK-VDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDT--LDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIY 1449
            S     DDD+ D+LNY  ++ ++  F  L+  +QYVG PIQCW+P  FT   E+Y+ENYCW+ +TYF P+ + +P    +R+ R IGYYQW P +LAL+  LFY+P ++W+  S+ S  ++  L+ +  D+  LD E+      A + I   ++    +K       +        CT+     V+               LY  VKILY  N++GQ++L+    G+   ++G+++L DL+ G EW+ SG+FPRVT CD E K LG  + +TVQCVL +N+F EKI+LFLWFW+ +L   T  SLF+W        R+L  + KYL         D  + R+FV  +L+ DGVFL+ M+A   GE+    +   LWN Y
Sbjct:   14 SIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNR---ALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTF--------------LYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 2.622e-80
Identity = 137/378 (36.24%), Postives = 222/378 (58.73%), Query Frame = 1
Query:  334 RSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKV-DRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSF-YSIYNLPKLISVTEDT--LDTE-ASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQF---QNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWN 1443
            R DDD  D+LNY  ++ ++  F  L+  +QYVG PIQCW+P  FT   E+Y+ENYCW+ +TY+ P+ E +P ++  R+ R IGYYQW P ILA++  LFY+P ++W+   + +S  NL  L+ +  D   +D+E  ++T+   AR++    Q + +L     Q    +C+ +       NC        GR  G ++  LY  +K+LY  N++ Q +L+  + GS+   +G  +L DL+  +EW+++G FPRVT CD E + LG  + +TVQCVL +N+F EKI+LFLWFW +   I+T  +  +W + +    + +  +RKYL+      A    D  T RKF   +L+ DGVF++ M++   GE++++ ++  LW 
Sbjct:  136 RLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHM----QDEVQLTNIDRQGHSRSCFSNLQLGA--NC--------GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 3.337e-70
Identity = 135/403 (33.50%), Postives = 217/403 (53.85%), Query Frame = 1
Query:  334 RSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSE--KLPSKVDR--QKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEAS---KTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKS-FFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIG-------TLKRR--LKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIY----RHKGVESYPM 1479
            R DDD +DRLNY ++  ++  F  LI  +Q+ G+PI+C  P +F   WE+Y+ENYCW   TYF   ++   L  K +R    R + YYQW P  L LQ   F  P  +WK  S +S   + +++   +D+ + E     K I+   R++   ++ Q  ++R   Q  KT  + +F  +                   F+  +Y F K+LY  N+  QLYLM    G+++  ++G  ++ D+++G  W+RSG FPR   CD E +++     Y+VQCVL +NIF EKI++ LWFW+VIL++ ++ SL  WF+ +         +K+   L T++ + Q  +   D+D S   KFVT+YL  DGVF++ M++   G I A  +V  L+  Y    ++K V+  P+
Sbjct:   17 REDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGSWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQVHKTVTFLNFQYS-----------------SGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDIVQGEPWERSGYFPRAAVCDFEVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVS---KFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPV 399          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 5.364e-68
Identity = 134/388 (34.54%), Postives = 193/388 (49.74%), Query Frame = 1
Query:  307 LGRWGSRHLRSD--DDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKV-DRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTE-------DTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELW 1440
            + RW S   +    DD  DRL+Y  ++ L+  F  ++  +QYVG  IQCW+P EF  GWE+Y+E+YC+I +T+F P   ++P  V DRQK  IGYYQW PI+LA+Q F+FY+P  IW S       + P +IS  E       +T     +K + F    +D          RS  +  +  CY+                  G+  G+    LY  +K++Y+ N+  Q  ++ K  G+    +G     DL  G EWQ SG FPRVT CD   +KL   + YTVQCVL +N+F EKIYLF+WFW V ++I T  +      R+     R   IR  L         +K+    F    L+ DGV L+  +    G +V   +  EL+
Sbjct:    7 IDRWLSETFKPKTFDDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILD---------TRSKNEYGRFYCYR-----------------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELF 368          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q27295|EAT5_CAEEL (Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN=eat-5 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.164e-64
Identity = 120/396 (30.30%), Postives = 208/396 (52.53%), Query Frame = 1
Query:  334 RSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVD-RQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVT---EDTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQ--------------IDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVE 1467
            R DD   DRLNY  S+L++ G    I  RQYVG P+QCW+P +FT+ WE+Y+E+YC++ +TY+   ++K+P  V+ R  + + YYQWAP I+A++   FY+P + W   S  S  N+ KL+      E     E  K I    R+I   +++    +R+  +  K A  +                  G  +G ++ ++Y   K++Y+ N   Q Y   K  G +  ++GMRIL D+++G +W+ SGNFPR+  CD + + LG    Y++QCVL +N+F EKI+LFL+ W +++  +T     +    + +  + ++ ++++L  Q+   + +K    + V +  Q               D + L+ M+    G+IV   +VG +WN +  +  +
Sbjct:   14 RLDDLGTDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKAWEQYAEDYCFVYNTYWVKPNDKVPLTVEERVSQQLIYYQWAPFIMAIEAAFFYLPVIFWSMLSTKSGINIIKLVETAQKAEGAESEERKKQIDIICRHISNNLRK----RRNEEETTKMAKIQRI---------------FGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLGQNDPYWGMRILDDILKGTDWEHSGNFPRIAMCDFQVRVLGNLQRYSIQCVLTLNMFNEKIFLFLYIWFLLVFFVTLFDSIFLCYNMFSSHKLVEFLQQFLDNQDQDENDEKKPEERKVYRKEQHSILLSEFCLHKFTPDIIILLKMINNHTGDIVCTEIVGRMWNEFLERDAK 390          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N2 (Innexin OS=Dugesia japonica OX=6161 GN=inx2 PE=2 SV=1)

HSP 1 Score: 862.062 bits (2226), Expect = 0.000e+0
Identity = 405/466 (86.91%), Postives = 440/466 (94.42%), Query Frame = 1
Query:  172 MAKGEVRNTNLNSQRGGNIDNIFVSTGQGKSDGDLDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCIQRQKKLKRSST-QCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESYPMDKVIKNSLTHIPDSREDKWSQSMWNDDIV 1566
            MAKGE+RNTNLN+QRG N++N+F S+GQGKSDGD DCNFLWN NKLG+WGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCW+ASTYFAP+SEKLPSKVDRQKRLIGYYQWAPIILA+QGFLFYMPYLIWKSCS+YSIYNLPKLIS+TE+ LD+EASK+IVF ARYIDLCIQRQ+KLK+SS+ QCIKTACYKSFS  KPKNCV+S H HIGR+YGNFL+SLY FVK+LYI N+IGQLYLME+IFGSSKSFFG+RIL+DLI+GMEW  SGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWH+ LVIITSTSLFWWF+++GTL RRLKTIRKYLQFQNAIGDTDKSTTRKFV KYLQIDGVFLVHM+ALSDGE+VAAGMV ELWNIYRHKGVE Y  DKVIKNSL  IPD RE+KW+Q MWNDDIV
Sbjct:    1 MAKGEIRNTNLNNQRGANLENVFGSSGQGKSDGDFDCNFLWNINKLGKWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWVASTYFAPISEKLPSKVDRQKRLIGYYQWAPIILAIQGFLFYMPYLIWKSCSYYSIYNLPKLISLTEENLDSEASKSIVFTARYIDLCIQRQRKLKKSSSSQCIKTACYKSFSWAKPKNCVISQHIHIGRLYGNFLISLYCFVKLLYIGNIIGQLYLMERIFGSSKSFFGIRILMDLIKGMEWHHSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHIALVIITSTSLFWWFIKLGTLGRRLKTIRKYLQFQNAIGDTDKSTTRKFVAKYLQIDGVFLVHMMALSDGELVAAGMVAELWNIYRHKGVEIYSTDKVIKNSLIQIPDCREEKWNQIMWNDDIV 466          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N1 (Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 SV=1)

HSP 1 Score: 459.529 bits (1181), Expect = 7.620e-154
Identity = 221/441 (50.11%), Postives = 296/441 (67.12%), Query Frame = 1
Query:  172 MAKGEVRNTNLNS--QRGGNIDNIFVSTGQGKSDGDLDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDT----LDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFS-CTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESY 1473
            ++ GEVR  + +   Q G  +         G   GD+D  F W  +KLGR GS  LR DDD  DRLNY+ + LL+F FI LIG+RQYVGKPIQCWIPQEFTRGWEEY+ENYCW+++TYFA +  ++PSK  R +++IGYYQWAPI+L LQ  LFY+P LIW++ S  S +N+ +++ V  D     +  +  K+I F AR++D C+ R +                 FS C     C+  L    G++ GNFL  LY  +K LY+ N+IGQLYLMEK  G+  +F+G+R+L DL+RG EW  SGNFPRVTFCD+E KKLGKN+LY++QCVLPMN+FLEKIY+FLWFWHVI+ I T  SLF W  RIG+   R+K IR YL+  N + DTDK  +RKF   YL+ DG FL+ ++A++ G++VA  ++ E+W IYRHK ++ +
Sbjct:   10 LSAGEVRRPSFSHIVQSGSPVPG-------GDCSGDMDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDTRNEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRSNGKRSKFSRCLAKLRCICCL----GKLQGNFLTVLYISIKFLYLINIIGQLYLMEKFIGTKYTFYGIRVLWDLMRGHEWHHSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLCSLFSWIRRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEF 439          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GCN3 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 447.973 bits (1151), Expect = 2.653e-150
Identity = 213/417 (51.08%), Postives = 295/417 (70.74%), Query Frame = 1
Query:  274 LDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEK-LPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDT---LDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESYPMDKVIKNSLTHI 1512
            +D  F+W  +KLGR GS  LR DDD ADRLNY+ + +++F FI LIG+RQYVGKPIQCWIPQEFTRGWEEY+ENYCW+A+TY+A V E+ LP++  R+KR+I YYQWAPI+LA+Q  +FY+P LIW+    YS +N+ K++ +  D    +    +K I F ARY++ CI RQ++ +R     +K        C    +C+       G+ YGNFLV LY+F+K+LY+ N+ GQLY+MEK  G++ +FFG ++L DL  G++W +S NFPRVTFCD++ KKLG NY YT+QCVLP+N+FLEKIY+FLWFWHV++ I+T  S   WF R+   +RRL  +RKYL+  N + DTDK+T+RKFV  YL+IDGVF+  ++A++ G+IVA  +  ELW+IYRHK ++     K+      H+
Sbjct:    1 MDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVPEEHLPAEHLRRKRMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNVRKILQMATDANVVIPEALNKNIRFMARYMEGCIYRQREYRRGVGVRVK-------HCLAKCSCLCC-----GKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFVGTTYTFFGFQVLRDLFNGIQWYQSSNFPRVTFCDLQAKKLGVNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLGSFVNWFFRMAFARRRLIFVRKYLKIMNVLKDTDKTTSRKFVENYLRIDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDDTKLETTDHRHV 405          
BLAST of Innexin vs. TrEMBL
Match: A0A267EEW5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 443.351 bits (1139), Expect = 2.281e-148
Identity = 211/426 (49.53%), Postives = 295/426 (69.25%), Query Frame = 1
Query:  274 LDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPV-SEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDT---LDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESYPMDKVIKNSLTHIPDSREDKWS 1539
            +D  F+W  +KLGR GS  LR DDD ADRLNY+ + +++F FI LIG+RQYVGKPIQCWIPQEFTRGWEEY+ENYCW+A+TY+A V ++ LP +  R + +I YYQWAPI+LA+Q  +FY+P LIW+    YS +NL K++ +  D    +    +K + F ARY++ CI RQ++ +R     +K    K                  G+ YGNFLV LY+F+K+LY+ N+ GQLY+MEK  G++ +FFG R+L+D++ G++W +S NFPRVTFCD++ KK G+NY YT+QCVLP+N+FLEKIY+FLWFWHV++ I+T TS   WF R+   +RRL  IRKYL+  N + DTDK+T+RKFV  YL++DGVF+  ++A++ G+IVA  +  ELW+IYRHK ++     K+        PD R   ++
Sbjct:    1 MDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVQADHLPPQHIRNELMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNLRKILQMATDANVVIPEALNKNVRFMARYMEGCIYRQREYRRGVGVRLKHCLSKCSCLCC------------GKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFIGTTYTFFGFRVLLDIVHGIKWYQSSNFPRVTFCDLQAKKEGQNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLTSFVNWFFRMAFARRRLNFIRKYLKIMNVLKDTDKTTSRKFVENYLRVDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDDTKL-------EPDHRHTAFA 407          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GJJ5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 7.393e-144
Identity = 207/434 (47.70%), Postives = 294/434 (67.74%), Query Frame = 1
Query:  238 FVSTGQGKSDG------DLDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPV-SEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDT---LDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESYPMDKVIKNSLTH 1509
            FV+   G   G       +D  F+W  +KLGR GS   R DDD ADRLNY+ S +++F FI LIG+RQYVGKPIQCWIPQEFTRGWEEY+ENYCW+A+TY+A + ++ LP +  R +  I YYQWAPI+LA+Q  +FY+P LIW+    YS +N+ +L+ +  D    +    +K + F ARY++ CI RQ++ KR     ++        C    +C+       G+ +GNFLV LY+FVK+LY+ N  GQLYLMEK  G++ +FFG R+L+D+++G+ W RS NFPRVTFCD++ +K+G NY YT+QCVLP+N+FLEKIY+FLWFW  ++ +IT +S   WF R+   +RR   +RKYL+  NA+ DTD+ T+RKFV  YL++DGVF++ +++ + G+IVA  +  ELW+IYRHK ++     K+   +  H
Sbjct:   73 FVANSLGPDGGFILQAPVMDATFMWKLSKLGRIGSSRQRVDDDFADRLNYQFSGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASLEADHLPEEQSRSRLTITYYQWAPIVLAVQALMFYIPCLIWRLFMNYSGFNVRRLLQMAADANVVIPEALNKNVRFMARYMEGCIYRQREYKRGLGVRVR-------RCLSACSCICC-----GKRHGNFLVVLYFFVKLLYLLNAFGQLYLMEKFVGTTHTFFGFRVLLDILQGVHWYRSSNFPRVTFCDLQARKIGVNYRYTLQCVLPLNMFLEKIYVFLWFWVALVSVITMSSFVSWFCRMAFARRRTGFVRKYLKIMNALKDTDRLTSRKFVENYLRVDGVFILRLVSANCGDIVAGDLACELWSIYRHKRLQELEDTKLDAAACCH 494          

HSP 2 Score: 65.855 bits (159), Expect = 1.728e-7
Identity = 31/81 (38.27%), Postives = 50/81 (61.73%), Query Frame = 1
Query: 1141 LPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVH 1383
            LP+N F+EK+Y+FLWFW++IL ++T  S   W +RI     R+  I++YL+    I +T+    ++FV   L  DG F++ 
Sbjct:    7 LPINHFVEKVYVFLWFWYIILGVLTLLSTIIWMLRILIPGGRVAYIKQYLRAMKLISNTEDRDCKRFVANSLGPDGGFILQ 87          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000048827.1 (SMESG000048827.1)

HSP 1 Score: 962.985 bits (2488), Expect = 0.000e+0
Identity = 465/465 (100.00%), Postives = 465/465 (100.00%), Query Frame = 1
Query:  172 MAKGEVRNTNLNSQRGGNIDNIFVSTGQGKSDGDLDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESYPMDKVIKNSLTHIPDSREDKWSQSMWNDDIV 1566
            MAKGEVRNTNLNSQRGGNIDNIFVSTGQGKSDGDLDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESYPMDKVIKNSLTHIPDSREDKWSQSMWNDDIV
Sbjct:    1 MAKGEVRNTNLNSQRGGNIDNIFVSTGQGKSDGDLDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESYPMDKVIKNSLTHIPDSREDKWSQSMWNDDIV 465          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000060499.1 (SMESG000060499.1)

HSP 1 Score: 447.973 bits (1151), Expect = 8.538e-153
Identity = 212/402 (52.74%), Postives = 286/402 (71.14%), Query Frame = 1
Query:  286 FLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDT----LDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSF--SCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESY 1473
            F W  +KLGR GS  LR DDD  DRLNY+ + LL+F FI LIG+RQYVGKPIQCWIPQEFTRGWEEY+ENYCW+++TYFA +  ++PSK  R++++IGYYQWAPI+L LQ  LFY+P LIW++ S  S +N+ +++ V  D     +  +  K+I F AR++D C+ R + +       ++T   +S    C     C+  L    G++ GNFL  LY  +KILY+ N+IGQLYLMEK  G+  +F+G+R+L DL+RG EW  SGNFPRVTFCD+E KKLGKN+LY++QCVLPMN+FLEKIY+FLWFWHVI+ I T  SLF W  RIG+   R+K IR YL+  N + DTDK  +RKF   YL+ DG FL+ ++A++ G++VA  ++ E+W IYRHK ++ +
Sbjct:   43 FFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHR-ICYEHKHFMRTNGKRSTISRCLAKLRCICCL----GKLQGNFLTVLYISIKILYLINIIGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEF 439          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000048374.1 (SMESG000048374.1)

HSP 1 Score: 412.535 bits (1059), Expect = 1.493e-139
Identity = 196/400 (49.00%), Postives = 275/400 (68.75%), Query Frame = 1
Query:  274 LDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDT---LDTEASKTIVFAARYIDLCIQRQ-KKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKG 1461
            +D   +W   KLGR GS HLR DDD  DRLNY+++  L F FI ++GLR Y+GKPIQCW PQEF + WE+YSEN+CW+++T++AP++  LP ++D+  +LIGYYQW PI+LA+Q  +FY+P LIW+    YS +N+ ++I +  DT   +    SK I F ARYID CI R  +  KR+      +   K  +  K  NC      H    +G FL  LY  VK+LY+ N++ Q+YLM++  G+  +FFG+++L+DLI G EW  SGNFPRVTFC+++TKKLG+N +Y +QCVLP+N+FLEKIY+FLWF++VIL IIT+ S   W +R+G +K R K IRKYL+  NA+ +TD + T KF    L+ DGVF+++++ ++ G IVA  +  ELWNIYRHK 
Sbjct:    1 MDATLVWKIAKLGRVGSSHLRFDDDWVDRLNYQITCFLHFLFIGVLGLRSYIGKPIQCWAPQEFNKAWEDYSENFCWVSNTFYAPINNNLPLRMDKTSKLIGYYQWTPIVLAVQALMFYIPCLIWRLLMNYSGFNVRRIIQMAGDTNSLVPDINSKNIKFIARYIDTCIDRNYRDCKRNQI----SVDGKQLNYRKKCNCFSRHCCHTN--HGRFLFFLYGIVKVLYVINVLLQMYLMKRFLGTDSNFFGVKVLVDLINGFEWNHSGNFPRVTFCEVQTKKLGENNIYNLQCVLPLNMFLEKIYIFLWFYYVILGIITTASFCSWLLRMGYVKSRWKFIRKYLKILNAMRETDNTATLKFTENNLRPDGVFIIYLVTINVGHIVAGDLTVELWNIYRHKS 394          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000045304.1 (SMESG000045304.1)

HSP 1 Score: 411.764 bits (1057), Expect = 1.113e-138
Identity = 205/423 (48.46%), Postives = 275/423 (65.01%), Query Frame = 1
Query:  274 LDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLD-------------TEASKTIVFAARYIDLCIQRQ----KKLKRSSTQC-----------IKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHK 1458
            +D  F+W   KLGR GS  LR DDD  DRLNY+ + +++F FI L+ +RQY+GKPIQCWIPQEFTRGWEEY+ENYCWIA+TYFA +  + P K++R++R+IGYYQWAPI +ALQ  +FY+P LIW+  +  S +N+ +LI +     +               ++    F  RYI  CI R+    + L +S   C           I  +C     C     C  S     GR  GN+L+SLY  VK LY+ N+I QLY+ME   G+S SF+G+R+LIDLI+G  W  SG+FPRVTFCD+E KKLGKN LYT+QCVLPMN+FLEKI++FLWFWHV+L I+   S+  W  +I +LKRR+K IRK L+    + DTD S +R+FV +YL+ D VF++ ++  + GEI+   +  ELW IYRHK
Sbjct:    1 MDATFVWKLGKLGRLGSNRLRYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPISNSCCSR--CCANHGCFESC---CGRRNGNYLISLYITVKFLYLINIIIQLYIMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIVNFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHK 418          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000059204.1 (SMESG000059204.1)

HSP 1 Score: 377.481 bits (968), Expect = 7.279e-126
Identity = 181/406 (44.58%), Postives = 258/406 (63.55%), Query Frame = 1
Query:  274 LDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLD-----------TEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHK 1458
            +D  F+W   KLGR GS HLR DDD  DRLNY+V+ +L+F FI +IG+RQYVGKPIQCW PQEFTRGWEEY+ENYCW+++TY++ V+ +LP K DR+  +IGYYQWA I L +Q  LFY+P +IW+     S +N+ ++I ++    D           + ++ +I F A+Y+D CI+R+   +    + +          + P  C            GN L  LY F+K+LYI N I Q+YLME   G+    +G+ +LIDL++G  W  SG+FPRVTFCD + KKLGKN++YT+QCVLP+N+ LEKI++ LWFW V+L II   S   W  R+   + R++ IRK+L    A+  +D+  +R FV  YL  D VF++ +++ +  E VA+ +  ELW IYRH+
Sbjct:    1 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTGILLFLFIGIIGIRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLSEKSGNSSSNTSIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCC--------SHKSGNCLSILYLFIKLLYILNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKIFIILWFWIVLLAIINIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHR 398          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-11.444e-9136.60Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.444e-9136.60Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-18.903e-9135.41Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-96.450e-8637.47Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
inx-189.928e-8435.46Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8][more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx21.718e-2026.87gene:FBgn0027108 transcript:FBtr0301860[more]
Inx21.718e-2026.87gene:FBgn0027108 transcript:FBtr0071005[more]
Inx21.718e-2026.87gene:FBgn0027108 transcript:FBtr0332314[more]
Inx21.718e-2026.87gene:FBgn0027108 transcript:FBtr0071006[more]
Inx31.812e-2023.53gene:FBgn0265274 transcript:FBtr0085350[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL8.205e-8537.47Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL2.622e-8036.24Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23157|INX11_CAEEL3.337e-7033.50Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|Q19746|INX3_CAEEL5.364e-6834.54Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q27295|EAT5_CAEEL1.164e-6430.30Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6N20.000e+086.91Innexin OS=Dugesia japonica OX=6161 GN=inx2 PE=2 S... [more]
Q2L6N17.620e-15450.11Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 S... [more]
A0A1I8GCN32.653e-15051.08Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A267EEW52.281e-14849.53Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A1I8GJJ57.393e-14447.70Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048827.10.000e+0100.00SMESG000048827.1[more]
SMESG000060499.18.538e-15352.74SMESG000060499.1[more]
SMESG000048374.11.493e-13949.00SMESG000048374.1[more]
SMESG000045304.11.113e-13848.46SMESG000045304.1[more]
SMESG000059204.17.279e-12644.58SMESG000059204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004284 ID=SMED30004284|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1721bp
TTCTTTCTTTCTGTTTTTTTGTTTTACTAATGTCTGTGTAGCCGCAATTT
GATTGGCGGAGAGATTTTTCGAATCATCGACGATAACCGACATATTATTT
GCTAATCTCTTCACTCATATTTCCTAAAACAAATTTATATCAATAAATGG
ACAAATAAAACCCTCGTATCAATGGCTAAAGGCGAAGTACGAAATACTAA
CTTAAACAGTCAGCGGGGTGGGAATATAGATAACATATTTGTGTCCACTG
GTCAAGGCAAAAGTGATGGAGACTTAGACTGCAACTTTCTTTGGAATTTC
AATAAATTGGGAAGATGGGGCTCCAGGCATTTGAGATCGGATGACGATAT
GGCAGATCGGCTCAATTACAAGGTGTCGAGCCTATTAATGTTTGGATTCA
TCAGTTTAATCGGTCTCCGACAATATGTGGGTAAACCTATTCAGTGCTGG
ATACCTCAAGAATTCACTCGGGGTTGGGAAGAATATTCTGAAAATTATTG
TTGGATAGCGAGTACATATTTTGCTCCGGTTAGTGAAAAGCTCCCTTCAA
AGGTTGATCGGCAGAAACGTCTAATAGGATATTATCAGTGGGCCCCAATC
ATTCTAGCTCTACAAGGGTTCCTTTTTTACATGCCATATCTAATCTGGAA
GAGCTGTTCATTTTATTCGATATACAATCTGCCGAAGCTTATTAGCGTGA
CCGAAGATACTCTAGACACTGAAGCCTCAAAGACTATAGTATTCGCAGCT
CGTTACATTGACCTCTGTATTCAACGTCAAAAAAAACTTAAAAGGTCCTC
CACCCAATGTATTAAAACCGCCTGTTATAAATCCTTTTCCTGTACAAAAC
CGAAAAACTGTGTTGTAAGCCTTCATTTTCATATTGGTCGAATGTATGGG
AATTTTCTTGTCTCTCTTTACTATTTCGTAAAGATTCTCTACATCTTTAA
CCTGATCGGTCAGCTGTATCTTATGGAGAAAATATTTGGATCGTCTAAAT
CATTCTTTGGAATGAGAATTCTCATCGACTTAATTCGAGGCATGGAATGG
CAACGTTCCGGAAACTTTCCTAGGGTCACATTTTGCGATATTGAGACAAA
AAAACTGGGGAAAAATTATTTATACACCGTTCAATGTGTGCTACCAATGA
ATATTTTCCTGGAGAAAATTTATCTCTTTCTTTGGTTTTGGCATGTTATT
CTGGTTATTATTACTAGCACCAGTCTTTTTTGGTGGTTTGTGAGAATTGG
AACCTTGAAACGGCGATTAAAAACAATCAGGAAGTACTTGCAATTTCAGA
ACGCCATCGGAGACACTGACAAATCTACGACGAGAAAATTTGTCACGAAA
TATCTACAAATTGACGGCGTATTTCTCGTCCACATGCTGGCGTTGAGTGA
CGGCGAAATCGTGGCAGCTGGAATGGTAGGAGAGCTTTGGAATATTTATC
GGCACAAAGGAGTCGAGAGCTATCCGATGGATAAAGTGATCAAGAATAGC
CTCACCCACATACCAGACAGCAGAGAGGACAAATGGAGCCAGTCGATGTG
GAACGATGACATTGTGTAGGATGTAAAACGTGATTGCAATTATTTACAGA
TTTGTAGAGATTATTTTAATTTACAAATTTTTGTACATATTTTAATGGAT
TTAAAAAAATTGAAAAATCATTTGGCATGAAACATAATCCACTTGATTGC
TTTCAGTAAATACAATACTGC
back to top

protein sequence of SMED30004284-orf-1

>SMED30004284-orf-1 ID=SMED30004284-orf-1|Name=SMED30004284-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=466bp
MAKGEVRNTNLNSQRGGNIDNIFVSTGQGKSDGDLDCNFLWNFNKLGRWG
SRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTR
GWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGF
LFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCI
QRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLY
YFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFP
RVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITST
SLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGV
FLVHMLALSDGEIVAAGMVGELWNIYRHKGVESYPMDKVIKNSLTHIPDS
REDKWSQSMWNDDIV*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
Dj-inx2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 322..338
score: 61.41
coord: 137..159
score: 52.52
coord: 81..92
score: 52.67
coord: 250..264
score: 42.13
coord: 298..307
score: 65.2
coord: 109..118
score: 50.4
IPR000990InnexinPFAMPF00876Innexincoord: 58..426
e-value: 2.0E-112
score: 376.0
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 54..430
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 53..432
score: 34.167
NoneNo IPR availableTMHMMTMhelixcoord: 246..268
NoneNo IPR availableTMHMMTMhelixcoord: 335..357
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 137..159