Cytoskeleton-associated protein 5-A

Overview
NameCytoskeleton-associated protein 5-A
Smed IDSMED30004281
Length (bp)6256
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytoskeleton-associated protein 5-A (SMED30004281) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytoskeleton-associated protein 5-A (SMED30004281) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytoskeleton-associated protein 5-A (SMED30004281) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytoskeleton-associated protein 5-A (SMED30004281) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004281

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30004281h1SMcG0002469 Contig45426uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004281h1SMcG0002469 Contig45426newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004281h1SMcG0002469 Contig45797uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004281h1SMcG0002469 Contig45797newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30004281h1SMcG0002469 dd_Smed_v4_3967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004281h1SMcG0002469 dd_Smed_v4_3967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004281h1SMcG0002469 dd_Smed_v4_3967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004281h1SMcG0002469 dd_Smed_v4_3967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004281h1SMcG0002157 SMED_06293_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004281h1SMcG0002469 SMED_06293_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Match: CKAP5 (cytoskeleton associated protein 5 [Source:HGNC Symbol;Acc:HGNC:28959])

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 667/1991 (33.50%), Postives = 1074/1991 (53.94%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK--QASEATIV--------LPEKSAVVVAE-----KPIEPPKAE--KHAEXXXXXXXXXXXXXXXXXXXXXXGAASK----VPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGL-KNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-PEP------------IPSKQLPKAASSNGXXXXXXXXX--XXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSAT----REQPKPQISQL--PPKTIDINP----LLKEEIGYKLINVDK-------EVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKASQ-SVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQISVYG--SNQL------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFD 5867
            K EHK WKAR+ GYEEALK  Q     K P ++ +LGL+K  V DSNAV Q K LE  L++V+ A+VA K   ++  G+V+K FN  + K +EL  EI  + +EIE+ + V EEL+KGL  K PK++V  I  L++ L +FG KI+ +K + K + KL E R+K VR+  K + +E+YRWI   AL P L  I  VQ+ EL  E+ KLP   P P+R+L+SQ+  E+ L +    G             PQ    ID Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LF+ R F   +       LLK     L     DS PEVRDAAF+ LGTA+KVV EK + P+L  +D +KL +I E  EK +     +A +         LP ++A   A      K I  PK    K A A+K     K         +   G  +K      EI  E  +S +    KA+ +     +  +   NWKER A  E  Q  V+    +++PCQ ++R++  KPG K+ N QV++ K+ ++  I   G  + T+A++ +  L +KIGD+K  +N K  +T +++   LP  A QV+  A    N KN  E LNWLS+AIK+FGF  + +   +  ++ A+  TNPAVR + I L G + LYV   +    +DEKP++   ID E E ++  +PP PTRG+ K+ T   +   D +     +    ++ D++PR  I+ KIT  L++++ DK  K++KE L +V  II+ +  I  + +  L  A+     DS+ ++ +  +N+L  L  A    + ++++K +   +++   D K   R  A+  +N W E+ G    ++G  ++E LK +NP+ +  +  W++  L  L     P  L+        +PHL+S +E+R+ DVRK +Q+A+  FM+  GY+ M K      K + K  ++  L+KAK  +P  P P             P+K  P +A +     +S E     KKA       K  S +  KMP+K++ + D+D      +   + K+QR+++++  KV KW  +       +QL +Q S+  +  L   +F +D +   KA+ ++   L E +K+ +      LDLILKW+ +RF +TN SVL K L+YL  +FT+L  +  + L E+E + FIP L+VK+G+PKD +R   + IL  +   Y   K+  F+ E   +K ++ R EC + L  L++   ++V        LK +A+ I +RDN VR AALN +V+ +N  G+ + K++ +L +KD SML ERIKRS K           ++   +  +KP R +  S+     R+ P   +S      +++  +P    +++ E    L  ++        E+ EL+Q  L+ I    L   P    K+R+ S        N+   I  +I  + S ++ TSIQA+ QIDEV+R +D    +  ++D  +++  MQL+      +++EK  + EI  ++  ++  ++S+F  + LA E +   L +LM  ++ ++++ ++  L EG  +IR +N+L V++LE S+QT +LSALL ++ D L    +  K+  L+ KC+W M + L +T++SI+L  I  DI +F   FP    + ++   + P+RT+KTL++++   KG   L+ L  I      +LE ++ +  +K ++       + T S +  E     +  +   KS+     + L +IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +IS     S Q+        +   +S+   N     + P   L RLK LR+  GLD +  D
Sbjct:   15 KCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWI-RDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----IDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKIKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKPGPLKKAPAAKAGGPPKKGKPAAPGGAGNTGTKNKKGLETKEI-VEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMDRTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVVSMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLGVMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDEPDDGSN---DVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPN-IGELPTALKGRLNDSNKILVQQTLNILQQLAVAMG-PNIKQHVKNLGIPIITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRST--PTDLIL------CVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKA-TGKLKPTSKDQVLAMLEKAKVNMPAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEPKPDPKKAKAPGLSSKAKSAQGKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRDEYIEQLKTQMSSCVAKWLQDEMFHSDFQHHNKALAVMVDHL-ESEKEGVIGC---LDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLS-EEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAK--------RPSAAPIKQVEEKPQRAQNISSNANMLRKGPAEDMSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEP----KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEIIKLYSCIIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKE--KLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCR-MMKHSM-------DQTGSKSDKETEKGAS--RIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGE--EVGPSVYLERLKILRQRCGLDNTKQD 1954          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Match: CKAP5 (cytoskeleton associated protein 5 [Source:HGNC Symbol;Acc:HGNC:28959])

HSP 1 Score: 898.271 bits (2320), Expect = 0.000e+0
Identity = 649/1990 (32.61%), Postives = 1040/1990 (52.26%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK--QASEATIV--------LPEKSAVVVAE-----KPIEPPKAE--KHAEXXXXXXXXXXXXXXXXXXXXXXGAASK----VPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGL-KNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-PEP------------IPSKQLPKAASSNGXXXXXXXXX--XXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSAT----REQPKPQISQL--PPKTIDINP----LLKEEIGYKLINVDK-------EVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKASQ-SVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQISVYG--SNQL------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFD 5867
            K EHK WKAR+ GYEEALK  Q     K P ++ +LGL+K  V DSNAV Q K LE  L++V+ A+VA K   ++  G+V+K FN  + K +EL  EI  + +EIE+ + V EEL+KGL  K PK++V  I  L++ L +FG KI+ +K + K + KL E R+K VR+  K + +E+YRWI   AL P L  I  VQ+ EL  E+ KLP   P P+R+L+SQ+  E+ L +    G             PQ    ID Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LF+ R F   +       LLK     L     DS PEVRDAAF+ LGTA+KVV EK + P+L  +D +KL +I E  EK +     +A +         LP ++A   A      K I  PK    K A A+K     K         +   G  +K      EI  E  +S +    KA+ +     +  +   NWKER A  E  Q  V+    +++PCQ ++R++  KPG K+ N QV++ K+ ++  I   G  + T+A++ +  L +KIGD+K  +N K  +T +++   LP  A QV+  A    N KN  E LNWLS+AIK+FGF  + +   +  ++ A+  TNPAVR + I L G + LYV   +    +DEKP++   ID E E ++  +PP PTRG+ K+ T   +   D +     +    ++ D++PR  I+ KIT  L++++ DK  K++KE L +V  II+ +  I  + +  L  A+     DS+ ++ +  +N+L  L  A    + ++++K +   +++   D K   R  A+  +N W E+ G    ++G  ++E LK +NP+ +  +  W++  L  L     P  L+        +PHL+S +E+R+ DVRK +Q+A+  FM+  GY+ M K      K + K  ++  L+KAK  +P  P P             P+K  P +A +     +S E     KKA       K  S +  KMP+K++ + D+D      +   + K+QR+++++  KV KW  +       +QL +Q S+  +  L   +F +D +   KA+ ++   L E +K+ +      LDLILKW+ +RF +TN SVL K L+YL  +FT+L  +  + L E+E + FIP L+VK+G+PKD +R   + IL  +   Y   K+  F+ E   +K ++ R EC + L  L++   ++V        LK +A+ I +RDN VR AALN +V+ +N  G+ + K++ +L +KD SML ERIKRS K           ++   +  +KP R +  S+     R+ P   +S      +++  +P    +++ E    L  ++        E+ EL+Q  L+ I    L   P    K+R+ S        N+   I  +I  + S ++ TSIQA+ Q+ ++                                  E  +    T + K ++  L+++                         +++ ++  L EG  +IR +N+L V++LE S+QT +LSALL ++ D L    +  K+  L+ KC+W M + L +T++SI+L  I  DI +F   FP    + ++   + P+RT+KTL++++   KG   L+ L  I      +LE ++ +  +K ++       + T S +  E     +  +   KS+     + L +IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +IS     S Q+        +   +S+   N     + P   L RLK LR+  GLD +  D
Sbjct:   15 KCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWI-RDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----IDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKIKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKPGPLKKAPAAKAGGPPKKGKPAAPGGAGNTGTKNKKGLETKEI-VEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMDRTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVVSMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLGVMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDEPDDGSN---DVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPN-IGELPTALKGRLNDSNKILVQQTLNILQQLAVAMG-PNIKQHVKNLGIPIITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRST--PTDLIL------CVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKA-TGKLKPTSKDQVLAMLEKAKVNMPAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEPKPDPKKAKAPGLSSKAKSAQGKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRDEYIEQLKTQMSSCVAKWLQDEMFHSDFQHHNKALAVMVDHL-ESEKEGVIGC---LDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLS-EEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAK--------RPSAAPIKQVEEKPQRAQNISSNANMLRKGPAEDMSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEP----KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQLFQI----------------------------------ESLAREASTGVLKDLMHGLITL-------------------------MLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKE--KLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCR-MMKHSM-------DQTGSKSDKETEKGAS--RIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGE--EVGPSVYLERLKILRQRCGLDNTKQD 1894          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Match: CKAP5 (cytoskeleton associated protein 5 [Source:HGNC Symbol;Acc:HGNC:28959])

HSP 1 Score: 898.271 bits (2320), Expect = 0.000e+0
Identity = 649/1990 (32.61%), Postives = 1040/1990 (52.26%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK--QASEATIV--------LPEKSAVVVAE-----KPIEPPKAE--KHAEXXXXXXXXXXXXXXXXXXXXXXGAASK----VPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGL-KNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-PEP------------IPSKQLPKAASSNGXXXXXXXXX--XXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSAT----REQPKPQISQL--PPKTIDINP----LLKEEIGYKLINVDK-------EVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKASQ-SVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQISVYG--SNQL------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFD 5867
            K EHK WKAR+ GYEEALK  Q     K P ++ +LGL+K  V DSNAV Q K LE  L++V+ A+VA K   ++  G+V+K FN  + K +EL  EI  + +EIE+ + V EEL+KGL  K PK++V  I  L++ L +FG KI+ +K + K + KL E R+K VR+  K + +E+YRWI   AL P L  I  VQ+ EL  E+ KLP   P P+R+L+SQ+  E+ L +    G             PQ    ID Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LF+ R F   +       LLK     L     DS PEVRDAAF+ LGTA+KVV EK + P+L  +D +KL +I E  EK +     +A +         LP ++A   A      K I  PK    K A A+K     K         +   G  +K      EI  E  +S +    KA+ +     +  +   NWKER A  E  Q  V+    +++PCQ ++R++  KPG K+ N QV++ K+ ++  I   G  + T+A++ +  L +KIGD+K  +N K  +T +++   LP  A QV+  A    N KN  E LNWLS+AIK+FGF  + +   +  ++ A+  TNPAVR + I L G + LYV   +    +DEKP++   ID E E ++  +PP PTRG+ K+ T   +   D +     +    ++ D++PR  I+ KIT  L++++ DK  K++KE L +V  II+ +  I  + +  L  A+     DS+ ++ +  +N+L  L  A    + ++++K +   +++   D K   R  A+  +N W E+ G    ++G  ++E LK +NP+ +  +  W++  L  L     P  L+        +PHL+S +E+R+ DVRK +Q+A+  FM+  GY+ M K      K + K  ++  L+KAK  +P  P P             P+K  P +A +     +S E     KKA       K  S +  KMP+K++ + D+D      +   + K+QR+++++  KV KW  +       +QL +Q S+  +  L   +F +D +   KA+ ++   L E +K+ +      LDLILKW+ +RF +TN SVL K L+YL  +FT+L  +  + L E+E + FIP L+VK+G+PKD +R   + IL  +   Y   K+  F+ E   +K ++ R EC + L  L++   ++V        LK +A+ I +RDN VR AALN +V+ +N  G+ + K++ +L +KD SML ERIKRS K           ++   +  +KP R +  S+     R+ P   +S      +++  +P    +++ E    L  ++        E+ EL+Q  L+ I    L   P    K+R+ S        N+   I  +I  + S ++ TSIQA+ Q+ ++                                  E  +    T + K ++  L+++                         +++ ++  L EG  +IR +N+L V++LE S+QT +LSALL ++ D L    +  K+  L+ KC+W M + L +T++SI+L  I  DI +F   FP    + ++   + P+RT+KTL++++   KG   L+ L  I      +LE ++ +  +K ++       + T S +  E     +  +   KS+     + L +IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +IS     S Q+        +   +S+   N     + P   L RLK LR+  GLD +  D
Sbjct:   15 KCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWI-RDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----IDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKIKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKPGPLKKAPAAKAGGPPKKGKPAAPGGAGNTGTKNKKGLETKEI-VEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMDRTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVVSMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLGVMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDEPDDGSN---DVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPN-IGELPTALKGRLNDSNKILVQQTLNILQQLAVAMG-PNIKQHVKNLGIPIITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRST--PTDLIL------CVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKA-TGKLKPTSKDQVLAMLEKAKVNMPAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEPKPDPKKAKAPGLSSKAKSAQGKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRDEYIEQLKTQMSSCVAKWLQDEMFHSDFQHHNKALAVMVDHL-ESEKEGVIGC---LDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLS-EEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAK--------RPSAAPIKQVEEKPQRAQNISSNANMLRKGPAEDMSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEP----KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQLFQI----------------------------------ESLAREASTGVLKDLMHGLITL-------------------------MLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKE--KLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCR-MMKHSM-------DQTGSKSDKETEKGAS--RIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGE--EVGPSVYLERLKILRQRCGLDNTKQD 1894          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Match: CKAP5 (cytoskeleton associated protein 5 [Source:HGNC Symbol;Acc:HGNC:28959])

HSP 1 Score: 128.642 bits (322), Expect = 1.966e-33
Identity = 64/135 (47.41%), Postives = 87/135 (64.44%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLK 521
            K EHK WKAR+ GYEEALK  Q     K P ++ +LGL+K  V DSNAV Q K LE  L++V+ A+VA K   ++  G+V+K FN  + K +EL  EI  + +EIE+ + V EEL+KGL  K PK++V  I  L+
Sbjct:   15 KCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLR 149          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Match: CKAP5 (cytoskeleton associated protein 5 [Source:HGNC Symbol;Acc:HGNC:28959])

HSP 1 Score: 58.151 bits (139), Expect = 1.890e-8
Identity = 42/119 (35.29%), Postives = 62/119 (52.10%), Query Frame = 3
Query: 5523 LKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQISVYG--SNQL------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLD 5852
            L +IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +IS     S Q+        +   +S+   N     + P   L RLK LR+  GLD
Sbjct:   72 LAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGE--EVGPSVYLERLKILRQRCGLD 188          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Celegans
Match: zyg-9 (Zygote defective protein 9 [Source:UniProtKB/Swiss-Prot;Acc:G5EEM5])

HSP 1 Score: 185.267 bits (469), Expect = 1.321e-46
Identity = 162/523 (30.98%), Postives = 241/523 (46.08%), Query Frame = 3
Query:  123 EHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVE-----------------------IERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVP---MKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLS-----QIKPVQVTEL----NAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALE-IIEKLTNNPKLVP-GEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKM--DNVKLARINEFYEKA 1574
            E K W+ R E  E  LK                  L  N  + + A   E    + ++  ++AN+  +A    C G   K     R K    A  +L VI E                       ++  +   E+++  L+   P++   +   +   L    P   P   +K +     KL  D D++VREA  + +  + R IG   +  +L      + K  ++ E      A F +  Q K  P     S  P  SA      GG A    S G       + DP+D +D  +V+SK+P  +   IE KKW +RK+ALE +++ +T NPKL P   YG L++ L KVL KD NI + AL+A  I  IA GLR KF P+AV+      EKFKEKK  +   L  CID+   TT+++A  E +L AL    PS+K++T LFL R F K + +    K LK +IP L     DS  EVR+A++  +G  M+ + EK     L  +  DN+K+++I EF++KA
Sbjct:   25 ESKKWQERKEALEALLKV-----------------LTDNERLSTKASYAELIGHLQMVLAKDANINCQALAAKCIG---KFATGLRAKFSSFAGPLLPVIFEKMKEKKPMLREPLVDCSNEVGRTMQSLETGQEDILAALAKPNPQIKQQTALFVARQLDLVVPAKQPKGFIKAVVPVFGKLTGDADQDVREASLQGLGAVQRIIGDKNVKNLLGDASSDEGKMKKIGEYAEKSTASFAE-EQAKNAPPVAPTSSTPSASAASGDPSGGTATAVVSSGAPV---AEADPWDFLDAFDVLSKMPDGFDTNIESKKWQERKEALEGLLQLITANPKLDPKANYGALVERLQKVLEKDANINVAALAANCITGIANGLRTKFQPFAVSVTPIIFEKFKEKKPTLRDPLVACIDAVVATTNLEAVGEIVLAALGKPNPSIKTQTDLFLQRCFMKLNSQTMPKKTLKTLIPSLIKHSGDSDSEVREASYAAMGAMMRAIGEKPSLQLLADIASDNLKMSKIKEFHQKA 523          

HSP 2 Score: 149.058 bits (375), Expect = 1.942e-35
Identity = 160/553 (28.93%), Postives = 265/553 (47.92%), Query Frame = 3
Query: 3495 LLAKNSNKKQRIQEDRKKKVTKWETSLASSQ---QLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSG-KPVXXXXXXXXXXXXXXXXXQKPS----RQRENSATREQPKPQISQ----------LPPKTIDINPLLKEEIGYKLINVD-KEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEIT---DMFKGMLATLVSIFNAKELAVELNR--DRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLK 5081
            LL+ N +KKQRI+E+++ K+ KW     + +   QL +         L   LF  D K+ + A   L+S +   D  S  +   N DL+LKW  +RF ETNP+ L K L+ LC+V   L  D+   + + EV+ F+P L++K G+ KD +R   + I+ ++S     LK+   L + L +K AR R EC   ++Y I +  I      ++ K+VA  + ++D NVR AA+N LV+   F G+ + K    + DKD+S++ ERIKR+G KP S    S           Q+      R    S TRE P+P+  Q          +PPKT     L  +     +  +D  +V    QP+   +     M        R+ S  +  S++++D I   I+ I+S+    +  AM Q+  V+ NQ  +  LV    +LV   +    A L  + EE  +  +++   D    ML  L+     +     LN   D +  ++ S+LR +I  Q+ +   G  + R +N L++R++     + +L  L+  M++ L+
Sbjct:  605 LLSDNEDKKQRIKEEKQLKLVKWNFQAPTDEHISQLQTLLGNQAKVSLMSQLFHKDFKQHLAA---LDSLVRLADT-SPRSLLSNSDLLLKWCTLRFFETNPAALIKVLE-LCKVIVELIRDTETPMSQEEVSAFVPYLLLKTGEAKDNMRTSVRDIVNVLSDVVGPLKMTPMLLDALKSKNARQRSECLLVIEYYITNAGISPLKSLSVEKTVAPFVGDKDVNVRNAAINVLVACFKFEGDQMWKAAGRMADKDKSLVEERIKRTGVKPGSGVVTSPPTGGPKILVPQQQGSVVRRPASRSRTRE-PEPEEVQSDTFTIRQDTMPPKTSSRYALRDDVFSSAMGRLDGTQVITPPQPVNGWSNNTFQMK-------RTNSSSSISSIDTSDQIQRSINNISSSLADVAQDAMFQVTYVL-NQPEQRHLVDRRADLVFRAS---AAQLDLVIEEFNAGRDVSGTMDACTQMLFILMGGVETEHGLEPLNASPDTVKAIISSVLRCII--QIGNTESGYGMARSLNRLAMRLIYRVELSNLLCGLILAMTESLQ 1138          

HSP 3 Score: 133.65 bits (335), Expect = 8.202e-31
Identity = 84/235 (35.74%), Postives = 131/235 (55.74%), Query Frame = 3
Query:  885 YDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKL-VPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTT-SIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKM--DNVKLARINEFYEKA 1574
            +D +D V+++ K+P N+ +  E KKW +RK+ALE + K LT+N +L     Y +L+  L  VL+KD NI   AL+AK I + ATGLR KFS +A   +    EK KEKK  + + L DC +    T  S++   E++L AL    P +K +TALF+ R  +           +K ++P    L  D+  +VR+A+ Q LG   +++ +K +K  L     D  K+ +I E+ EK+
Sbjct:    4 WDYLDEVDILPKLPPNFDELRESKKWQERKEALEALLKVLTDNERLSTKASYAELIGHLQMVLAKDANINCQALAAKCIGKFATGLRAKFSSFAGPLLPVIFEKMKEKKPMLREPLVDCSNEVGRTMQSLETGQEDILAALAKPNPQIKQQTALFVARQLDLVVPAKQPKGFIKAVVPVFGKLTGDADQDVREASLQGLGAVQRIIGDKNVKNLLGDASSDEGKMKKIGEYAEKS 238          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Celegans
Match: F54A3.2 (pep chromosome:WBcel235:II:2243642:2254323:1 gene:WBGene00018781.1 transcript:F54A3.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F54A3.2)

HSP 1 Score: 102.449 bits (254), Expect = 1.885e-21
Identity = 100/365 (27.40%), Postives = 174/365 (47.67%), Query Frame = 3
Query:  531 RDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQ-EKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVD----------IDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLV--PGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTE---KKL--KPYLDKMDNVKLARINEFYEK 1571
            R   P I  +K +   + K   + D  VR+   + +  + R IG T    + + I P+  TE  A+ EK+ Q ++     + K Q+       +P  GGD   + S     +N  +          +D ++L++P +   KI  +   Q+ +K W +R    E ++K   N   +       ++ K L+K++ KD N+ + A+SA+I+ +IA   R  F+P A+       +K K+KK  +  AL +  D A  TT + A  E ++ AL++K P  + +TALFL+R F K+  +    + +KQ+   +     D+  EVR+AA + +    K + E   K+L  + Y DK+   KL  + E  EK
Sbjct:  168 RQCTPDIQFIKTIAPLIVKASSESDVTVRDKACQALGSIKRLIGDT----ITAFIGPIS-TE-TAKIEKINQYQQEAAEEFKKFQE------TQPKAGGDGGAENSAENLDENQENSPEKAEKPQVLDAWELLEPEDCSKKIDKSVETQLIDKNWKERLAGAENVKKSMENAGRIEISERLTEISKLLMKIVEKDVNVNVGAISAQILAEIAKKSRFSFAPLALRAFPVVFDKLKDKKAILRDALVEFCDEAANTTPLSAYSEAVITALSNKNPQARQQTALFLSRFFAKNDPKTVETEAVKQLAEHILKTSNDADKEVREAALRIVAAVQKCLGEGVAKRLLAEVYDDKLKAEKLPPLIEELEK 520          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Celegans
Match: T08D2.8 (pep chromosome:WBcel235:X:192834:197901:1 gene:WBGene00011613.1 transcript:T08D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08D2.8)

HSP 1 Score: 75.8702 bits (185), Expect = 9.441e-14
Identity = 65/213 (30.52%), Postives = 108/213 (50.70%), Query Frame = 3
Query:  981 LEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTE---KKL--KPYLDKMDNVKLARINEFYEKAKQASEATIVL 1604
            +EI E+LT           ++ K L+K++ KD N+ + A+SA+I+ +IA   R  FS  A+       +K K+K   +  AL +  D A  TT + A  E     L++K P  + +TALFL+R F K+  ++   + +KQ+   +     D+  EVR AA + +    K + E   K+L  + Y DK+   KL  + E  EK  ++S +  +L
Sbjct:    7 IEISERLT-----------EISKILMKIVEKDVNVNVGAISAQILAEIAKKSRFSFSALALRAFPVVFDKLKDKNAILRDALVEFCDEAANTTPLSAYSEA---GLSNKNPQARQQTALFLSRFFAKNDPKIVETEEVKQLAEHILKTSNDADKEVRKAALRIVAAVQKCLGEGVAKRLLAEVYHDKLKTEKLPPLIEELEKEFESSASPEML 205          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Match: msps (gene:FBgn0027948 transcript:FBtr0304802)

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 510/1431 (35.64%), Postives = 801/1431 (55.97%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSA-------------VVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIP--TESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKN-QVPSDIPCQLIIRLIL-MKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNET-PVVENATDSEVVATHAVPE---LNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-PEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQL-----NSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRS 4283
            MAE  ++K L   ++  HK WKARV+GYEEA K  +  D  K P ++ + GL+K MV+DSNA+AQEK LE  L+FV+ + +A +   D+  GIV KC  + + KT+EL+ ++  + VEIE+Q+ V+EEL+KG+  K PK+V   +      LR+FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   + + LEKFKEKK NVV ALR+ ID+ + +TS++A  E ++ +L++K PSVKSETALF+ R   ++       KLLK +   L     +  P VRD++ + LGT +K++ +K + P L  +D +K+A+I E  EKA+   +  +  P+K                      ++P    + A    +    KPA       +  P AA K    P  TE  ++ +++  K+ +I     L  +VD NWK R AA E L   +           Q++IR I   KPGLK+ N QVLK K+++I+ +  N  +T TT ++ I ++ EK+ D KN       L+  ++   L  V  +V+  A E  + K   EA NW++ +I +FGF++    L+  +R  VQ TNP VR S I++ GT+S+Y+ + +      EKP++K  I  E +      PP P RG++  +     N+ D+E     A  E   +N+ D++PR +I  +IT+ LL ++SDK  K + E L  +  IIS  A +    +  L  A+     DS+  I++  + +   L  A        +++ + P  L +  D K   R  A+  +N + EK G+    +   + +ALK  +P  K+ ++AW++  L  L     PK +   D  S ++PHL++ I +R+ DVRK + EAVL  M+  G+D M +      K + K  I+  L+KA+  LPV P P    Q P       K      A        +   +    +  ++P +     D+D     LL  NS K QR+ +++K KV KW T +   ++      +   +A+ +  L   +F  D +  +K IE     LSED   + +A   NLDLILKW+ +RF +TNPSVL KGL+YL +VF +L +D  + L E+E + F+P L++K+GDPKD VR   +++L+ +   +  +K+  ++ E L +K AR R EC D L +LI+   +++  Q + ++ +A  IS+RDN+VR AALNC+V      GE   K++  L++KD SML ERIKR+
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAE--IKIKVAGPKKETRPASAPTAKAAAPAKTVAGSVDPKPVTRPATTGARKVLKKPATVSGGGATSAPTAALKAGGKPLATEREITPEELQEKSEEILPAEILNGLVDSNWKNRLAAVEQLLGEISGFDAKQAGISQILIRTISGRKPGLKEMNFQVLKFKLDIIRSVAENYPLTTTTVDLVINEIIEKLADAKNGAAAADVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQPKTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGKALMMFFDSEKPALKSQIQVEFDKNVGEKPPKPVRGVQRSSGGTAGNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIIS-EARLIKPSIGDLAPALAHRLVDSNAKIAQTTLAICEQLATAMG-AGCRNHVRNLFPGFLHALGDNKSFVRAAALNCINSFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLP----PKSVSKEDIHS-MVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRAL-DKQKPASKKDILAALEKARPNLPVKPLPKGKHQAPIPEEPKLKTVRGGGAGGAPGIQKSATARVAGGQDKQVPARKK---DEDIDTSPLLCANSAKNQRLLDEQKMKVLKW-TFVTPREEFTELLRDQMMTANVNKALIANMFHDDFRYHLKVIEQ----LSEDLAGNSKALVCNLDLILKWLTLRFYDTNPSVLIKGLEYLVQVFQVL-IDEEYILAENEGSSFVPHLLLKIGDPKDAVRNGVRRVLRQVILVFPFVKVFGYVMEGLKSKNARQRTECLDELTFLIESYGMNICPQ-SAVREIARQISDRDNSVRNAALNCIVQVFFLSGEKTYKMIGHLNEKDLSMLDERIKRA 1407          

HSP 2 Score: 107.842 bits (268), Expect = 8.973e-23
Identity = 97/398 (24.37%), Postives = 185/398 (46.48%), Query Frame = 3
Query: 4617 ITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVV-KSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLN-------NSGAAASLDKDNLAY 5786
            +  VI  ++S +   +  A+ ++  +I   + +  L  Y +  + ++  Q K     LS+   ++S +  +++ +L+ L + F+A  L   L+   + NLM ++L ++ + +L ++ +     + IN + +++L+  + T +  AL+R++ +         K+ +L+ KCIW   K L    + ++   +  ++  F    P   W+ R S  D P+RT+KT+++++   KG   L+ L QI    + +L TY+ +           +L N     +   I  +  + K +  K  +    + +  IF  I   +  +QGL  LYDFK + P +DLS +L  ++  F + IE GL  I  ER Q      GS Q N       N+G       D L Y
Sbjct: 1633 LVKVIKGVSSTDTLKARAAINELAAIIEAPEKQAVLRDYEEIFIQNVLAQFK----NLSQIPSAQSVV--VYQPLLSILYTFFHANILGKTLSVACIKNLMSALLNLMADPKL-AVGDDSQYNKVINGICLKVLDKVDFTNLNCALIRLLRETCPEAKL-PKFTDLLMKCIWRNVKMLPERSNELNYDAVILEVHEFMLALPSTWWQNRPS--DTPMRTIKTILHNMAKVKGNAILQHLNQIPT--HSELHTYLIR-----------ILKNFQKDGSASGIGASPQRAKEIASKRISHQTHDTVSQIFKLISDRDTKQQGLQKLYDFKQQNPDIDLSTFLQGSSAPFHKYIEEGLAEI--ERNQNA----GSTQDNRTDVNYQNNGPDPDFWMDRLQY 2001          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Match: msps (gene:FBgn0027948 transcript:FBtr0304801)

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 510/1431 (35.64%), Postives = 801/1431 (55.97%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSA-------------VVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIP--TESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKN-QVPSDIPCQLIIRLIL-MKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNET-PVVENATDSEVVATHAVPE---LNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-PEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQL-----NSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRS 4283
            MAE  ++K L   ++  HK WKARV+GYEEA K  +  D  K P ++ + GL+K MV+DSNA+AQEK LE  L+FV+ + +A +   D+  GIV KC  + + KT+EL+ ++  + VEIE+Q+ V+EEL+KG+  K PK+V   +      LR+FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   + + LEKFKEKK NVV ALR+ ID+ + +TS++A  E ++ +L++K PSVKSETALF+ R   ++       KLLK +   L     +  P VRD++ + LGT +K++ +K + P L  +D +K+A+I E  EKA+   +  +  P+K                      ++P    + A    +    KPA       +  P AA K    P  TE  ++ +++  K+ +I     L  +VD NWK R AA E L   +           Q++IR I   KPGLK+ N QVLK K+++I+ +  N  +T TT ++ I ++ EK+ D KN       L+  ++   L  V  +V+  A E  + K   EA NW++ +I +FGF++    L+  +R  VQ TNP VR S I++ GT+S+Y+ + +      EKP++K  I  E +      PP P RG++  +     N+ D+E     A  E   +N+ D++PR +I  +IT+ LL ++SDK  K + E L  +  IIS  A +    +  L  A+     DS+  I++  + +   L  A        +++ + P  L +  D K   R  A+  +N + EK G+    +   + +ALK  +P  K+ ++AW++  L  L     PK +   D  S ++PHL++ I +R+ DVRK + EAVL  M+  G+D M +      K + K  I+  L+KA+  LPV P P    Q P       K      A        +   +    +  ++P +     D+D     LL  NS K QR+ +++K KV KW T +   ++      +   +A+ +  L   +F  D +  +K IE     LSED   + +A   NLDLILKW+ +RF +TNPSVL KGL+YL +VF +L +D  + L E+E + F+P L++K+GDPKD VR   +++L+ +   +  +K+  ++ E L +K AR R EC D L +LI+   +++  Q + ++ +A  IS+RDN+VR AALNC+V      GE   K++  L++KD SML ERIKR+
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAE--IKIKVAGPKKETRPASAPTAKAAAPAKTVAGSVDPKPVTRPATTGARKVLKKPATVSGGGATSAPTAALKAGGKPLATEREITPEELQEKSEEILPAEILNGLVDSNWKNRLAAVEQLLGEISGFDAKQAGISQILIRTISGRKPGLKEMNFQVLKFKLDIIRSVAENYPLTTTTVDLVINEIIEKLADAKNGAAAADVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQPKTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGKALMMFFDSEKPALKSQIQVEFDKNVGEKPPKPVRGVQRSSGGTAGNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIIS-EARLIKPSIGDLAPALAHRLVDSNAKIAQTTLAICEQLATAMG-AGCRNHVRNLFPGFLHALGDNKSFVRAAALNCINSFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLP----PKSVSKEDIHS-MVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRAL-DKQKPASKKDILAALEKARPNLPVKPLPKGKHQAPIPEEPKLKTVRGGGAGGAPGIQKSATARVAGGQDKQVPARKK---DEDIDTSPLLCANSAKNQRLLDEQKMKVLKW-TFVTPREEFTELLRDQMMTANVNKALIANMFHDDFRYHLKVIEQ----LSEDLAGNSKALVCNLDLILKWLTLRFYDTNPSVLIKGLEYLVQVFQVL-IDEEYILAENEGSSFVPHLLLKIGDPKDAVRNGVRRVLRQVILVFPFVKVFGYVMEGLKSKNARQRTECLDELTFLIESYGMNICPQ-SAVREIARQISDRDNSVRNAALNCIVQVFFLSGEKTYKMIGHLNEKDLSMLDERIKRA 1407          

HSP 2 Score: 112.079 bits (279), Expect = 4.525e-24
Identity = 100/405 (24.69%), Postives = 191/405 (47.16%), Query Frame = 3
Query: 4617 ITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVV-KSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKD-NLAYCNMDPESLLLRLK 5825
            +  VI  ++S +   +  A+ ++  +I   + +  L  Y +  + ++  Q K     LS+   ++S +  +++ +L+ L + F+A  L   L+   + NLM ++L ++ + +L ++ +     + IN + +++L+  + T +  AL+R++ +         K+ +L+ KCIW   K L    + ++   +  ++  F    P   W+ R S  D P+RT+KT+++++   KG   L+ L QI    + +L TY+ +           +L N     +   I  +  + K +  K  +    + +  IF  I   +  +QGL  LYDFK + P +DLS +L  ++  F + IE GL  I  ER Q      GS Q N + A  S   D N      DP+  + RL+
Sbjct: 1633 LVKVIKGVSSTDTLKARAAINELAAIIEAPEKQAVLRDYEEIFIQNVLAQFK----NLSQIPSAQSVV--VYQPLLSILYTFFHANILGKTLSVACIKNLMSALLNLMADPKL-AVGDDSQYNKVINGICLKVLDKVDFTNLNCALIRLLRETCPEAKL-PKFTDLLMKCIWRNVKMLPERSNELNYDAVILEVHEFMLALPSTWWQNRPS--DTPMRTIKTILHNMAKVKGNAILQHLNQIPT--HSELHTYLIR-----------ILKNFQKDGSASGIGASPQRAKEIASKRISHQTHDTVSQIFKLISDRDTKQQGLQKLYDFKQQNPDIDLSTFLQGSSAPFHKYIEEGLAEI--ERNQNA----GSTQDNRTAATRSYLTDVNYQNNGPDPDFWMDRLQ 2008          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Match: msps (gene:FBgn0027948 transcript:FBtr0304803)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 510/1431 (35.64%), Postives = 801/1431 (55.97%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSA-------------VVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIP--TESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKN-QVPSDIPCQLIIRLIL-MKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNET-PVVENATDSEVVATHAVPE---LNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-PEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQL-----NSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRS 4283
            MAE  ++K L   ++  HK WKARV+GYEEA K  +  D  K P ++ + GL+K MV+DSNA+AQEK LE  L+FV+ + +A +   D+  GIV KC  + + KT+EL+ ++  + VEIE+Q+ V+EEL+KG+  K PK+V   +      LR+FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   + + LEKFKEKK NVV ALR+ ID+ + +TS++A  E ++ +L++K PSVKSETALF+ R   ++       KLLK +   L     +  P VRD++ + LGT +K++ +K + P L  +D +K+A+I E  EKA+   +  +  P+K                      ++P    + A    +    KPA       +  P AA K    P  TE  ++ +++  K+ +I     L  +VD NWK R AA E L   +           Q++IR I   KPGLK+ N QVLK K+++I+ +  N  +T TT ++ I ++ EK+ D KN       L+  ++   L  V  +V+  A E  + K   EA NW++ +I +FGF++    L+  +R  VQ TNP VR S I++ GT+S+Y+ + +      EKP++K  I  E +      PP P RG++  +     N+ D+E     A  E   +N+ D++PR +I  +IT+ LL ++SDK  K + E L  +  IIS  A +    +  L  A+     DS+  I++  + +   L  A        +++ + P  L +  D K   R  A+  +N + EK G+    +   + +ALK  +P  K+ ++AW++  L  L     PK +   D  S ++PHL++ I +R+ DVRK + EAVL  M+  G+D M +      K + K  I+  L+KA+  LPV P P    Q P       K      A        +   +    +  ++P +     D+D     LL  NS K QR+ +++K KV KW T +   ++      +   +A+ +  L   +F  D +  +K IE     LSED   + +A   NLDLILKW+ +RF +TNPSVL KGL+YL +VF +L +D  + L E+E + F+P L++K+GDPKD VR   +++L+ +   +  +K+  ++ E L +K AR R EC D L +LI+   +++  Q + ++ +A  IS+RDN+VR AALNC+V      GE   K++  L++KD SML ERIKR+
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAE--IKIKVAGPKKETRPASAPTAKAAAPAKTVAGSVDPKPVTRPATTGARKVLKKPATVSGGGATSAPTAALKAGGKPLATEREITPEELQEKSEEILPAEILNGLVDSNWKNRLAAVEQLLGEISGFDAKQAGISQILIRTISGRKPGLKEMNFQVLKFKLDIIRSVAENYPLTTTTVDLVINEIIEKLADAKNGAAAADVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQPKTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGKALMMFFDSEKPALKSQIQVEFDKNVGEKPPKPVRGVQRSSGGTAGNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIIS-EARLIKPSIGDLAPALAHRLVDSNAKIAQTTLAICEQLATAMG-AGCRNHVRNLFPGFLHALGDNKSFVRAAALNCINSFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLP----PKSVSKEDIHS-MVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRAL-DKQKPASKKDILAALEKARPNLPVKPLPKGKHQAPIPEEPKLKTVRGGGAGGAPGIQKSATARVAGGQDKQVPARKK---DEDIDTSPLLCANSAKNQRLLDEQKMKVLKW-TFVTPREEFTELLRDQMMTANVNKALIANMFHDDFRYHLKVIEQ----LSEDLAGNSKALVCNLDLILKWLTLRFYDTNPSVLIKGLEYLVQVFQVL-IDEEYILAENEGSSFVPHLLLKIGDPKDAVRNGVRRVLRQVILVFPFVKVFGYVMEGLKSKNARQRTECLDELTFLIESYGMNICPQ-SAVREIARQISDRDNSVRNAALNCIVQVFFLSGEKTYKMIGHLNEKDLSMLDERIKRA 1407          

HSP 2 Score: 112.464 bits (280), Expect = 3.903e-24
Identity = 100/405 (24.69%), Postives = 191/405 (47.16%), Query Frame = 3
Query: 4617 ITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVV-KSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKD-NLAYCNMDPESLLLRLK 5825
            +  VI  ++S +   +  A+ ++  +I   + +  L  Y +  + ++  Q K     LS+   ++S +  +++ +L+ L + F+A  L   L+   + NLM ++L ++ + +L ++ +     + IN + +++L+  + T +  AL+R++ +         K+ +L+ KCIW   K L    + ++   +  ++  F    P   W+ R S  D P+RT+KT+++++   KG   L+ L QI    + +L TY+ +           +L N     +   I  +  + K +  K  +    + +  IF  I   +  +QGL  LYDFK + P +DLS +L  ++  F + IE GL  I  ER Q      GS Q N + A  S   D N      DP+  + RL+
Sbjct: 1601 LVKVIKGVSSTDTLKARAAINELAAIIEAPEKQAVLRDYEEIFIQNVLAQFK----NLSQIPSAQSVV--VYQPLLSILYTFFHANILGKTLSVACIKNLMSALLNLMADPKL-AVGDDSQYNKVINGICLKVLDKVDFTNLNCALIRLLRETCPEAKL-PKFTDLLMKCIWRNVKMLPERSNELNYDAVILEVHEFMLALPSTWWQNRPS--DTPMRTIKTILHNMAKVKGNAILQHLNQIPT--HSELHTYLIR-----------ILKNFQKDGSASGIGASPQRAKEIASKRISHQTHDTVSQIFKLISDRDTKQQGLQKLYDFKQQNPDIDLSTFLQGSSAPFHKYIEEGLAEI--ERNQNA----GSTQDNRTAATRSYLTDVNYQNNGPDPDFWMDRLQ 1976          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Match: msps (gene:FBgn0027948 transcript:FBtr0301479)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 510/1431 (35.64%), Postives = 801/1431 (55.97%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSA-------------VVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIP--TESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKN-QVPSDIPCQLIIRLIL-MKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNET-PVVENATDSEVVATHAVPE---LNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-PEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQL-----NSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRS 4283
            MAE  ++K L   ++  HK WKARV+GYEEA K  +  D  K P ++ + GL+K MV+DSNA+AQEK LE  L+FV+ + +A +   D+  GIV KC  + + KT+EL+ ++  + VEIE+Q+ V+EEL+KG+  K PK+V   +      LR+FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   + + LEKFKEKK NVV ALR+ ID+ + +TS++A  E ++ +L++K PSVKSETALF+ R   ++       KLLK +   L     +  P VRD++ + LGT +K++ +K + P L  +D +K+A+I E  EKA+   +  +  P+K                      ++P    + A    +    KPA       +  P AA K    P  TE  ++ +++  K+ +I     L  +VD NWK R AA E L   +           Q++IR I   KPGLK+ N QVLK K+++I+ +  N  +T TT ++ I ++ EK+ D KN       L+  ++   L  V  +V+  A E  + K   EA NW++ +I +FGF++    L+  +R  VQ TNP VR S I++ GT+S+Y+ + +      EKP++K  I  E +      PP P RG++  +     N+ D+E     A  E   +N+ D++PR +I  +IT+ LL ++SDK  K + E L  +  IIS  A +    +  L  A+     DS+  I++  + +   L  A        +++ + P  L +  D K   R  A+  +N + EK G+    +   + +ALK  +P  K+ ++AW++  L  L     PK +   D  S ++PHL++ I +R+ DVRK + EAVL  M+  G+D M +      K + K  I+  L+KA+  LPV P P    Q P       K      A        +   +    +  ++P +     D+D     LL  NS K QR+ +++K KV KW T +   ++      +   +A+ +  L   +F  D +  +K IE     LSED   + +A   NLDLILKW+ +RF +TNPSVL KGL+YL +VF +L +D  + L E+E + F+P L++K+GDPKD VR   +++L+ +   +  +K+  ++ E L +K AR R EC D L +LI+   +++  Q + ++ +A  IS+RDN+VR AALNC+V      GE   K++  L++KD SML ERIKR+
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAE--IKIKVAGPKKETRPASAPTAKAAAPAKTVAGSVDPKPVTRPATTGARKVLKKPATVSGGGATSAPTAALKAGGKPLATEREITPEELQEKSEEILPAEILNGLVDSNWKNRLAAVEQLLGEISGFDAKQAGISQILIRTISGRKPGLKEMNFQVLKFKLDIIRSVAENYPLTTTTVDLVINEIIEKLADAKNGAAAADVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQPKTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGKALMMFFDSEKPALKSQIQVEFDKNVGEKPPKPVRGVQRSSGGTAGNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIIS-EARLIKPSIGDLAPALAHRLVDSNAKIAQTTLAICEQLATAMG-AGCRNHVRNLFPGFLHALGDNKSFVRAAALNCINSFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLP----PKSVSKEDIHS-MVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRAL-DKQKPASKKDILAALEKARPNLPVKPLPKGKHQAPIPEEPKLKTVRGGGAGGAPGIQKSATARVAGGQDKQVPARKK---DEDIDTSPLLCANSAKNQRLLDEQKMKVLKW-TFVTPREEFTELLRDQMMTANVNKALIANMFHDDFRYHLKVIEQ----LSEDLAGNSKALVCNLDLILKWLTLRFYDTNPSVLIKGLEYLVQVFQVL-IDEEYILAENEGSSFVPHLLLKIGDPKDAVRNGVRRVLRQVILVFPFVKVFGYVMEGLKSKNARQRTECLDELTFLIESYGMNICPQ-SAVREIARQISDRDNSVRNAALNCIVQVFFLSGEKTYKMIGHLNEKDLSMLDERIKRA 1407          

HSP 2 Score: 112.464 bits (280), Expect = 3.903e-24
Identity = 100/405 (24.69%), Postives = 191/405 (47.16%), Query Frame = 3
Query: 4617 ITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVV-KSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKD-NLAYCNMDPESLLLRLK 5825
            +  VI  ++S +   +  A+ ++  +I   + +  L  Y +  + ++  Q K     LS+   ++S +  +++ +L+ L + F+A  L   L+   + NLM ++L ++ + +L ++ +     + IN + +++L+  + T +  AL+R++ +         K+ +L+ KCIW   K L    + ++   +  ++  F    P   W+ R S  D P+RT+KT+++++   KG   L+ L QI    + +L TY+ +           +L N     +   I  +  + K +  K  +    + +  IF  I   +  +QGL  LYDFK + P +DLS +L  ++  F + IE GL  I  ER Q      GS Q N + A  S   D N      DP+  + RL+
Sbjct: 1601 LVKVIKGVSSTDTLKARAAINELAAIIEAPEKQAVLRDYEEIFIQNVLAQFK----NLSQIPSAQSVV--VYQPLLSILYTFFHANILGKTLSVACIKNLMSALLNLMADPKL-AVGDDSQYNKVINGICLKVLDKVDFTNLNCALIRLLRETCPEAKL-PKFTDLLMKCIWRNVKMLPERSNELNYDAVILEVHEFMLALPSTWWQNRPS--DTPMRTIKTILHNMAKVKGNAILQHLNQIPT--HSELHTYLIR-----------ILKNFQKDGSASGIGASPQRAKEIASKRISHQTHDTVSQIFKLISDRDTKQQGLQKLYDFKQQNPDIDLSTFLQGSSAPFHKYIEEGLAEI--ERNQNA----GSTQDNRTAATRSYLTDVNYQNNGPDPDFWMDRLQ 1976          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Match: msps (gene:FBgn0027948 transcript:FBtr0301480)

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 510/1431 (35.64%), Postives = 801/1431 (55.97%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSA-------------VVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIP--TESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKN-QVPSDIPCQLIIRLIL-MKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNET-PVVENATDSEVVATHAVPE---LNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-PEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQL-----NSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRS 4283
            MAE  ++K L   ++  HK WKARV+GYEEA K  +  D  K P ++ + GL+K MV+DSNA+AQEK LE  L+FV+ + +A +   D+  GIV KC  + + KT+EL+ ++  + VEIE+Q+ V+EEL+KG+  K PK+V   +      LR+FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   + + LEKFKEKK NVV ALR+ ID+ + +TS++A  E ++ +L++K PSVKSETALF+ R   ++       KLLK +   L     +  P VRD++ + LGT +K++ +K + P L  +D +K+A+I E  EKA+   +  +  P+K                      ++P    + A    +    KPA       +  P AA K    P  TE  ++ +++  K+ +I     L  +VD NWK R AA E L   +           Q++IR I   KPGLK+ N QVLK K+++I+ +  N  +T TT ++ I ++ EK+ D KN       L+  ++   L  V  +V+  A E  + K   EA NW++ +I +FGF++    L+  +R  VQ TNP VR S I++ GT+S+Y+ + +      EKP++K  I  E +      PP P RG++  +     N+ D+E     A  E   +N+ D++PR +I  +IT+ LL ++SDK  K + E L  +  IIS  A +    +  L  A+     DS+  I++  + +   L  A        +++ + P  L +  D K   R  A+  +N + EK G+    +   + +ALK  +P  K+ ++AW++  L  L     PK +   D  S ++PHL++ I +R+ DVRK + EAVL  M+  G+D M +      K + K  I+  L+KA+  LPV P P    Q P       K      A        +   +    +  ++P +     D+D     LL  NS K QR+ +++K KV KW T +   ++      +   +A+ +  L   +F  D +  +K IE     LSED   + +A   NLDLILKW+ +RF +TNPSVL KGL+YL +VF +L +D  + L E+E + F+P L++K+GDPKD VR   +++L+ +   +  +K+  ++ E L +K AR R EC D L +LI+   +++  Q + ++ +A  IS+RDN+VR AALNC+V      GE   K++  L++KD SML ERIKR+
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAE--IKIKVAGPKKETRPASAPTAKAAAPAKTVAGSVDPKPVTRPATTGARKVLKKPATVSGGGATSAPTAALKAGGKPLATEREITPEELQEKSEEILPAEILNGLVDSNWKNRLAAVEQLLGEISGFDAKQAGISQILIRTISGRKPGLKEMNFQVLKFKLDIIRSVAENYPLTTTTVDLVINEIIEKLADAKNGAAAADVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQPKTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGKALMMFFDSEKPALKSQIQVEFDKNVGEKPPKPVRGVQRSSGGTAGNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIIS-EARLIKPSIGDLAPALAHRLVDSNAKIAQTTLAICEQLATAMG-AGCRNHVRNLFPGFLHALGDNKSFVRAAALNCINSFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLP----PKSVSKEDIHS-MVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRAL-DKQKPASKKDILAALEKARPNLPVKPLPKGKHQAPIPEEPKLKTVRGGGAGGAPGIQKSATARVAGGQDKQVPARKK---DEDIDTSPLLCANSAKNQRLLDEQKMKVLKW-TFVTPREEFTELLRDQMMTANVNKALIANMFHDDFRYHLKVIEQ----LSEDLAGNSKALVCNLDLILKWLTLRFYDTNPSVLIKGLEYLVQVFQVL-IDEEYILAENEGSSFVPHLLLKIGDPKDAVRNGVRRVLRQVILVFPFVKVFGYVMEGLKSKNARQRTECLDELTFLIESYGMNICPQ-SAVREIARQISDRDNSVRNAALNCIVQVFFLSGEKTYKMIGHLNEKDLSMLDERIKRA 1407          

HSP 2 Score: 107.842 bits (268), Expect = 8.931e-23
Identity = 97/398 (24.37%), Postives = 185/398 (46.48%), Query Frame = 3
Query: 4617 ITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVV-KSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLN-------NSGAAASLDKDNLAY 5786
            +  VI  ++S +   +  A+ ++  +I   + +  L  Y +  + ++  Q K     LS+   ++S +  +++ +L+ L + F+A  L   L+   + NLM ++L ++ + +L ++ +     + IN + +++L+  + T +  AL+R++ +         K+ +L+ KCIW   K L    + ++   +  ++  F    P   W+ R S  D P+RT+KT+++++   KG   L+ L QI    + +L TY+ +           +L N     +   I  +  + K +  K  +    + +  IF  I   +  +QGL  LYDFK + P +DLS +L  ++  F + IE GL  I  ER Q      GS Q N       N+G       D L Y
Sbjct: 1601 LVKVIKGVSSTDTLKARAAINELAAIIEAPEKQAVLRDYEEIFIQNVLAQFK----NLSQIPSAQSVV--VYQPLLSILYTFFHANILGKTLSVACIKNLMSALLNLMADPKL-AVGDDSQYNKVINGICLKVLDKVDFTNLNCALIRLLRETCPEAKL-PKFTDLLMKCIWRNVKMLPERSNELNYDAVILEVHEFMLALPSTWWQNRPS--DTPMRTIKTILHNMAKVKGNAILQHLNQIPT--HSELHTYLIR-----------ILKNFQKDGSASGIGASPQRAKEIASKRISHQTHDTVSQIFKLISDRDTKQQGLQKLYDFKQQNPDIDLSTFLQGSSAPFHKYIEEGLAEI--ERNQNA----GSTQDNRTDVNYQNNGPDPDFWMDRLQY 1969          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Zebrafish
Match: ckap5 (cytoskeleton associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-051120-174])

HSP 1 Score: 960.288 bits (2481), Expect = 0.000e+0
Identity = 646/1994 (32.40%), Postives = 1042/1994 (52.26%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL-VKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK--QASEATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIP--TESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAEL---------------------------------PV-----PEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMP---NKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGN--QKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXX------XXXXQKPSRQ---------RENSATREQPKPQIS---QLPPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSN-DAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKD----IFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER---GQPQIS-VYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKS 5858
            K EHK WKAR+ GYEEALK  Q  D  K P ++ YLGL+K  V +SNAVAQ K LE  L F++ A+VA K   ++  G+VNK FN  + + +EL  EI  + +EIE+ +VV +ELIKGL  K PK+VV  I  L++ L +FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL   L  I  VQ+ EL  E+ K+P   P   R+L+SQ+  ++    +   GGD        +     V +D Y+L++ VE++SK+P ++Y++IE KKW +RK+ALE +E LT NPKL  G+YGDL+++L KV+ KD N++LV+++AK +  +ATGLRKKF  YA   +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K PS+K + +LFL R F   +       +LK           DS PEVRDAAF+ LGTAMKV+ EK + P+L  +D +KL +I E  +K +            ++     A  P+E P           PA++    KK    +     + K PE     E+ +S +    KA  +   + +  +   NWKER A+ E  Q  V+    S++PCQ +++++  KPG K+ N QV++ K+ ++  +   G+ + T+A + +  L +KIGD+K   N K  LT + +  +LP  A QV+  A    N KN  E LNWL++A+K+FGF  I +   +  ++ A+  TNPAVR S I L G + LY+   +    +DEKP++   ID E   ++  +PP PTRG K      +     E  A     ++   DM+PR +I+ KIT  +++++SDK  K++KE L +V  +IS +  I  + +  L +A+     DS+ ++ +  +N+L  +  A      +    + +P +++   D KP  R  A+  LN W E+ G    ++G  ++E LK +NP+ +  +  W+S  L  L    +P  L+        +PHL++ +E+RS DVRK +Q+A+  FM+  G+D M K      K + K  ++G LDKA+A +                                 PV     PEP P  +  K A                              +GK P     + ++ DK   +  L+   + K+QRI+E++  K+ KW          +QL +Q S   +  L   LF  D +  +KAI  +   +  +     EA    LDL+LKW  +RF +TN SV+ K L++L  +FT+L    ++QL ++E + FIP LI+K+G+ KD VR   + IL ++   Y   K+  +L +   +K ++ R EC + L  LI++  ++V        LK +A+ I +RD  VR AALN +V+A+N  G+ + K++ +L +K+ SML ERIKRS K   + +    +              +KP+++         R+ +A  EQ  P I    QL     + N     +I      V  +++E+L+P+         M P    K+ S S       NS    I  VI  + S ++ TSIQA+AQIDEV+R  D    +  ++D  +++  MQL+      +++++  + EI  ++  ++  ++S+F+ + LA E +   L +LM  ++ ++++ ++  + +G  +IR +N+L VR+LE S+QT +LSALL ++ D L +      +  L+ KC+W M + L  T++SI+L  I  D+  F   FP    + ++   DVP RT+KTL++++    G   L+ L  I      +LE ++R+                  S+N+  +       K  ++S+++    ++ D    IF KIG  E  K+GL +LY++K KY   DL  +L  T+ +FQ  +E GL+ I  ER   G+ Q S V   +   +   ++S    +    +++  +   RLK LR+  GL+ S
Sbjct:   15 KCEHKVWKARLSGYEEALKLFQKLDE-KSPEWSKYLGLIKKFVTESNAVAQLKGLEAALAFIENAHVAGKTVGEVVSGVVNKVFNQPKARAKELGTEICLMYIEIEKAEVVQDELIKGLDNKNPKIVVACIEALRKALCEFGSKIITLKPVVKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRAPLQNINSVQLKELEEEWVKVPATAPKQIRFLRSQQDLKAKFEQQQAAGGDEADGDD--EEVAEAVQVDAYELLEAVEILSKLPKDFYEKIEAKKWQERKEALEAVEALTKNPKLESGDYGDLVRALKKVIGKDANVMLVSMAAKCLAGLATGLRKKFGTYAGLVVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPSIKQQASLFLARSFRHCTPSTLPKSVLKPFCAAFLKQVNDSAPEVRDAAFEALGTAMKVIGEKAVNPFLTDVDKLKLDKIKECADKVELIGKKGGGGGEKKERPAAKASPPVEAPAKTSGPPKKSAPAKAAGPPKKGKPAAAPSAKSKKAPETKEIIETELSPEVCEEKAAAVLPASCMQLLDSANWKERLASMEEFQKAVEQMDKSEMPCQALVKMLAKKPGWKETNFQVMQMKLSIVGLVAQKGQFSKTSALVVLDGLVDKIGDVKCGGNAKEALTAIGEACSLPWTAEQVVSIAFAQKNPKNQAETLNWLANAMKEFGFAGINVKGFINNVKTALGATNPAVRTSAIALLGVMYLYMGAPLRMFFEDEKPALLSQIDAEFVKMQGQSPPAPTRGAKKAGAEEDGDVADEDEADGGAGDIM--DMLPRTDISDKITSEMVSKISDKNWKIRKEGLDEVAAVISEAKFIQAN-IGELPMALKGRLNDSNKLLVQQTLNILQQIAIAMGPSLKQHVKNLGIP-VVTVLGDSKPNVRATAMATLNAWVEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLSEKLPTL--RTVPADLML------CVPHLYTCLEDRSGDVRKKAQDALPTFMMHLGFDKMTKA-TGKLKPASKDQVVGMLDKARAVMPAKPAAPAKAAASKPASSAPAAKTASAPARNHSPVDDYSEPEPKPDTKKAKPAGPAA----------------------KKVVAGKKPPVKAGAKDEEDKSGPIFILVP--NGKEQRIKEEKSLKILKWNFITPRDEYVEQLKTQMSTCLAKWLQDELFHFDFQHHVKAIGAMIEHMEAES----EAVIGCLDLVLKWFTLRFFDTNTSVIMKTLEFLKMLFTMLS-RKNYQLNDYEASSFIPYLILKVGESKDVVRKDVRAILAMLCKVYAASKVFPYLMDGTKSKNSKQRSECLEELGCLIENFGMNVCQPTPAKALKEIAVHIGDRDTTVRNAALNTVVAAYNACGDQVFKLIGNLSEKEMSMLEERIKRSAKKTPAPSTKQERPQREHPTNPNATFLRKPAQEEVPNKLNQARQQNAHLEQSAPSIPKEFQLDLDVFENNHTCASDIPDL---VQHKLDEVLEPV---------MIPE--RKIHSVSPHFDDIHNSTASTINFVISQVASGDINTSIQALAQIDEVLRQADKAEAMSGHIDQFLIATFMQLRLIYNTHMADDRLDKKEIFKLYSCIIGNMLSLFSMESLAREASMGVLKDLMHGLITLMLDSRVEDIEDGQQLIRSVNLLMVRVLEKSDQTNILSALLVLLQDSLISTAGSPMFSELVMKCLWRMIRFLPQTINSINLDRILLDVHNFMKVFPKE--KLKQLKSDVPHRTLKTLLHTLCRLTGAKILDHLSMIENRNESELEAHLRRVV--------------KHSANLSGLKSDKGTEKGALRSDDKMIKAKVSDILSEIFKKIGSKENTKEGLTELYEYKQKYSDADLEPFLRNTSQFFQSYVERGLRMIESEREGKGRIQTSTVIAQHSTESFVPSSSSVPVSSNGEDLNAAAYYERLKILRQRRGLENS 1932          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Zebrafish
Match: ckap5 (cytoskeleton associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-051120-174])

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 390/1065 (36.62%), Postives = 603/1065 (56.62%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL-VKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK--QASEATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIP--TESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKA 3293
            K EHK WKAR+ GYEEALK  Q  D  K P ++ YLGL+K  V +SNAVAQ K LE  L F++ A+VA K   ++  G+VNK FN  + + +EL  EI  + +EIE+ +VV +ELIKGL  K PK+VV  I  L++ L +FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL   L  I  VQ+ EL  E+ K+P   P   R+L+SQ+  ++    +   GGD        +     V +D Y+L++ VE++SK+P ++Y++IE KKW +RK+ALE +E LT NPKL  G+YGDL+++L KV+ KD N++LV+++AK +  +ATGLRKKF  YA   +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K PS+K + +LFL R F   +       +LK           DS PEVRDAAF+ LGTAMKV+ EK + P+L  +D +KL +I E  +K +            ++     A  P+E P           PA++    KK    +     + K PE     E+ +S +    KA  +   + +  +   NWKER A+ E  Q  V+    S++PCQ +++++  KPG K+ N QV++ K+ ++  +   G+ + T+A + +  L +KIGD+K   N K  LT + +  +LP  A QV+  A    N KN  E LNWL++A+K+FGF  I +   +  ++ A+  TNPAVR S I L G + LY+   +    +DEKP++   ID E   ++  +PP PTRG K      +     E  A     ++   DM+PR +I+ KIT  +++++SDK  K++KE L +V  +IS +  I  + +  L +A+     DS+ ++ +  +N+L  +  A      +    + +P +++   D KP  R  A+  LN W E+ G    ++G  ++E LK +NP+ +  +  W+S  L  L    +P  L+        +PHL++ +E+RS DVRK +Q+A+  FM+  G+D M K      K + K  ++G LDKA+A
Sbjct:   15 KCEHKVWKARLSGYEEALKLFQKLDE-KSPEWSKYLGLIKKFVTESNAVAQLKGLEAALAFIENAHVAGKTVGEVVSGVVNKVFNQPKARAKELGTEICLMYIEIEKAEVVQDELIKGLDNKNPKIVVACIEALRKALCEFGSKIITLKPVVKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRAPLQNINSVQLKELEEEWVKVPATAPKQIRFLRSQQDLKAKFEQQQAAGGDEADGDD--EEVAEAVQVDAYELLEAVEILSKLPKDFYEKIEAKKWQERKEALEAVEALTKNPKLESGDYGDLVRALKKVIGKDANVMLVSMAAKCLAGLATGLRKKFGTYAGLVVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPSIKQQASLFLARSFRHCTPSTLPKSVLKPFCAAFLKQVNDSAPEVRDAAFEALGTAMKVIGEKAVNPFLTDVDKLKLDKIKECADKVELIGKKGGGGGEKKERPAAKASPPVEAPAKTSGPPKKSAPAKAAGPPKKGKPAAAPSAKSKKAPETKEIIETELSPEVCEEKAAAVLPASCMQLLDSANWKERLASMEEFQKAVEQMDKSEMPCQALVKMLAKKPGWKETNFQVMQMKLSIVGLVAQKGQFSKTSALVVLDGLVDKIGDVKCGGNAKEALTAIGEACSLPWTAEQVVSIAFAQKNPKNQAETLNWLANAMKEFGFAGINVKGFINNVKTALGATNPAVRTSAIALLGVMYLYMGAPLRMFFEDEKPALLSQIDAEFVKMQGQSPPAPTRGAKKAGAEEDGDVADEDEADGGAGDIM--DMLPRTDISDKITSEMVSKISDKNWKIRKEGLDEVAAVISEAKFIQAN-IGELPMALKGRLNDSNKLLVQQTLNILQQIAIAMGPSLKQHVKNLGIP-VVTVLGDSKPNVRATAMATLNAWVEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLSEKLPTL--RTVPADLML------CVPHLYTCLEDRSGDVRKKAQDALPTFMMHLGFDKMTKA-TGKLKPASKDQVVGMLDKARA 1062          

HSP 2 Score: 325.479 bits (833), Expect = 4.686e-89
Identity = 243/816 (29.78%), Postives = 417/816 (51.10%), Query Frame = 3
Query: 3510 SNKKQRIQEDRKKKVTKWETSLASSQ---QLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQ--KNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXX------XXXXQKPSRQ---------RENSATREQPKPQIS---QLPPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSN-DAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKD----IFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER---GQPQIS-VYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKS 5858
            + K+QRI+E++  K+ KW       +   QL +Q S   +  L   LF  D +  +KAI  +   +  +     EA    LDL+LKW  +RF +TN SV+ K L++L  +FT+L    ++QL ++E + FIP LI+K+G+ KD VR   + IL ++   Y   K+  +L +   +K ++ R EC + L  LI++  ++V        LK +A+ I +RD  VR AALN +V+A+N  G+ + K++ +L +K+ SML ERIKRS K   + +    +              +KP+++         R+ +A  EQ  P I    QL     + N     +I      V  +++E+L+P+         M P    K+ S S       NS    I  VI  + S ++ TSIQA+AQIDEV+R  D    +  ++D  +++  MQL+      +++++  + EI  ++  ++  ++S+F+ + LA E +   L +LM  ++ ++++ ++  + +G  +IR +N+L VR+LE S+QT +LSALL ++ D L +      +  L+ KC+W M + L  T++SI+L  I  D+  F   FP    +  +S  DVP RT+KTL++++    G   L+ L  I      +LE ++R+                  S+N+  +       K  ++S+++    ++ D    IF KIG  E  K+GL +LY++K KY   DL  +L  T+ +FQ  +E GL+ I  ER   G+ Q S V   +   +   ++S    +    +++  +   RLK LR+  GL+ S
Sbjct: 1181 NGKEQRIKEEKSLKILKWNFITPRDEYVEQLKTQMSTCLAKWLQDELFHFDFQHHVKAIGAMIEHMEAES----EAVIGCLDLVLKWFTLRFFDTNTSVIMKTLEFLKMLFTMLS-RKNYQLNDYEASSFIPYLILKVGESKDVVRKDVRAILAMLCKVYAASKVFPYLMDGTKSKNSKQRSECLEELGCLIENFGMNVCQPTPAKALKEIAVHIGDRDTTVRNAALNTVVAAYNACGDQVFKLIGNLSEKEMSMLEERIKRSAKKTPAPSTKQERPQREHPTNPNATFLRKPAQEEVPNKLNQARQQNAHLEQSAPSIPKEFQLDLDVFENNHTCASDIPDL---VQHKLDEVLEPV---------MIPE--RKIHSVSPHFDDIHNSTASTINFVISQVASGDINTSIQALAQIDEVLRQADKAEAMSGHIDQFLIATFMQLRLIYNTHMADDRLDKKEIFKLYSCIIGNMLSLFSMESLAREASMGVLKDLMHGLITLMLDSRVEDIEDGQQLIRSVNLLMVRVLEKSDQTNILSALLVLLQDSLISTAGSPMFSELVMKCLWRMIRFLPQTINSINLDRILLDVHNFMKVFPKEKLKQLKS--DVPHRTLKTLLHTLCRLTGAKILDHLSMIENRNESELEAHLRRVV--------------KHSANLSGLKSDKGTEKGALRSDDKMIKAKVSDILSEIFKKIGSKENTKEGLTELYEYKQKYSDADLEPFLRNTSQFFQSYVERGLRMIESEREGKGRIQTSTVIAQHSTESFVPSSSSVPVSSNGEDLNAAAYYERLKILRQRRGLENS 1961          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Zebrafish
Match: ckap5 (cytoskeleton associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-051120-174])

HSP 1 Score: 323.939 bits (829), Expect = 8.229e-92
Identity = 247/829 (29.79%), Postives = 424/829 (51.15%), Query Frame = 3
Query: 3474 KDAVVMALLAKNSN-KKQRIQEDRKKKVTKWETSLASSQ---QLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVG--NQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXX------XXXXQKPSRQ---------RENSATREQPKPQIS---QLPPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSN-DAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKD----IFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER---GQPQIS-VYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKS 5858
            +D ++  L  KN N K+QRI+E++  K+ KW       +   QL +Q S   +  L   LF  D +  +KAI  +   +  +     EA    LDL+LKW  +RF +TN SV+ K L++L  +FT+L    ++QL ++E + FIP LI+K+G+ KD VR   + IL ++   Y   K+  +L +   +K ++ R EC + L  LI++  ++V        LK +A+ I +RD  VR AALN +V+A+N  G+ + K++ +L +K+ SML ERIKRS K   + +    +              +KP+++         R+ +A  EQ  P I    QL     + N     +I      V  +++E+L+P+         M P    K+ S S       NS    I  VI  + S ++ TSIQA+AQIDEV+R  D    +  ++D  +++  MQL+      +++++  + EI  ++  ++  ++S+F+ + LA E +   L +LM  ++ ++++ ++  + +G  +IR +N+L VR+LE S+QT +LSALL ++ D L +      +  L+ KC+W M + L  T++SI+L  I  D+  F   FP    + ++   DVP RT+KTL++++    G   L+ L  I      +LE ++R+                  S+N+  +       K  ++S+++    ++ D    IF KIG  E  K+GL +LY++K KY   DL  +L  T+ +FQ  +E GL+ I  ER   G+ Q S V   +   +   ++S    +    +++  +   RLK LR+  GL+ S
Sbjct:  125 QDELIKGLDNKNPNGKEQRIKEEKSLKILKWNFITPRDEYVEQLKTQMSTCLAKWLQDELFHFDFQHHVKAIGAMIEHMEAES----EAVIGCLDLVLKWFTLRFFDTNTSVIMKTLEFLKMLFTMLS-RKNYQLNDYEASSFIPYLILKVGESKDVVRKDVRAILAMLCKVYAASKVFPYLMDGTKSKNSKQRSECLEELGCLIENFGMNVCQPTPAKALKEIAVHIGDRDTTVRNAALNTVVAAYNACGDQVFKLIGNLSEKEMSMLEERIKRSAKKTPAPSTKQERPQREHPTNPNATFLRKPAQEEVPNKLNQARQQNAHLEQSAPSIPKEFQLDLDVFENNHTCASDIPDL---VQHKLDEVLEPV---------MIPE--RKIHSVSPHFDDIHNSTASTINFVISQVASGDINTSIQALAQIDEVLRQADKAEAMSGHIDQFLIATFMQLRLIYNTHMADDRLDKKEIFKLYSCIIGNMLSLFSMESLAREASMGVLKDLMHGLITLMLDSRVEDIEDGQQLIRSVNLLMVRVLEKSDQTNILSALLVLLQDSLISTAGSPMFSELVMKCLWRMIRFLPQTINSINLDRILLDVHNFMKVFPKE--KLKQLKSDVPHRTLKTLLHTLCRLTGAKILDHLSMIENRNESELEAHLRRVV--------------KHSANLSGLKSDKGTEKGALRSDDKMIKAKVSDILSEIFKKIGSKENTKEGLTELYEYKQKYSDADLEPFLRNTSQFFQSYVERGLRMIESEREGKGRIQTSTVIAQHSTESFVPSSSSVPVSSNGEDLNAAAYYERLKILRQRRGLENS 918          

HSP 2 Score: 122.094 bits (305), Expect = 3.290e-27
Identity = 63/124 (50.81%), Postives = 82/124 (66.13%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTP 488
            K EHK WKAR+ GYEEALK  Q  D  K P ++ YLGL+K  V +SNAVAQ K LE  L F++ A+VA K   ++  G+VNK FN  + + +EL  EI  + +EIE+ +VV +ELIKGL  K P
Sbjct:   15 KCEHKVWKARLSGYEEALKLFQKLDE-KSPEWSKYLGLIKKFVTESNAVAQLKGLEAALAFIENAHVAGKTVGEVVSGVVNKVFNQPKARAKELGTEICLMYIEIEKAEVVQDELIKGLDNKNP 137          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Zebrafish
Match: ckap5 (cytoskeleton associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-051120-174])

HSP 1 Score: 126.716 bits (317), Expect = 5.380e-33
Identity = 65/127 (51.18%), Postives = 85/127 (66.93%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVV 497
            K EHK WKAR+ GYEEALK  Q  D  K P ++ YLGL+K  V +SNAVAQ K LE  L F++ A+VA K   ++  G+VNK FN  + + +EL  EI  + +EIE+ +VV +ELIKGL  K PK+V
Sbjct:   15 KCEHKVWKARLSGYEEALKLFQKLDE-KSPEWSKYLGLIKKFVTESNAVAQLKGLEAALAFIENAHVAGKTVGEVVSGVVNKVFNQPKARAKELGTEICLMYIEIEKAEVVQDELIKGLDNKNPKIV 140          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Match: CKAP5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:100145713])

HSP 1 Score: 909.442 bits (2349), Expect = 0.000e+0
Identity = 642/1998 (32.13%), Postives = 1041/1998 (52.10%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL--VKPTGGGDA---VPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEK-----PIEPPKAE---KHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSE--DDVTM-------KATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXX-------------XXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGN--QKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSAT--REQPKPQISQL------------PPKTI------DINPLLKEEIGYKL---INVDKEVEELLQPLEK----ITLRYLP--MGPSLLDKLRSYSGKASQSVNSNDA--ITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLK-ATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKF----VVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQISVYGSNQ--LNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDK 5870
            K EHK WKAR+ GYEEA+K  Q     K P ++ YLGL+K  V +SNAVAQ K LE  L++V+ A+VA K   ++  G+VNK FN  + + +EL  +I  + VEIE+ + V EEL+KGL  K PK+VV  +  L++ L +FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  SR+L+SQ+  ++     +  GG D    VPQ            +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L K++ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LFL R F   +       LLK     L     DS PEVRDAAF+ LGTA KVV EK + P+L ++D +KL RI E  EK + AS       +K      EK     P   P      + A         K AA      + K G    V       +M +  DD+         +A  +   + + Q+   NWKER A+ E  Q               +  L  +  GL     QV++ K+ ++  +   G  + T+A + +  L +K+GD+K   N K  L+ +++  NLP  A QV+  A    N KN  E LNWLS+AIK+FGF  I +   +  ++ A+  TNPA+R S I L G + LY+   +    ++EKP++   ID E + +K   PP PTRG         +  +         P  ++ D++PR  I  KI+ +L++++ DK  K++KE L +VT II+ +  I  + +  L  A+     DS+ ++ +  + +L  L  A    + ++++K +   ++S   D K   R  A+  LN W E+ G    ++G  ++E LK +NP+ +  +F W++  L   SQ  +P  L +       LP+L++ +E+R+ DVRK SQEA+  FM+  G++ M K   +  K S K  ++  L+KAKA +P     P+ +  K   +    P    A++   S ++                K       K P K N + ++D      +   + K+QR++E++  KV KW  +       +QL +Q S+  +  L   LF  D +  +K + ++   L E +K+ + +    LDLILKW  +RF +TN SVL KGL+YL  +FT+L     + L E E   F+P L++K+G+PKD VR   + IL  +   Y   K+  F+ E   +K ++ R EC + L  L++   ++V        LK +A+ I +RD  VR AALN +V+ +N  GE + K++ +L +KD SML ERIKR+GK           ++ + +  +KP R +  +A+  R+ P   +S              P  ++      D++ +  +    +      V  +++E+ +PL        L +LP  + P +   +          ++S  A  I  VI  + S ++  SIQA+AQIDEV+R +D    +  ++D  +++  MQL+ A    +++E+  + ++  ++  ++  ++S+F  + L  E +   L +LM  ++ ++++ ++  L +G  + R +N+L V++LE ++QT +LSALL ++ D L    +  K+  L+ KC+W M + L  ++++++L  I  DI  F    P    +  +S  ++P+RT+KTL++++   KG   ++ L  I      +LE ++ +           V+ +  DS+       T          V K+N   +L E   IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +I+    N   ++NS               + P   L RLK LR+  GLD +  D+
Sbjct:   15 KCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKKFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVSGVVNKVFNQPKARAKELGADICLMYVEIEKAEAVQEELLKGLDNKNPKIVVACVETLRKALSEFGSKIMTLKPIIKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQSRFLRSQQDLKAKFEQQQQAGGDDGEEVVPQ------------VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKKIVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFLARSFRHCTPSTLPKSLLKPFCAALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECAEKVELAS------GKKGGAAAGEKKETKAPAAAPGKSVPNQGAAEKDTKDAGKAAAAPKKGPAGKVGLQEYVHTYGLHGLMCKCMDDLCFSCKACEERAAAVLPASCMQQLDSNNWKERLASMEEFQKVTTK----------LFNLCFIS-GL-----QVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDVKCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGAPLRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGDEAEEGEEQDEDAPA-DVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPN-IGELPSALKARLNDSNKILVQQTLTILQQLSTAMG-PNIKQHVKNLGMPIISVLGDSKANVRAAAMVTLNSWVEQTGMKEWLEGEDLSEELKKENPFLRQELFGWLAEKLP--SQRTVPSDLQF------CLPYLYNCLEDRNADVRKKSQEALPMFMMHIGFEKMSKA-TTKLKPSSKDQVVALLEKAKASMPAKPAGPAGKASKQPPAVAPAPPPAAASSDSGSSTSDYKPDPKKTKPGAPASKAKILPGKKAPAKPNVKDEEDKSGPIYIIIPNGKEQRVKEEKGLKVLKWNFTTPRDEYVEQLKTQMSSCIAKWLQDELFHADFQHHIKGLAVMTEHL-ESEKEGVVSC---LDLILKWFTLRFFDTNTSVLMKGLEYLKLLFTMLS-QEEYHLTEMEATSFLPYLMLKVGEPKDIVRKDVRAILNKMCQVYPASKMFNFVMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPAKALKEIAVHIGDRDTTVRNAALNTIVTVYNVHGEQVFKLIGNLSEKDMSMLEERIKRAGK-------KQAVAAPAKQVEEKPQRVQSANASILRKAPPEDMSSKLNQARNMGGHTEPSHSVPREFQLDLDEIENDNGTVRCEMPALVQHKLDEIFEPLIPSIMIAPLLFLPVCIKPKMAANMIRAVSPHFDDMHSTTASTINFVISQVASGDINASIQALAQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLAYNTHMADERLDKYDLVRLYSCIIGNMISLFQMESLVKEASTGVLKDLMHGLITLMMDTRVDDLEDGPQVTRSVNVLLVKVLEKADQTNILSALLMLLQDSLLATASSPKFYELVMKCLWRMIRLLPESINNLNLDRILLDIHNFMRVLPKEKLKQHKS--ELPMRTLKTLLHTLCKLKGPKIMDHLSMIENKHESELEAHLLR-----------VMKHSMDSTGSKGDKETEKGASRIEDKVSKANVSDFLAE---IFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRLIEMEREGKARIAPTTGNSPPVSNSNGE-----------EVGPSVYLERLKILRQRCGLDNAKQDE 1926          

HSP 2 Score: 75.0998 bits (183), Expect = 1.467e-12
Identity = 109/509 (21.41%), Postives = 201/509 (39.49%), Query Frame = 3
Query:  105 NTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIK-GLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLP-QEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACM--EELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSA 1619
            + + +++  NWK R+   EE               F      + N+   S     +  L ++ L  Q+ N +  +A  +  G+V+K  +    K    A E L  I E        E+++    + K PK    ++N L   +++FG   + +K     V   L   +  +R +   L+  MY ++G+  L     + KP  +++++AEF+K+  Q  P P+R                       +   G+    +   D  DL+   E+  KI ++   +I +K W  RK+ L+ +  + N  K +    G+L  S LK    D+N +LV  +  I+ Q++T +      +  N     +    + K NV  A    ++S    T +   +  E+L   L  + P ++ E       + EK   +      L+  +P L N   D   +VR  + + L   M  +  +K+     K+      ++    EKAK +  A    P   A
Sbjct:  589 SCMQQLDSNNWKERLASMEE---------------FQKVTTKLFNLCFISGLQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDV---KCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGAP-LRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGD------------EAEEGEEQDEDAPADVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPNIGEL-PSALKARLNDSNKILVQQTLTILQQLSTAMGPNIKQHVKNLGMPIISVLGDSKANVRAAAMVTLNSWVEQTGMKEWLEGEDLSEELKKENPFLRQE---LFGWLAEKLPSQRTVPSDLQFCLPYLYNCLEDRNADVRKKSQEALPMFMMHIGFEKMSKATTKLKPSSKDQVVALLEKAKASMPAKPAGPAGKA 1062          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Match: CKAP5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:100145713])

HSP 1 Score: 905.975 bits (2340), Expect = 0.000e+0
Identity = 634/1968 (32.22%), Postives = 1034/1968 (52.54%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASE---ATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXX-------------XXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGN--QKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSR-QRENSATREQPKP--------QISQLPPKTIDINPLLKE------EIGYKLINVDKEVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLK-ATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNK-PKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQIS-VYGSNQL----------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKS 5858
            K EHK WKAR+ GYEEA+K  Q     K P ++ YLGL+K  V +SNAVAQ K LE  L++V+ A+VA K   ++  G+VNK FN  + + +EL  +I  + VEIE+ + V EEL+KGL  K PK+VV  +  L++ L +FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  SR+L+SQ+  ++   +    G         +   PQ    +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L K++ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LFL R F   +       LLK     L     DS PEVRDAAF+ LGTA KVV EK + P+L ++D +KL RI E  EK + AS          +K     A  P +    +  AE   K A       K        GA +K  +      + E+ +T+ +  ++           NWKER A+ E  Q  V+    +DIPCQ +++++  KPG K+ N QV++ K+ ++  +   G  + T+A + +  L +K+GD+K   N K  L+ +++  NLP  A QV+  A    N KN  E LNWLS+AIK+FGF  I +   +  ++ A+  TNPA+R S I L G + LY+   +    ++EKP++   ID E + +K   PP PTRG         +  +         P  ++ D++PR  I  KI+ +L++++ DK  K++KE L +VT II+ +  I  + +  L  A+     DS+ ++ +  + +L  L  A    + ++++K +   ++S   D K   R  A+  LN W E+ G    ++G  ++E LK +NP+ +  +F W++  L   SQ  +P  L +       LP+L++ +E+R+ DVRK SQEA+  FM+  G++ M K   +  K S K  ++  L+KAKA +P     P+ +  K   +    P    A++   S ++                K       K P K N + ++D      +   + K+QR++E++  KV KW  +       +QL +Q S+  +  L   LF  D +  +K + ++   L E +K+ + +    LDLILKW  +RF +TN SVL KGL+YL  +FT+L     + L E E   F+P L++K+G+PKD VR   + IL  +   Y   K+  F+ E   +K ++ R EC + L  L++   ++V        LK +A+ I +RD  VR AALN +V+ +N  GE + K++ +L +KD SML ERIKR+GK           ++ + +  +KP R Q  N++   +  P        Q   +   T   + + +E      EI      V  E+  L+Q  L++I    L   P +      +    S + ++ + + S + +    ++  SIQA+AQIDEV+R +D    +  ++D  +++  MQL+ A    +++E+  + ++  ++  ++  ++S+F  + L  E +   L +LM  ++ ++++ ++  L +G  + R +N+L V++LE                DC+ N +  S       +C+W M + L  ++++++L  I  DI  F    P    +  +S  ++P+RT+KTL++++   KG   ++ L  I      +LE ++ +  +K ++       + T S    E     ++    V K+N   +L E   IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +I+   G + L           N+    S    N     + P   L RLK LR+  GLD +
Sbjct:   15 KCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKKFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVSGVVNKVFNQPKARAKELGADICLMYVEIEKAEAVQEELLKGLDNKNPKIVVACVETLRKALSEFGSKIMTLKPIIKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQSRFLRSQQDLKAKFEQQQQAGGDDGGDEGEEEVVPQ----VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKKIVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFLARSFRHCTPSTLPKSLLKPFCAALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECAEKVELASGKKGGAAAGEKKETKAPAAAPGKSVPNQGAAEKDTKDAGKPGGPVKKAKAPASSGAPAKGKKAGDNKEIIEE-ITIPSYLLYN----------NWKERLASMEEFQKAVETMERNDIPCQALVKMLAKKPGFKETNFQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDVKCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGAPLRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGDEAEEGEEQDEDAPA-DVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPN-IGELPSALKARLNDSNKILVQQTLTILQQLSTAMG-PNIKQHVKNLGMPIISVLGDSKANVRAAAMVTLNSWVEQTGMKEWLEGEDLSEELKKENPFLRQELFGWLAEKLP--SQRTVPSDLQF------CLPYLYNCLEDRNADVRKKSQEALPMFMMHIGFEKMSKA-TTKLKPSSKDQVVALLEKAKASMPAKPAGPAGKASKQPPAVAPAPPPAAASSDSGSSTSDYKPDPKKTKPGAPASKAKILPGKKAPAKPNVKDEEDKSGPIYIIIPNGKEQRVKEEKGLKVLKWNFTTPRDEYVEQLKTQMSSCIAKWLQDELFHADFQHHIKGLAVMTEHL-ESEKEGVVSC---LDLILKWFTLRFFDTNTSVLMKGLEYLKLLFTMLS-QEEYHLTEMEATSFLPYLMLKVGEPKDIVRKDVRAILNKMCQVYPASKMFNFVMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPAKALKEIAVHIGDRDTTVRNAALNTIVTVYNVHGEQVFKLIGNLSEKDMSMLEERIKRAGK-------KQAVAAPAKQVEEKPQRVQSANASILRKAPPEDMSSKLNQARNMGGHTEPSHSVPREFQLDLDEIENDNGTVRCEMPALVQHKLDEIFEPVLIPEPKIRAVSPHFDDMHSTTASTINFVISQVAS---GDINASIQALAQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLAYNTHMADERLDKYDLVRLYSCIIGNMISLFQMESLVKEASTGVLKDLMHGLITLMMDTRVDDLEDGPQVTRSVNVLLVKVLE---------------KDCIANPEFLSP------QCLWRMIRLLPESINNLNLDRILLDIHNFMRVLPKEKLKQHKS--ELPMRTLKTLLHTLCKLKGPKIMDHLSMIENKHESELEAHLLR-VMKHSM-------DSTGSKGDKETEKGASRIEDKVSKANVSDFLAE---IFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRLIEMEREGKARIAPTTGISSLVTEITPLPTVTNTAPPVS----NSNGEEVGPSVYLERLKILRQRCGLDNA 1901          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Match: CKAP5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:100145713])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 509/1420 (35.85%), Postives = 787/1420 (55.42%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL--VKPTGGGDA---VPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQAS---EATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMK--ATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXX-------------XXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGN--QKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGK 4289
            K EHK WKAR+ GYEEA+K  Q     K P ++ YLGL+K  V +SNAVAQ K LE  L++V+ A+VA K   ++  G+VNK FN  + + +EL  +I  + VEIE+ + V EEL+KGL  K PK+VV  +  L++ L +FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  SR+L+SQ+  ++     +  GG D    VPQ            +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L K++ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LFL R F   +       LLK     L     DS PEVRDAAF+ LGTA KVV EK + P+L ++D +KL RI E  EK + AS          +K     A  P +    +  AE   K A    AA K     +  G   K   +    ++S+  V +     +I   ++L   +  NWKER A+ E  Q  V+    +DIPCQ +++++  KPG K+ N QV++ K+ ++  +   G  + T+A + +  L +K+GD+K   N K  L+ +++  NLP  A QV+  A    N KN  E LNWLS+AIK+FGF  I +   +  ++ A+  TNPA+R S I L G + LY+   +    ++EKP++   ID E + +K   PP PTRG         +  +         P  ++ D++PR  I  KI+ +L++++ DK  K++KE L +VT II+ +  I  + +  L  A+     DS+ ++ +  + +L  L  A    + ++++K +   ++S   D K   R  A+  LN W E+ G    ++G  ++E LK +NP+ +  +F W++  L   SQ  +P  L +       LP+L++ +E+R+ DVRK SQEA+  FM+  G++ M K   +  K S K  ++  L+KAKA +P     P+ +  K   +    P    A++   S ++                K       K P K N + ++D      +   + K+QR++E++  KV KW  +       +QL +Q S+  +  L   LF  D +  +K + ++   L E +K+ + +    LDLILKW  +RF +TN SVL KGL+YL  +FT+L     + L E E   F+P L++K+G+PKD VR   + IL  +   Y   K+  F+ E   +K ++ R EC + L  L++   ++V        LK +A+ I +RD  VR AALN +V+ +N  GE + K++ +L +KD SML ERIKR+GK
Sbjct:   15 KCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKKFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVSGVVNKVFNQPKARAKELGADICLMYVEIEKAEAVQEELLKGLDNKNPKIVVACVETLRKALSEFGSKIMTLKPIIKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQSRFLRSQQDLKAKFEQQQQAGGDDGEEVVPQ------------VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKKIVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFLARSFRHCTPSTLPKSLLKPFCAALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECAEKVELASGKKGGAAAGEKKETKAPAAAPGKSVPNQGAAEKDTKDAGKAAAAPKKGPAGKVAGTLCKWTWLGYLGMLSKAFVQLHVAGREITIPSYL---LYNNWKERLASMEEFQKAVETMERNDIPCQALVKMLAKKPGFKETNFQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDVKCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGAPLRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGDEAEEGEEQDEDAPA-DVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPN-IGELPSALKARLNDSNKILVQQTLTILQQLSTAMG-PNIKQHVKNLGMPIISVLGDSKANVRAAAMVTLNSWVEQTGMKEWLEGEDLSEELKKENPFLRQELFGWLAEKLP--SQRTVPSDLQF------CLPYLYNCLEDRNADVRKKSQEALPMFMMHIGFEKMSKA-TTKLKPSSKDQVVALLEKAKASMPAKPAGPAGKASKQPPAVAPAPPPAAASSDSGSSTSDYKPDPKKTKPGAPASKAKILPGKKAPAKPNVKDEEDKSGPIYIIIPNGKEQRVKEEKGLKVLKWNFTTPRDEYVEQLKTQMSSCIAKWLQDELFHADFQHHIKGLAVMTEHL-ESEKEGVVSC---LDLILKWFTLRFFDTNTSVLMKGLEYLKLLFTMLS-QEEYHLTEMEATSFLPYLMLKVGEPKDIVRKDVRAILNKMCQVYPASKMFNFVMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPAKALKEIAVHIGDRDTTVRNAALNTIVTVYNVHGEQVFKLIGNLSEKDMSMLEERIKRAGK 1401          

HSP 2 Score: 147.902 bits (372), Expect = 1.082e-34
Identity = 115/435 (26.44%), Postives = 211/435 (48.51%), Query Frame = 3
Query: 4617 ITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLK-ATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKF----VVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQIS-VYGSNQL----------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDK 5870
            I  VI  + S ++  SIQA+AQIDEV+R +D    +  ++D  +++  MQL+ A    +++E+  + ++  ++  ++  ++S+F  + L  E +   L +LM  ++ ++++ ++  L +G  + R +N+L V++LE                DC+ N +  S       +C+W M + L  ++++++L  I  DI  F    P    +  +S  ++P+RT+KTL++++   KG   ++ L  I      +LE ++ +           V+ +  DS+       T          V K+N   +L E   IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +I+   G + L           N+    S    N     + P   L RLK LR+  GLD +  D+
Sbjct: 1525 INFVISQVASGDINASIQALAQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLAYNTHMADERLDKYDLVRLYSCIIGNMISLFQMESLVKEASTGVLKDLMHGLITLMMDTRVDDLEDGPQVTRSVNVLLVKVLEK---------------DCIANPEFLSP------QCLWRMIRLLPESINNLNLDRILLDIHNFMRVLPKEKLKQHKS--ELPMRTLKTLLHTLCKLKGPKIMDHLSMIENKHESELEAHLLR-----------VMKHSMDSTGSKGDKETEKGASRIEDKVSKANVSDFLAE---IFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRLIEMEREGKARIAPTTGISSLVTEITPLPTVTNTAPPVS----NSNGEEVGPSVYLERLKILRQRCGLDNAKQDE 1918          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Match: CKAP5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:100145713])

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 503/1415 (35.55%), Postives = 781/1415 (55.19%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASE---ATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXX-------------XXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGN--QKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGK 4289
            K EHK WKAR+ GYEEA+K  Q     K P ++ YLGL+K  V +SNAVAQ K LE  L++V+ A+VA K   ++  G+VNK FN  + + +EL  +I  + VEIE+ + V EEL+KGL  K PK+VV  +  L++ L +FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  SR+L+SQ+  ++   +    G         +   PQ    +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L K++ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LFL R F   +       LLK     L     DS PEVRDAAF+ LGTA KVV EK + P+L ++D +KL RI E  EK + AS          +K     A  P +    +  AE   K A       K        GA +K  +      + E+ +T+ +  ++           NWKER A+ E  Q  V+    +DIPCQ +++++  KPG K+ N QV++ K+ ++  +   G  + T+A + +  L +K+GD+K   N K  L+ +++  NLP  A QV+  A    N KN  E LNWLS+AIK+FGF  I +   +  ++ A+  TNPA+R S I L G + LY+   +    ++EKP++   ID E + +K   PP PTRG         +  +         P  ++ D++PR  I  KI+ +L++++ DK  K++KE L +VT II+ +  I  + +  L  A+     DS+ ++ +  + +L  L  A    + ++++K +   ++S   D K   R  A+  LN W E+ G    ++G  ++E LK +NP+ +  +F W++  L   SQ  +P  L +       LP+L++ +E+R+ DVRK SQEA+  FM+  G++ M K   +  K S K  ++  L+KAKA +P     P+ +  K   +    P    A++   S ++                K       K P K N + ++D      +   + K+QR++E++  KV KW  +       +QL +Q S+  +  L   LF  D +  +K + ++   L E +K+ + +    LDLILKW  +RF +TN SVL KGL+YL  +FT+L     + L E E   F+P L++K+G+PKD VR   + IL  +   Y   K+  F+ E   +K ++ R EC + L  L++   ++V        LK +A+ I +RD  VR AALN +V+ +N  GE + K++ +L +KD SML ERIKR+GK
Sbjct:   15 KCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKKFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVSGVVNKVFNQPKARAKELGADICLMYVEIEKAEAVQEELLKGLDNKNPKIVVACVETLRKALSEFGSKIMTLKPIIKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQSRFLRSQQDLKAKFEQQQQAGGDDGGDEGEEEVVPQ----VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKKIVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFLARSFRHCTPSTLPKSLLKPFCAALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECAEKVELASGKKGGAAAGEKKETKAPAAAPGKSVPNQGAAEKDTKDAGKPGGPVKKAKAPASSGAPAKGKKAGDNKEIIEE-ITIPSYLLYN----------NWKERLASMEEFQKAVETMERNDIPCQALVKMLAKKPGFKETNFQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDVKCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGAPLRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGDEAEEGEEQDEDAPA-DVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPN-IGELPSALKARLNDSNKILVQQTLTILQQLSTAMG-PNIKQHVKNLGMPIISVLGDSKANVRAAAMVTLNSWVEQTGMKEWLEGEDLSEELKKENPFLRQELFGWLAEKLP--SQRTVPSDLQF------CLPYLYNCLEDRNADVRKKSQEALPMFMMHIGFEKMSKA-TTKLKPSSKDQVVALLEKAKASMPAKPAGPAGKASKQPPAVAPAPPPAAASSDSGSSTSDYKPDPKKTKPGAPASKAKILPGKKAPAKPNVKDEEDKSGPIYIIIPNGKEQRVKEEKGLKVLKWNFTTPRDEYVEQLKTQMSSCIAKWLQDELFHADFQHHIKGLAVMTEHL-ESEKEGVVSC---LDLILKWFTLRFFDTNTSVLMKGLEYLKLLFTMLS-QEEYHLTEMEATSFLPYLMLKVGEPKDIVRKDVRAILNKMCQVYPASKMFNFVMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPAKALKEIAVHIGDRDTTVRNAALNTIVTVYNVHGEQVFKLIGNLSEKDMSMLEERIKRAGK 1396          

HSP 2 Score: 147.902 bits (372), Expect = 1.146e-34
Identity = 115/435 (26.44%), Postives = 211/435 (48.51%), Query Frame = 3
Query: 4617 ITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLK-ATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKF----VVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQIS-VYGSNQL----------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDK 5870
            I  VI  + S ++  SIQA+AQIDEV+R +D    +  ++D  +++  MQL+ A    +++E+  + ++  ++  ++  ++S+F  + L  E +   L +LM  ++ ++++ ++  L +G  + R +N+L V++LE                DC+ N +  S       +C+W M + L  ++++++L  I  DI  F    P    +  +S  ++P+RT+KTL++++   KG   ++ L  I      +LE ++ +           V+ +  DS+       T          V K+N   +L E   IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +I+   G + L           N+    S    N     + P   L RLK LR+  GLD +  D+
Sbjct: 1520 INFVISQVASGDINASIQALAQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLAYNTHMADERLDKYDLVRLYSCIIGNMISLFQMESLVKEASTGVLKDLMHGLITLMMDTRVDDLEDGPQVTRSVNVLLVKVLEK---------------DCIANPEFLSP------QCLWRMIRLLPESINNLNLDRILLDIHNFMRVLPKEKLKQHKS--ELPMRTLKTLLHTLCKLKGPKIMDHLSMIENKHESELEAHLLR-----------VMKHSMDSTGSKGDKETEKGASRIEDKVSKANVSDFLAE---IFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRLIEMEREGKARIAPTTGISSLVTEITPLPTVTNTAPPVS----NSNGEEVGPSVYLERLKILRQRCGLDNAKQDE 1913          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Match: CKAP5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:100145713])

HSP 1 Score: 671.003 bits (1730), Expect = 0.000e+0
Identity = 401/1085 (36.96%), Postives = 612/1085 (56.41%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL--VKPTGGGDA---VPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEK-----PIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPK 3338
            K EHK WKAR+ GYEEA+K  Q     K P ++ YLGL+K  V +SNAVAQ K LE  L++V+ A+VA K   ++  G+VNK FN  + + +EL  +I  + VEIE+ + V EEL+KGL  K PK+VV  +  L++ L +FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  SR+L+SQ+  ++     +  GG D    VPQ            +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L K++ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LFL R F   +       LLK     L     DS PEVRDAAF+ LGTA KVV EK + P+L ++D +KL RI E  EK + AS       +K      EK     P   P      + +      K  A        K   A    EI  E  +S +    +A  +   + + Q+   NWKER A+ E  Q  V+    +DIPCQ +++++  KPG K+ N QV++ K+ ++  +   G  + T+A + +  L +K+GD+K   N K  L+ +++  NLP  A QV+  A    N KN  E LNWLS+AIK+FGF  I +   +  ++ A+  TNPA+R S I L G + LY+   +    ++EKP++   ID E + +K   PP PTRG         +  +         P  ++ D++PR  I  KI+ +L++++ DK  K++KE L +VT II+ +  I  + +  L  A+     DS+ ++ +  + +L  L  A    + ++++K +   ++S   D K   R  A+  LN W E+ G    ++G  ++E LK +NP+ +  +F W++  L   SQ  +P  L +       LP+L++ +E+R+ DVRK SQEA+  FM+  G++ M K   +  K S K  ++  L+KAKA +P     P+ +  K
Sbjct:   15 KCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKKFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVSGVVNKVFNQPKARAKELGADICLMYVEIEKAEAVQEELLKGLDNKNPKIVVACVETLRKALSEFGSKIMTLKPIIKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQSRFLRSQQDLKAKFEQQQQAGGDDGEEVVPQ------------VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKKIVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFLARSFRHCTPSTLPKSLLKPFCAALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECAEKVELAS------GKKGGAAAGEKKETKAPAAAPGKSVPNQGAPGGPVKKAKAPASSGAPAKGKKAGDNKEI-IEQELSPEACEERAAAVLPASCMQQLDSNNWKERLASMEEFQKAVETMERNDIPCQALVKMLAKKPGFKETNFQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDVKCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGAPLRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGDEAEEGEEQDEDAPA-DVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPN-IGELPSALKARLNDSNKILVQQTLTILQQLSTAMG-PNIKQHVKNLGMPIISVLGDSKANVRAAAMVTLNSWVEQTGMKEWLEGEDLSEELKKENPFLRQELFGWLAEKLP--SQRTVPSDLQF------CLPYLYNCLEDRNADVRKKSQEALPMFMMHIGFEKMSKA-TTKLKPSSKDQVVALLEKAKASMPAKPAGPAGKASK 1067          

HSP 2 Score: 310.071 bits (793), Expect = 3.128e-84
Identity = 246/833 (29.53%), Postives = 430/833 (51.62%), Query Frame = 3
Query: 3447 PNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQ---QLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQ--KNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSR-QRENSATREQPKP--------QISQLPPKTIDINPLLKE------EIGYKLINVDKEVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKASQ-SVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLK-ATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNK-PKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQISVYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDK 5870
            PN  +E+ DK   +  ++   + K+QR++E++  KV KW  +    +   QL +Q S+  +  L   LF  D +  +K + ++   L E +K+ + +    LDLILKW  +RF +TN SVL KGL+YL  +FT+L  +  + L E E   F+P L++K+G+PKD VR   + IL  +   Y   K+  F+ E   +K ++ R EC + L  L++   ++V        LK +A+ I +RD  VR AALN +V+ +N  GE + K++ +L +KD SML ERIKR+GK           ++ + +  +KP R Q  N++   +  P        Q   +   T   + + +E      EI      V  E+  L+Q  L++I    L   P    K+R+ S         +   I  VI  + S ++  SIQA+AQIDEV+R +D    +  ++D  +++  MQL+ A    +++E+  + ++  ++  ++  ++S+F  + L  E +   L +LM  ++ ++++ ++  L +G  + R +N+L V++LE ++QT +LSALL ++ D L    +  K+  L+ KC+W M + L  ++++++L  I  DI  F    P    +  +S  ++P+RT+KTL++++   KG   ++ L  I      +LE ++ +  +K ++       + T S    E     ++    V K+N   +L E   IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +I+      + N+    S    N     + P   L RLK LR+  GLD +  D+
Sbjct: 1126 PNVKDEE-DKSGPIYIIIP--NGKEQRVKEEKGLKVLKWNFTTPRDEYVEQLKTQMSSCIAKWLQDELFHADFQHHIKGLAVMTEHL-ESEKEGVVSC---LDLILKWFTLRFFDTNTSVLMKGLEYLKLLFTMLSQEE-YHLTEMEATSFLPYLMLKVGEPKDIVRKDVRAILNKMCQVYPASKMFNFVMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPAKALKEIAVHIGDRDTTVRNAALNTIVTVYNVHGEQVFKLIGNLSEKDMSMLEERIKRAGK-------KQAVAAPAKQVEEKPQRVQSANASILRKAPPEDMSSKLNQARNMGGHTEPSHSVPREFQLDLDEIENDNGTVRCEMPALVQHKLDEIFEPVLIPEP----KIRAVSPHFDDMHSTTASTINFVISQVASGDINASIQALAQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLAYNTHMADERLDKYDLVRLYSCIIGNMISLFQMESLVKEASTGVLKDLMHGLITLMMDTRVDDLEDGPQVTRSVNVLLVKVLEKADQTNILSALLMLLQDSLLATASSPKFYELVMKCLWRMIRLLPESINNLNLDRILLDIHNFMRVLPKEKLKQHKS--ELPMRTLKTLLHTLCKLKGPKIMDHLSMIENKHESELEAHLLR-VMKHSM-------DSTGSKGDKETEKGASRIEDKVSKANVSDFLAE---IFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRLIEMEREGKARIA---PTTVTNTAPPVS----NSNGEEVGPSVYLERLKILRQRCGLDNAKQDE 1919          

HSP 3 Score: 79.7221 bits (195), Expect = 6.044e-14
Identity = 113/514 (21.98%), Postives = 209/514 (40.66%), Query Frame = 3
Query:  105 NTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVI-----DSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIK-GLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLP-QEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACM--EELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSA 1619
            + + +++  NWK R+   EE  KA++  +    P       LVK +       ++N    +  L ++ L  Q+ N +  +A  +  G+V+K  +    K    A E L  I E        E+++    + K PK    ++N L   +++FG   + +K     V   L   +  +R +   L+  MY ++G+  L     + KP  +++++AEF+K+  Q  P P+R                       +   G+    +   D  DL+   E+  KI ++   +I +K W  RK+ L+ +  + N  K +    G+L  S LK    D+N +LV  +  I+ Q++T +      +  N     +    + K NV  A    ++S    T +   +  E+L   L  + P ++ E       + EK   +      L+  +P L N   D   +VR  + + L   M  +  +K+     K+      ++    EKAK +  A    P   A
Sbjct:  576 SCMQQLDSNNWKERLASMEEFQKAVETMERNDIPC----QALVKMLAKKPGFKETNFQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDV---KCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGAP-LRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGD------------EAEEGEEQDEDAPADVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPNIGEL-PSALKARLNDSNKILVQQTLTILQQLSTAMGPNIKQHVKNLGMPIISVLGDSKANVRAAAMVTLNSWVEQTGMKEWLEGEDLSEELKKENPFLRQE---LFGWLAEKLPSQRTVPSDLQFCLPYLYNCLEDRNADVRKKSQEALPMFMMHIGFEKMSKATTKLKPSSKDQVVALLEKAKASMPAKPAGPAGKA 1065          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Mouse
Match: Ckap5 (cytoskeleton associated protein 5 [Source:MGI Symbol;Acc:MGI:1923036])

HSP 1 Score: 961.829 bits (2485), Expect = 0.000e+0
Identity = 664/1997 (33.25%), Postives = 1060/1997 (53.08%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEP-----------------------PKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASK----VPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGF-KIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELN-LEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPK--------------AASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXG-KMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSR-QRENSAT---REQPKPQISQL--PPKTIDINP----LLKEEIGYKLINVDK-------EVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKA-SQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER---GQPQISVYGSNQL------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFD 5867
            K EHK WKAR+ GYEEALK  Q     K P ++ YLGL+K  V DSNAV Q K LE  L++V+ A+VA K   ++  G+V+K FN  + K +EL  EI  + VEIE+ + V EEL+KGL  K PK++V  I  L++ L +FG KI+ +K + K + KL E RDK VR+  K   IE+YRW    A+   L  I  VQ+ EL  E+ KLP   P PSR+L+SQ+  E+ L +    G             PQ    +D Y+L+D VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LF+ R F   +       LLK     L     DS PEVRDAAF+ LGTA+KVV EK + P+L  +D +KL RI E  EK +      +V  +KS +   +K  +P                       P   K    +K    SK         S   G  +K      EI  E  +S +    KA+ +     +  +   NWKER A  E  Q  V+    +++PCQ +++++  KPG K+ N QV++ K+ ++  I   G  + T+A++ +  L +KIGD+K  +N K  +T +++   LP  A QV+  A    N KN  E LNWLS+AIK+FGF ++ +   +  ++ A+  TNPAVR S I L G + LYV   +  + +DEKP++   ID E + ++  +PP PTRG+   +    +ATD            N + D++PR  I+ KIT  L++++ DK  K++KE L +V  II+ +  I  + +  L  A+     DS+ ++ +  +N+L  L  A    +  +++K +   +++   D K   R  A+  +N W E+ G    ++G  ++E LK +NP+ +  +  W++  L  L     P  L+        +PHL+S +E+R+ DVRK +Q+A+  FM+  GY+ M K      K + K  ++  L+KAKA +P     P+K + K              A   +      +   + K + +     +     G K+P+K+  + D D      +   + K+QR+++++  KV KW  +       +QL +Q S   +  L   +F +D +   KA+ ++   L E +KD + +    LDLILKW+ +RF +TN SVL K L+YL  +FT+L  +  + L E+E + FIP LI+K+G+PKD +R   + IL  +   Y   K+  F+ E   +K ++ R EC + L  LI+   ++V        LK +A+ I +RDN VR AALN +V+ +N  G+ + K++ +L +KD SML ERIKRS K           ++   +  +KP R Q  NS     R+ P   +S      +++  +P    +++ E    L  ++        E+ EL+Q  L+ I    L   P    K+R+ S        N+   I  +I  + S ++ TSIQA+ QIDEV+R +D    +  ++D  +++  MQL+      +++EK  + EI  ++  ++  ++S+F  + LA E +   L +LM  ++ ++++ ++  L EG  +IR +N+L V++LE S+QT +LSALL ++ D L    +  K+  L+ KC+W M + L +T++SI+L  I  DI +F   FP    + ++   + P+RT+KTL++++   KG   L+ L  I      +LE ++ +  +K ++       + T S +  E     +  +   KS+     + L +IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER   G+   S   S Q+        +   +SL   N     + P   L RLK LR+  GLD +  D
Sbjct:   15 KCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTLQNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----VDAYELLDAVEILSKLPKDFYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKVE------LVHGKKSGLATEKKESKPLPGRAAASGAAGDKDTKDVSGPKPGPLKKTPTAKAGGPSKKGKTTAPGGSASAGTKNKKGLETKEI-VEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMERTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVKTALAATNPAVRTSAITLLGVMYLYVGPSLRMIFEDEKPALLSQIDAEFQKMQGQSPPAPTRGIAKHS---TSATDEGEDGEEPGEGGNDVVDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPN-IGELPTALKGRLNDSNKILVQQTLNILQQLAVAMG-ANIRQHVKNLGIPVITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRST--PTDLIL------CVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKA-TGKLKPTSKDQVLAMLEKAKANMPSKPAAPAKAMSKPMGGSAPAKTQPIPAPVEDSVSSTIEAKPDLKKAKAPGVSSKAKSVQGKKVPSKTTLKEDDDKSGPIFIVVPNGKEQRMRDEKGLKVLKWNFTTPRDEYIEQLKTQMSTCVAKWLQDEMFHSDFQHHNKALAVMVDHL-ESEKDGVISC---LDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLS-EEEYHLTENEASSFIPYLILKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLIESYGMNVCQPTPGKALKEIAIHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAK--------RPSAAPVKQAEEKPQRTQNINSNANMLRKGPAEDMSSKLNQARSLSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEP----KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYSTHMADEKLDKDEIIKLYSCIIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKE--KLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCR-MMKHSM-------DQTGSKSDKETEKGAS--RIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDTDIEPFLKNSSQFFQSYVERGLRVIEMERESKGRIPTSTGISPQMEVTCVPTPTSTVSSLGNTNGE--EVGPSVYLERLKILRQRCGLDNTKQD 1954          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Mouse
Match: Ckap5 (cytoskeleton associated protein 5 [Source:MGI Symbol;Acc:MGI:1923036])

HSP 1 Score: 961.829 bits (2485), Expect = 0.000e+0
Identity = 664/1997 (33.25%), Postives = 1060/1997 (53.08%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEP-----------------------PKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASK----VPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGF-KIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELN-LEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPK--------------AASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXG-KMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSR-QRENSAT---REQPKPQISQL--PPKTIDINP----LLKEEIGYKLINVDK-------EVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKA-SQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER---GQPQISVYGSNQL------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFD 5867
            K EHK WKAR+ GYEEALK  Q     K P ++ YLGL+K  V DSNAV Q K LE  L++V+ A+VA K   ++  G+V+K FN  + K +EL  EI  + VEIE+ + V EEL+KGL  K PK++V  I  L++ L +FG KI+ +K + K + KL E RDK VR+  K   IE+YRW    A+   L  I  VQ+ EL  E+ KLP   P PSR+L+SQ+  E+ L +    G             PQ    +D Y+L+D VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LF+ R F   +       LLK     L     DS PEVRDAAF+ LGTA+KVV EK + P+L  +D +KL RI E  EK +      +V  +KS +   +K  +P                       P   K    +K    SK         S   G  +K      EI  E  +S +    KA+ +     +  +   NWKER A  E  Q  V+    +++PCQ +++++  KPG K+ N QV++ K+ ++  I   G  + T+A++ +  L +KIGD+K  +N K  +T +++   LP  A QV+  A    N KN  E LNWLS+AIK+FGF ++ +   +  ++ A+  TNPAVR S I L G + LYV   +  + +DEKP++   ID E + ++  +PP PTRG+   +    +ATD            N + D++PR  I+ KIT  L++++ DK  K++KE L +V  II+ +  I  + +  L  A+     DS+ ++ +  +N+L  L  A    +  +++K +   +++   D K   R  A+  +N W E+ G    ++G  ++E LK +NP+ +  +  W++  L  L     P  L+        +PHL+S +E+R+ DVRK +Q+A+  FM+  GY+ M K      K + K  ++  L+KAKA +P     P+K + K              A   +      +   + K + +     +     G K+P+K+  + D D      +   + K+QR+++++  KV KW  +       +QL +Q S   +  L   +F +D +   KA+ ++   L E +KD + +    LDLILKW+ +RF +TN SVL K L+YL  +FT+L  +  + L E+E + FIP LI+K+G+PKD +R   + IL  +   Y   K+  F+ E   +K ++ R EC + L  LI+   ++V        LK +A+ I +RDN VR AALN +V+ +N  G+ + K++ +L +KD SML ERIKRS K           ++   +  +KP R Q  NS     R+ P   +S      +++  +P    +++ E    L  ++        E+ EL+Q  L+ I    L   P    K+R+ S        N+   I  +I  + S ++ TSIQA+ QIDEV+R +D    +  ++D  +++  MQL+      +++EK  + EI  ++  ++  ++S+F  + LA E +   L +LM  ++ ++++ ++  L EG  +IR +N+L V++LE S+QT +LSALL ++ D L    +  K+  L+ KC+W M + L +T++SI+L  I  DI +F   FP    + ++   + P+RT+KTL++++   KG   L+ L  I      +LE ++ +  +K ++       + T S +  E     +  +   KS+     + L +IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER   G+   S   S Q+        +   +SL   N     + P   L RLK LR+  GLD +  D
Sbjct:   15 KCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTLQNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----VDAYELLDAVEILSKLPKDFYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKVE------LVHGKKSGLATEKKESKPLPGRAAASGAAGDKDTKDVSGPKPGPLKKTPTAKAGGPSKKGKTTAPGGSASAGTKNKKGLETKEI-VEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMERTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVKTALAATNPAVRTSAITLLGVMYLYVGPSLRMIFEDEKPALLSQIDAEFQKMQGQSPPAPTRGIAKHS---TSATDEGEDGEEPGEGGNDVVDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPN-IGELPTALKGRLNDSNKILVQQTLNILQQLAVAMG-ANIRQHVKNLGIPVITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRST--PTDLIL------CVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKA-TGKLKPTSKDQVLAMLEKAKANMPSKPAAPAKAMSKPMGGSAPAKTQPIPAPVEDSVSSTIEAKPDLKKAKAPGVSSKAKSVQGKKVPSKTTLKEDDDKSGPIFIVVPNGKEQRMRDEKGLKVLKWNFTTPRDEYIEQLKTQMSTCVAKWLQDEMFHSDFQHHNKALAVMVDHL-ESEKDGVISC---LDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLS-EEEYHLTENEASSFIPYLILKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLIESYGMNVCQPTPGKALKEIAIHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAK--------RPSAAPVKQAEEKPQRTQNINSNANMLRKGPAEDMSSKLNQARSLSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEP----KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYSTHMADEKLDKDEIIKLYSCIIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKE--KLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCR-MMKHSM-------DQTGSKSDKETEKGAS--RIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDTDIEPFLKNSSQFFQSYVERGLRVIEMERESKGRIPTSTGISPQMEVTCVPTPTSTVSSLGNTNGE--EVGPSVYLERLKILRQRCGLDNTKQD 1954          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Mouse
Match: Ckap5 (cytoskeleton associated protein 5 [Source:MGI Symbol;Acc:MGI:1923036])

HSP 1 Score: 959.903 bits (2480), Expect = 0.000e+0
Identity = 659/1988 (33.15%), Postives = 1051/1988 (52.87%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEP-----------------------PKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASK----VPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGF-KIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELN-LEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPK--------------AASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXG-KMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSR-QRENSAT---REQPKPQISQL--PPKTIDINP----LLKEEIGYKLINVDK-------EVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKASQ-SVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFD 5867
            K EHK WKAR+ GYEEALK  Q     K P ++ YLGL+K  V DSNAV Q K LE  L++V+ A+VA K   ++  G+V+K FN  + K +EL  EI  + VEIE+ + V EEL+KGL  K PK++V  I  L++ L +FG KI+ +K + K + KL E RDK VR+  K   IE+YRW    A+   L  I  VQ+ EL  E+ KLP   P PSR+L+SQ+  E+ L +    G             PQ    +D Y+L+D VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LF+ R F   +       LLK     L     DS PEVRDAAF+ LGTA+KVV EK + P+L  +D +KL RI E  EK +      +V  +KS +   +K  +P                       P   K    +K    SK         S   G  +K      EI  E  +S +    KA+ +     +  +   NWKER A  E  Q  V+    +++PCQ +++++  KPG K+ N QV++ K+ ++  I   G  + T+A++ +  L +KIGD+K  +N K  +T +++   LP  A QV+  A    N KN  E LNWLS+AIK+FGF ++ +   +  ++ A+  TNPAVR S I L G + LYV   +  + +DEKP++   ID E + ++  +PP PTRG+   +    +ATD            N + D++PR  I+ KIT  L++++ DK  K++KE L +V  II+ +  I  + +  L  A+     DS+ ++ +  +N+L  L  A    +  +++K +   +++   D K   R  A+  +N W E+ G    ++G  ++E LK +NP+ +  +  W++  L  L     P  L+        +PHL+S +E+R+ DVRK +Q+A+  FM+  GY+ M K      K + K  ++  L+KAKA +P     P+K + K              A   +      +   + K + +     +     G K+P+K+  + D D      +   + K+QR+++++  KV KW  +       +QL +Q S   +  L   +F +D +   KA+ ++   L E +KD + +    LDLILKW+ +RF +TN SVL K L+YL  +FT+L  +  + L E+E + FIP LI+K+G+PKD +R   + IL  +   Y   K+  F+ E   +K ++ R EC + L  LI+   ++V        LK +A+ I +RDN VR AALN +V+ +N  G+ + K++ +L +KD SML ERIKRS K           ++   +  +KP R Q  NS     R+ P   +S      +++  +P    +++ E    L  ++        E+ EL+Q  L+ I    L   P    K+R+ S        N+   I  +I  + S ++ TSIQA+ QIDEV+R +D    +  ++D  +++  MQL+      +++EK  + EI  ++  ++  ++S+F  + LA E +   L +LM  ++ ++++ ++  L EG  +IR +N+L V++LE S+QT +LSALL ++ D L    +  K+  L+ KC+W M + L +T++SI+L  I  DI +F   FP    + ++   + P+RT+KTL++++   KG   L+ L  I      +LE ++ +  +K ++       + T S +  E     +  +   KS+     + L +IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER               S         N     + P   L RLK LR+  GLD +  D
Sbjct:   15 KCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTLQNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----VDAYELLDAVEILSKLPKDFYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKVE------LVHGKKSGLATEKKESKPLPGRAAASGAAGDKDTKDVSGPKPGPLKKTPTAKAGGPSKKGKTTAPGGSASAGTKNKKGLETKEI-VEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMERTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVKTALAATNPAVRTSAITLLGVMYLYVGPSLRMIFEDEKPALLSQIDAEFQKMQGQSPPAPTRGIAKHS---TSATDEGEDGEEPGEGGNDVVDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPN-IGELPTALKGRLNDSNKILVQQTLNILQQLAVAMG-ANIRQHVKNLGIPVITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRST--PTDLIL------CVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKA-TGKLKPTSKDQVLAMLEKAKANMPSKPAAPAKAMSKPMGGSAPAKTQPIPAPVEDSVSSTIEAKPDLKKAKAPGVSSKAKSVQGKKVPSKTTLKEDDDKSGPIFIVVPNGKEQRMRDEKGLKVLKWNFTTPRDEYIEQLKTQMSTCVAKWLQDEMFHSDFQHHNKALAVMVDHL-ESEKDGVISC---LDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLS-EEEYHLTENEASSFIPYLILKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLIESYGMNVCQPTPGKALKEIAIHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAK--------RPSAAPVKQAEEKPQRTQNINSNANMLRKGPAEDMSSKLNQARSLSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEP----KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYSTHMADEKLDKDEIIKLYSCIIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKE--KLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCR-MMKHSM-------DQTGSKSDKETEKGAS--RIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDTDIEPFLKNSSQFFQSYVERGLRVIEMER--------------ESKGRIPTSTGNTNGEEVGPSVYLERLKILRQRCGLDNTKQD 1933          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Mouse
Match: Ckap5 (cytoskeleton associated protein 5 [Source:MGI Symbol;Acc:MGI:1923036])

HSP 1 Score: 897.501 bits (2318), Expect = 0.000e+0
Identity = 646/1996 (32.36%), Postives = 1026/1996 (51.40%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEP-----------------------PKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASK----VPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGF-KIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELN-LEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPK--------------AASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXG-KMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSR-QRENSAT---REQPKPQISQL--PPKTIDINP----LLKEEIGYKLINVDK-------EVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKASQ-SVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER---GQPQISVYGSNQL------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFD 5867
            K EHK WKAR+ GYEEALK  Q     K P ++ YLGL+K  V DSNAV Q K LE  L++V+ A+VA K   ++  G+V+K FN  + K +EL  EI  + VEIE+ + V EEL+KGL  K PK++V  I  L++ L +FG KI+ +K + K + KL E RDK VR+  K   IE+YRW    A+   L  I  VQ+ EL  E+ KLP   P PSR+L+SQ+  E+ L +    G             PQ    +D Y+L+D VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LF+ R F   +       LLK     L     DS PEVRDAAF+ LGTA+KVV EK + P+L  +D +KL RI E  EK +      +V  +KS +   +K  +P                       P   K    +K    SK         S   G  +K      EI  E  +S +    KA+ +     +  +   NWKER A  E  Q  V+    +++PCQ +++++  KPG K+ N QV++ K+ ++  I   G  + T+A++ +  L +KIGD+K  +N K  +T +++   LP  A QV+  A    N KN  E LNWLS+AIK+FGF ++ +   +  ++ A+  TNPAVR S I L G + LYV   +  + +DEKP++   ID E + ++  +PP PTRG+   +    +ATD            N + D++PR  I+ KIT  L++++ DK  K++KE L +V  II+ +  I  + +  L  A+     DS+ ++ +  +N+L  L  A    +  +++K +   +++   D K   R  A+  +N W E+ G    ++G  ++E LK +NP+ +  +  W++  L  L     P  L+        +PHL+S +E+R+ DVRK +Q+A+  FM+  GY+ M K      K + K  ++  L+KAKA +P     P+K + K              A   +      +   + K + +     +     G K+P+K+  + D D      +   + K+QR+++++  KV KW  +       +QL +Q S   +  L   +F +D +   KA+ ++   L E +KD + +    LDLILKW+ +RF +TN SVL K L+YL  +FT+L  +  + L E+E + FIP LI+K+G+PKD +R   + IL  +   Y   K+  F+ E   +K ++ R EC + L  LI+   ++V        LK +A+ I +RDN VR AALN +V+ +N  G+ + K++ +L +KD SML ERIKRS K           ++   +  +KP R Q  NS     R+ P   +S      +++  +P    +++ E    L  ++        E+ EL+Q  L+ I    L   P    K+R+ S        N+   I  +I  + S ++ TSIQA+ Q+ ++                                  E  +    T + K ++  L+++                         +++ ++  L EG  +IR +N+L V++LE S+QT +LSALL ++ D L    +  K+  L+ KC+W M + L +T++SI+L  I  DI +F   FP    + ++   + P+RT+KTL++++   KG   L+ L  I      +LE ++ +  +K ++       + T S +  E     +  +   KS+     + L +IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER   G+   S   S Q+        +   +SL   N     + P   L RLK LR+  GLD +  D
Sbjct:   15 KCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTLQNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----VDAYELLDAVEILSKLPKDFYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKVE------LVHGKKSGLATEKKESKPLPGRAAASGAAGDKDTKDVSGPKPGPLKKTPTAKAGGPSKKGKTTAPGGSASAGTKNKKGLETKEI-VEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMERTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVKTALAATNPAVRTSAITLLGVMYLYVGPSLRMIFEDEKPALLSQIDAEFQKMQGQSPPAPTRGIAKHS---TSATDEGEDGEEPGEGGNDVVDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPN-IGELPTALKGRLNDSNKILVQQTLNILQQLAVAMG-ANIRQHVKNLGIPVITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRST--PTDLIL------CVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKA-TGKLKPTSKDQVLAMLEKAKANMPSKPAAPAKAMSKPMGGSAPAKTQPIPAPVEDSVSSTIEAKPDLKKAKAPGVSSKAKSVQGKKVPSKTTLKEDDDKSGPIFIVVPNGKEQRMRDEKGLKVLKWNFTTPRDEYIEQLKTQMSTCVAKWLQDEMFHSDFQHHNKALAVMVDHL-ESEKDGVISC---LDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLS-EEEYHLTENEASSFIPYLILKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLIESYGMNVCQPTPGKALKEIAIHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAK--------RPSAAPVKQAEEKPQRTQNINSNANMLRKGPAEDMSSKLNQARSLSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEP----KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQLFQI----------------------------------ESLAREASTGVLKDLMHGLITL-------------------------MLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKE--KLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCR-MMKHSM-------DQTGSKSDKETEKGAS--RIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDTDIEPFLKNSSQFFQSYVERGLRVIEMERESKGRIPTSTGISPQMEVTCVPTPTSTVSSLGNTNGE--EVGPSVYLERLKILRQRCGLDNTKQD 1894          
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Match: sp|Q14008|CKAP5_HUMAN (Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3)

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 667/1991 (33.50%), Postives = 1074/1991 (53.94%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK--QASEATIV--------LPEKSAVVVAE-----KPIEPPKAE--KHAEXXXXXXXXXXXXXXXXXXXXXXGAASK----VPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGL-KNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-PEP------------IPSKQLPKAASSNGXXXXXXXXX--XXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSAT----REQPKPQISQL--PPKTIDINP----LLKEEIGYKLINVDK-------EVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKASQ-SVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQISVYG--SNQL------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFD 5867
            K EHK WKAR+ GYEEALK  Q     K P ++ +LGL+K  V DSNAV Q K LE  L++V+ A+VA K   ++  G+V+K FN  + K +EL  EI  + +EIE+ + V EEL+KGL  K PK++V  I  L++ L +FG KI+ +K + K + KL E R+K VR+  K + +E+YRWI   AL P L  I  VQ+ EL  E+ KLP   P P+R+L+SQ+  E+ L +    G             PQ    ID Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LF+ R F   +       LLK     L     DS PEVRDAAF+ LGTA+KVV EK + P+L  +D +KL +I E  EK +     +A +         LP ++A   A      K I  PK    K A A+K     K         +   G  +K      EI  E  +S +    KA+ +     +  +   NWKER A  E  Q  V+    +++PCQ ++R++  KPG K+ N QV++ K+ ++  I   G  + T+A++ +  L +KIGD+K  +N K  +T +++   LP  A QV+  A    N KN  E LNWLS+AIK+FGF  + +   +  ++ A+  TNPAVR + I L G + LYV   +    +DEKP++   ID E E ++  +PP PTRG+ K+ T   +   D +     +    ++ D++PR  I+ KIT  L++++ DK  K++KE L +V  II+ +  I  + +  L  A+     DS+ ++ +  +N+L  L  A    + ++++K +   +++   D K   R  A+  +N W E+ G    ++G  ++E LK +NP+ +  +  W++  L  L     P  L+        +PHL+S +E+R+ DVRK +Q+A+  FM+  GY+ M K      K + K  ++  L+KAK  +P  P P             P+K  P +A +     +S E     KKA       K  S +  KMP+K++ + D+D      +   + K+QR+++++  KV KW  +       +QL +Q S+  +  L   +F +D +   KA+ ++   L E +K+ +      LDLILKW+ +RF +TN SVL K L+YL  +FT+L  +  + L E+E + FIP L+VK+G+PKD +R   + IL  +   Y   K+  F+ E   +K ++ R EC + L  L++   ++V        LK +A+ I +RDN VR AALN +V+ +N  G+ + K++ +L +KD SML ERIKRS K           ++   +  +KP R +  S+     R+ P   +S      +++  +P    +++ E    L  ++        E+ EL+Q  L+ I    L   P    K+R+ S        N+   I  +I  + S ++ TSIQA+ QIDEV+R +D    +  ++D  +++  MQL+      +++EK  + EI  ++  ++  ++S+F  + LA E +   L +LM  ++ ++++ ++  L EG  +IR +N+L V++LE S+QT +LSALL ++ D L    +  K+  L+ KC+W M + L +T++SI+L  I  DI +F   FP    + ++   + P+RT+KTL++++   KG   L+ L  I      +LE ++ +  +K ++       + T S +  E     +  +   KS+     + L +IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +IS     S Q+        +   +S+   N     + P   L RLK LR+  GLD +  D
Sbjct:   15 KCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWI-RDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----IDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKIKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKPGPLKKAPAAKAGGPPKKGKPAAPGGAGNTGTKNKKGLETKEI-VEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMDRTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVVSMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLGVMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDEPDDGSN---DVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPN-IGELPTALKGRLNDSNKILVQQTLNILQQLAVAMG-PNIKQHVKNLGIPIITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRST--PTDLIL------CVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKA-TGKLKPTSKDQVLAMLEKAKVNMPAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEPKPDPKKAKAPGLSSKAKSAQGKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRDEYIEQLKTQMSSCVAKWLQDEMFHSDFQHHNKALAVMVDHL-ESEKEGVIGC---LDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLS-EEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAK--------RPSAAPIKQVEEKPQRAQNISSNANMLRKGPAEDMSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEP----KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEIIKLYSCIIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKE--KLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCR-MMKHSM-------DQTGSKSDKETEKGAS--RIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGE--EVGPSVYLERLKILRQRCGLDNTKQD 1954          
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Match: sp|A2AGT5|CKAP5_MOUSE (Cytoskeleton-associated protein 5 OS=Mus musculus OX=10090 GN=Ckap5 PE=1 SV=1)

HSP 1 Score: 959.903 bits (2480), Expect = 0.000e+0
Identity = 663/1997 (33.20%), Postives = 1060/1997 (53.08%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEP-----------------------PKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASK----VPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGF-KIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELN-LEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPK--------------AASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXG-KMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSR-QRENSAT---REQPKPQISQL--PPKTIDINP----LLKEEIGYKLINVDK-------EVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKA-SQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER---GQPQISVYGSNQL------NNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFD 5867
            K EHK WKAR+ GYEEALK  Q     K P ++ YLGL+K  V DSNAV Q K LE  L++V+ A+VA K   ++  G+V+K FN  + K +EL  EI  + VEIE+ + V EEL+KGL  K PK++V  I  L++ L +FG KI+ +K + K + KL E RDK VR+  K   IE+YRW    A+   L  I  VQ+ EL  E+ KLP   P PSR+L+SQ+  E+ L +    G             PQ    +D Y+L+D VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LF+ R F   +       LLK     L     DS PEVRDAAF+ LGTA+KVV EK + P+L  +D +KL RI E  EK +      +V  +KS +   +K  +P                       P   K    +K    SK         S   G  +K      EI  E  +S +    KA+ +     +  +   NWKER A  E  Q  V+    +++PCQ +++++  KPG K+ N QV++ K+ ++  I   G  + T+A++ +  L +KIGD+K  +N K  +T +++   LP  A QV+  A    N KN  E LNWLS+AIK+FGF ++ +   +  ++ A+  TNPAVR S I L G + LYV   +  + +DEKP++   ID E + ++  +PP PTRG+   +    +ATD            N + D++PR  I+ KIT  L++++ DK  K++KE L +V  II+ +  I  + +  L  A+     DS+ ++ +  +N+L  L  A    +  +++K +   +++   D K   R  A+  +N W E+ G    ++G  ++E LK +NP+ +  +  W++  L  L     P  L+        +PHL+S +++R+ DVRK +Q+A+  FM+  GY+ M K      K + K  ++  L+KAKA +P     P+K + K              A   +      +   + K + +     +     G K+P+K+  + D D      +   + K+QR+++++  KV KW  +       +QL +Q S   +  L   +F +D +   KA+ ++   L E +KD + +    LDLILKW+ +RF +TN SVL K L+YL  +FT+L  +  + L E+E + FIP LI+K+G+PKD +R   + IL  +   Y   K+  F+ E   +K ++ R EC + L  LI+   ++V        LK +A+ I +RDN VR AALN +V+ +N  G+ + K++ +L +KD SML ERIKRS K           ++   +  +KP R Q  NS     R+ P   +S      +++  +P    +++ E    L  ++        E+ EL+Q  L+ I    L   P    K+R+ S        N+   I  +I  + S ++ TSIQA+ QIDEV+R +D    +  ++D  +++  MQL+      +++EK  + EI  ++  ++  ++S+F  + LA E +   L +LM  ++ ++++ ++  L EG  +IR +N+L V++LE S+QT +LSALL ++ D L    +  K+  L+ KC+W M + L +T++SI+L  I  DI +F   FP    + ++   + P+RT+KTL++++   KG   L+ L  I      +LE ++ +  +K ++       + T S +  E     +  +   KS+     + L +IF KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER   G+   S   S Q+        +   +SL   N     + P   L RLK LR+  GLD +  D
Sbjct:   15 KCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTLQNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----VDAYELLDAVEILSKLPKDFYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKVE------LVHGKKSGLATEKKESKPLPGRAAASGAAGDKDTKDVSGPKPGPLKKTPTAKAGGPSKKGKTTAPGGSASAGTKNKKGLETKEI-VEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMERTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVKTALAATNPAVRTSAITLLGVMYLYVGPSLRMIFEDEKPALLSQIDAEFQKMQGQSPPAPTRGIAKHS---TSATDEGEDGEEPGEGGNDVVDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPN-IGELPTALKGRLNDSNKILVQQTLNILQQLAVAMG-ANIRQHVKNLGIPVITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRST--PTDLIL------CVPHLYSCLKDRNGDVRKKAQDALPFFMMHLGYEKMAKA-TGKLKPTSKDQVLAMLEKAKANMPSKPAAPAKAMSKPMGGSAPAKTQPIPAPVEDSVSSTIEAKPDLKKAKAPGVSSKAKSVQGKKVPSKTTLKEDDDKSGPIFIVVPNGKEQRMRDEKGLKVLKWNFTTPRDEYIEQLKTQMSTCVAKWLQDEMFHSDFQHHNKALAVMVDHL-ESEKDGVISC---LDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLS-EEEYHLTENEASSFIPYLILKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLIESYGMNVCQPTPGKALKEIAIHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAK--------RPSAAPVKQAEEKPQRTQNINSNANMLRKGPAEDMSSKLNQARSLSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEP----KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYSTHMADEKLDKDEIIKLYSCIIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKE--KLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCR-MMKHSM-------DQTGSKSDKETEKGAS--RIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDTDIEPFLKNSSQFFQSYVERGLRVIEMERESKGRIPTSTGISPQMEVTCVPTPTSTVSSLGNTNGE--EVGPSVYLERLKILRQRCGLDNTKQD 1954          
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Match: sp|Q9VEZ3|MSPS_DROME (Protein mini spindles OS=Drosophila melanogaster OX=7227 GN=msps PE=1 SV=3)

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 510/1431 (35.64%), Postives = 801/1431 (55.97%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSA-------------VVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIP--TESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKN-QVPSDIPCQLIIRLIL-MKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNET-PVVENATDSEVVATHAVPE---LNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-PEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQL-----NSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRS 4283
            MAE  ++K L   ++  HK WKARV+GYEEA K  +  D  K P ++ + GL+K MV+DSNA+AQEK LE  L+FV+ + +A +   D+  GIV KC  + + KT+EL+ ++  + VEIE+Q+ V+EEL+KG+  K PK+V   +      LR+FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   + + LEKFKEKK NVV ALR+ ID+ + +TS++A  E ++ +L++K PSVKSETALF+ R   ++       KLLK +   L     +  P VRD++ + LGT +K++ +K + P L  +D +K+A+I E  EKA+   +  +  P+K                      ++P    + A    +    KPA       +  P AA K    P  TE  ++ +++  K+ +I     L  +VD NWK R AA E L   +           Q++IR I   KPGLK+ N QVLK K+++I+ +  N  +T TT ++ I ++ EK+ D KN       L+  ++   L  V  +V+  A E  + K   EA NW++ +I +FGF++    L+  +R  VQ TNP VR S I++ GT+S+Y+ + +      EKP++K  I  E +      PP P RG++  +     N+ D+E     A  E   +N+ D++PR +I  +IT+ LL ++SDK  K + E L  +  IIS  A +    +  L  A+     DS+  I++  + +   L  A        +++ + P  L +  D K   R  A+  +N + EK G+    +   + +ALK  +P  K+ ++AW++  L  L     PK +   D  S ++PHL++ I +R+ DVRK + EAVL  M+  G+D M +      K + K  I+  L+KA+  LPV P P    Q P       K      A        +   +    +  ++P +     D+D     LL  NS K QR+ +++K KV KW T +   ++      +   +A+ +  L   +F  D +  +K IE     LSED   + +A   NLDLILKW+ +RF +TNPSVL KGL+YL +VF +L +D  + L E+E + F+P L++K+GDPKD VR   +++L+ +   +  +K+  ++ E L +K AR R EC D L +LI+   +++  Q + ++ +A  IS+RDN+VR AALNC+V      GE   K++  L++KD SML ERIKR+
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAE--IKIKVAGPKKETRPASAPTAKAAAPAKTVAGSVDPKPVTRPATTGARKVLKKPATVSGGGATSAPTAALKAGGKPLATEREITPEELQEKSEEILPAEILNGLVDSNWKNRLAAVEQLLGEISGFDAKQAGISQILIRTISGRKPGLKEMNFQVLKFKLDIIRSVAENYPLTTTTVDLVINEIIEKLADAKNGAAAADVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQPKTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGKALMMFFDSEKPALKSQIQVEFDKNVGEKPPKPVRGVQRSSGGTAGNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIIS-EARLIKPSIGDLAPALAHRLVDSNAKIAQTTLAICEQLATAMG-AGCRNHVRNLFPGFLHALGDNKSFVRAAALNCINSFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLP----PKSVSKEDIHS-MVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRAL-DKQKPASKKDILAALEKARPNLPVKPLPKGKHQAPIPEEPKLKTVRGGGAGGAPGIQKSATARVAGGQDKQVPARKK---DEDIDTSPLLCANSAKNQRLLDEQKMKVLKW-TFVTPREEFTELLRDQMMTANVNKALIANMFHDDFRYHLKVIEQ----LSEDLAGNSKALVCNLDLILKWLTLRFYDTNPSVLIKGLEYLVQVFQVL-IDEEYILAENEGSSFVPHLLLKIGDPKDAVRNGVRRVLRQVILVFPFVKVFGYVMEGLKSKNARQRTECLDELTFLIESYGMNICPQ-SAVREIARQISDRDNSVRNAALNCIVQVFFLSGEKTYKMIGHLNEKDLSMLDERIKRA 1407          

HSP 2 Score: 107.842 bits (268), Expect = 8.953e-22
Identity = 97/398 (24.37%), Postives = 185/398 (46.48%), Query Frame = 3
Query: 4617 ITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVV-KSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLN-------NSGAAASLDKDNLAY 5786
            +  VI  ++S +   +  A+ ++  +I   + +  L  Y +  + ++  Q K     LS+   ++S +  +++ +L+ L + F+A  L   L+   + NLM ++L ++ + +L ++ +     + IN + +++L+  + T +  AL+R++ +         K+ +L+ KCIW   K L    + ++   +  ++  F    P   W+ R S  D P+RT+KT+++++   KG   L+ L QI    + +L TY+ +           +L N     +   I  +  + K +  K  +    + +  IF  I   +  +QGL  LYDFK + P +DLS +L  ++  F + IE GL  I  ER Q      GS Q N       N+G       D L Y
Sbjct: 1601 LVKVIKGVSSTDTLKARAAINELAAIIEAPEKQAVLRDYEEIFIQNVLAQFK----NLSQIPSAQSVV--VYQPLLSILYTFFHANILGKTLSVACIKNLMSALLNLMADPKL-AVGDDSQYNKVINGICLKVLDKVDFTNLNCALIRLLRETCPEAKL-PKFTDLLMKCIWRNVKMLPERSNELNYDAVILEVHEFMLALPSTWWQNRPS--DTPMRTIKTILHNMAKVKGNAILQHLNQIPT--HSELHTYLIR-----------ILKNFQKDGSASGIGASPQRAKEIASKRISHQTHDTVSQIFKLISDRDTKQQGLQKLYDFKQQNPDIDLSTFLQGSSAPFHKYIEEGLAEI--ERNQNA----GSTQDNRTDVNYQNNGPDPDFWMDRLQY 1969          
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Match: sp|Q9PT63|CKAP5_XENLA (Cytoskeleton-associated protein 5-A OS=Xenopus laevis OX=8355 GN=ckap5-a PE=1 SV=1)

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 397/1109 (35.80%), Postives = 616/1109 (55.55%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDA---------VPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKA------KQASEATIVLPEKSAVVVAEKPI-------EPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATD-----IFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPV-----PEPIPSKQLPKAA 3344
            K EHK WKAR+ GYEEA+K  Q     K P ++ YLGL+K  V +SNAVAQ K LE  L++V+ A+VA K   ++  G+VNK FN  + + +EL  +I  + VEIE+ +VV EEL+KGL  K PK+VV  +  +++ L +FG KI+ +K + K + KL E R+K +R+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  +R+L+SQ+  ++   +    GD          VPQ            +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L  V+ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K P++K +T+LFL R F   +       LLK     L     DS PEVRDAAF+ LGTA KVV EK + P+L ++D +KL RI E  +KA      K  + A      K+      KP+       E    +  A   K PA       K        GA +K  +      + E +++ +A +     +   + + Q+   NWKER A+ E  Q  V++   +DIPCQ +++++  KPG K+ N QV++ K+ ++  I   G  + T+A   +  L +K+GD+K   N K  L+ +++   LP  A QV+  A    N KN  E LNWLS+AIK+FGF  I +   +  ++ A+  TNPA+R S I L G + LY+   +    ++EKP++   ID E E +K   PPV  RG K+ +   E     E          ++ D++PR +I+ KI+ +L++++ DK  K++KE L +VT II+ +  I    +  L  A+     DS+ ++ +  + +L  L  A    + ++++K +   +++   D K   R  A+  L  W ++ G  + ++G  ++E LK +NP+ +  +  W++         KLP     P      +P+L++ +E+R+ DVRK +QEA+  FM+  G++ M K   S  K + K  ++  L+KAKA +P      P    SKQ P  A
Sbjct:   15 KCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKRFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVNGVVNKVFNQPKARAKELGADICLMYVEIEKAEVVQEELLKGLDNKNPKIVVACVETVRKALSEFGSKIMTLKPIIKVLPKLFESREKAIRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQTRFLRSQQDLKAKFEQQQAAGDDGGDDGEEEIVPQ------------VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKTVVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPAIKQQTSLFLARSFRHCTPSTLPKSLLKPFCVALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECADKAELANGKKGGAAAGEKKETKAPAAAPGKPVPNQGAAAEKDAGKAAAAPKKAPAAKPGGPVKKAKAPASSGATAKGKKAVENKEIIEQELSPEACEERAAAVLPASCMQQLDSSNWKERLASMEEFQKTVESMERNDIPCQALVKMLAKKPGFKETNFQVMQMKLHIVALIAQKGNFSKTSACAVLDGLVDKVGDVKCGGNAKEALSGIAEACTLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFISNVKTALAATNPAIRTSAITLLGVMYLYMGAPLRMFFEEEKPALLSQIDAEFEKMKGQTPPVSIRGSKHGSGRDEGEEGEEQDEDAPA---DVTDLLPRTDISDKISSDLVSKIEDKNWKIRKEGLDEVTAIINEAKFIQ-PSIGELPSALKGRLNDSNKILVQQTLTILQQLSTAMG-HNIKQHVKNLGMPIITVLGDSKANVRAAALGTLKSWVDQTGMKDWLEGEDLSEELKKENPFLRQELLGWLA--------EKLPSMRTVPSDLQLCVPYLYNCLEDRNGDVRKKAQEALPIFMMHIGFEKMSKA-TSKLKPASKDQVVALLEKAKASMPAKPAGPPGKASSKQPPAVA 1096          

HSP 2 Score: 286.574 bits (732), Expect = 2.796e-76
Identity = 238/844 (28.20%), Postives = 426/844 (50.47%), Query Frame = 3
Query: 3441 KMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQ---QLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQ--KNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSR-QRENSATREQPKP--------QISQLPPKTIDINPLLKE------EIGYKLINVDKEVEELLQ-PLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLK-ATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQI------SVYGSNQ-----LNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDK 5870
            K P+K N + ++D      +   + K+QR+++++  KV KW  +    +   QL +Q S   +  L   LF  D ++ +K + ++   L  + +  I      LDL+LKW  +RF +TN SVL K L+YL  +F +L  +  + L E E   F+P L++K+G+PKD VR   + IL  +   Y   K+  F+ E   +K ++ R EC + L  L++   ++V        LK +A+ I +RD  VR AALN +V+ +N  GE + K++ +L +KD SML ERIKR+        +    ++ + +  +KP R Q  N++   +  P        Q   +   T   + + +E      EI      V  E+  L+Q  L++I    L   P +      +    S + ++ + + S + +++ N    SIQA+AQIDEV+R +D    +  ++D  +++  MQL+ A    +++E+  + +I  ++  ++  ++S+F  + LA E +   L +LM  ++ ++++ ++  L EG  ++R +N+L V++LE S+QT ++SALL ++ D L    +   +  L+ KC+W M + L   +++++L  I  DI  F    P    +  +S  ++P+RT+KTL++++   KG   ++ L  I      +LE ++      L V   ++    +      E   +  + K V K+N   +L E+   F KIG  E  K+GL +LY++K KY   D+  +L  ++ +FQ  +E GL+ I  ER G+ +I      S + +       + N+ A  S    N     + P   L RLK LR+  GLD +  D+
Sbjct: 1176 KAPSKPNAKDEEDKSGPIYIIVPNGKEQRVKDEKALKVLKWNFTTPRDEYIEQLKTQMSPCIARWLQDELFHADFQRQIKGLAVMTEHLESEKEGVISC----LDLVLKWFTLRFFDTNTSVLMKCLEYLKLLFIMLSQEE-YHLTEMEGTSFLPYLMLKVGEPKDIVRKDVRAILTKMCQVYPASKMFNFVMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPAKALKEIAIHIGDRDTTVRNAALNTIVTVYNVHGEQVFKLIGNLSEKDMSMLEERIKRA-------GKKQAAAAPAKQVEEKPQRVQSANASILRKAPPEDMSSKLNQARNMGGHTEPSHSVPREFQLDLDEIENDNGTVRCEMPALVQHKLDEIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFVISQVASVDIN---ASIQALAQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLAYNTHMADERLDKDDIVRLYSCIIGNMISLFQMESLAREASTGVLKDLMHGLISLMLDARIEDLEEGQQVVRSVNLLVVKVLEKSDQTNIISALLMLLQDSLLATASSPNFSELVMKCLWRMIRLLPEAINNLNLDRILLDIHNFMRVLPKEKLKQHKS--EMPMRTLKTLLHTLCKLKGPKIMDHLSMIENKHESELEAHL------LRVMKHSIDRTGSKGDKETEKGASCIEDK-VGKANVSDFLAEM---FKKIGSKENTKEGLAELYEYKKKYSDADIKPFLKNSSQFFQSYVERGLRLIEMEREGKARIAPNTGMSTHVTEMTPLPTVTNTAAPVS----NTNGEEVGPSVYLERLKILRQRCGLDNAKQDE 1988          

HSP 3 Score: 87.0409 bits (214), Expect = 1.953e-15
Identity = 120/528 (22.73%), Postives = 223/528 (42.23%), Query Frame = 3
Query:  105 NTLDKIEHKNWKARV---EGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVI-----DSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIK-GLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACM--EELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIV-LPEKSAVVVAEKPIEPP 1652
            + + +++  NWK R+   E +++ +++M+ +D        P   LVK +       ++N    +  L ++ L  Q+ N +  +A  +  G+V+K  +    K    A E L  I E        E+++    + K PK    ++N L   +++FG   + +K     V   L   +  +R +   L+  MY ++G+  L     + KP  +++++AEFEK+           K Q P  S  ++ +  G    +   G+    +   D  DL+   ++  KI ++   +IE+K W  RK+ L+ +  + N  K +    G+L  S LK    D+N +LV  +  I+ Q++T +      +  N     +    + K NV  A    + S    T +   +  E+L   L  + P ++ E    L  + EK          L+  +P L N   D   +VR  A + L             P    M ++   ++++   K K AS+  +V L EK+   +  KP  PP
Sbjct:  600 SCMQQLDSSNWKERLASMEEFQKTVESMERNDI-------PCQALVKMLAKKPGFKETNFQVMQMKLHIVALIAQKGNFSKTSACAVLDGLVDKVGDV---KCGGNAKEALSGIAEACTLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFISNVKTALAATNPAIRTSAITLLGVMYLYMGA-PLRMFFEEEKPALLSQIDAEFEKM-----------KGQTPPVS--IRGSKHGSGRDEGEEGEEQDEDAPADVTDLLPRTDISDKISSDLVSKIEDKNWKIRKEGLDEVTAIINEAKFIQPSIGEL-PSALKGRLNDSNKILVQQTLTILQQLSTAMGHNIKQHVKNLGMPIITVLGDSKANVRAAALGTLKSWVDQTGMKDWLEGEDLSEELKKENPFLRQE---LLGWLAEKLPSMRTVPSDLQLCVPYLYNCLEDRNGDVRKKAQEAL-------------PIF--MMHIGFEKMSKATSKLKPASKDQVVALLEKAKASMPAKPAGPP 1084          
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Match: sp|Q94FN2|MOR1_ARATH (Protein MOR1 OS=Arabidopsis thaliana OX=3702 GN=MOR1 PE=1 SV=1)

HSP 1 Score: 483.026 bits (1242), Expect = 2.742e-138
Identity = 510/1952 (26.13%), Postives = 874/1952 (44.77%), Query Frame = 3
Query:  114 DKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANV-ANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVL-SQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKE-SALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIP-ANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDAC--MEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCL-DSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFY---------------------EKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAAS-KVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIV-TNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKI-PINDLVPFIR-LAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVES--LKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIIS-ASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVV--------DGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLF----SAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQL----DKDAVVMALL-AKNSNKKQRIQEDRKKKVTKW----ETSLASSQQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSATREQPKPQISQLPPKTIDINPLLKEEIGYKLINVDKEVEELLQP-----LEKITLRYLPM--------GPS----LLDKLRSYSGKASQSVNSNDAITSVIH--AINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVM-SITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTR---MLSALLRMMSD------------CLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGG---GALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNI 5687
            D++ HKNWK R E   +           KDP    +  L +  V DSNA  QEKAL+ ++ F++ A+  A + A ++C  I  KC    R+ T + A     + VE+E  DV ++ + K +  K  K VV +++V+ + L +FG K++P K + K + +L + +D+NVR + K + +E+ RWIG   +  +L  +++     EL AE   +      P+R ++S++ KE  A       GD   +++V   PQ   +ID YDL+DPV++++ +  + ++D ++  KW++RK+A+  + KL +  K+ PG++ ++ ++L K+++ D N+ +   + + I  +A GLR  FS  +   +   LEK KEKK +V   L   + + +    ++    +E++  A+ +K P V+S T  +L    E S+  +   K  K+ +P L   CL D  P+VRDAAF  L    K V  + L+  L+K+D+V+  +++E                         A   S+A+ V    ++++  ++P         A+ASKK    KP   K     +  G+ S + PE    + M  +++  +   +     ++Q+    WKER  A   L+  ++     D   ++++RL+   PG  + N QV +  IE+I  I  T  +       +CIT  +E++ DIK   +    LT   + +    V  ++ K   E+ N K L E L W+  A+ DFG  +  + DL+ F + + +Q +  A R + IKL G +  +V   I   L D KP++   +D E E    + T  P         T       DS                +PRE+I+ KIT NLL        K++ ES+  V KI+  A+  I   G   L   +     DS+  +    +  +  +  A      EK  K ++  +L    D K   RE  + AL++W   V    ++        DG    E  K         +F W++  LT LS           DF   I  HL     +A+ ++S DVRK ++  +   + V G +++ KN K     +        L+K +    V EP  S +      S G    SK  +N       + +         +P K + Q+    D      ALL  K+SNK     EDR++ V +     E      Q L +        +L + L + D KK +  +E+L   L    K+ IE     LD++L+W V++F ++N + L K L++L  +F  L  D  + + E E   F+P L  K+G   ++VR   ++++K I   Y   K   ++ E L +K  R R EC D + YL++    ++G     L  VA L +ERD  +R AALN + + +  +G D+ K +  L D  +SM+ +R K   K +                     ++RE      +P    + L     D  P + E+ G    ++ + V   L P     + +  L   P+        GP+     LD +    G   QSV   + +  V H  A  SN+ + S      IDE++++ D    LVS + N V  +  + L     R               K +L TL+  F  K+LA  +    L +L+  +L  ++++++  + +G  +++ +N+L ++IL+++++T    +L +LLR +               ++N     K+ +L+ KC+  +TK L +T++ +DL  + + I ++  D        R    D PLR VKT+++ ++  +G    G L +L  I   P   +  YI  +   L          P   ++  +   T N P     S +    +EL  IF KIG  + +  GL DLY     YP VD+   L   +  F+  I  GL  +
Sbjct:   19 DRLGHKNWKVRNEANVDLASVFDSITDPKDPRLRDFGHLFRKTVADSNAPVQEKALDALIAFLRAADSDAGRYAKEVCDAIALKCLTG-RKNTVDKAQAAFLLWVELEAVDVFLDTMEKAIKNKVAKAVVPAVDVMFQALSEFGSKVIPPKRILKMLPELFDHQDQNVRASAKGVTLELCRWIGKDPVKSILFEKMRDTMKKELEAELANV-TAGAKPTRKIRSEQDKEPEAEASSDVVGDGPSEEAVADAPQ---EIDEYDLMDPVDILTPLEKSGFWDGVKATKWSERKEAVAELTKLASTKKIAPGDFSEICRTLKKLIT-DVNLAVAVEAIQAIGNLACGLRTHFSASSRFMLPVLLEKLKEKKQSVTDPLTQTLQTMYKAGCLNLVDVIEDVKTAVKNKVPLVRSSTLTWLTFCLETSNKALIL-KAHKEYVP-LCMECLNDGTPDVRDAAFSALAAIAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGGGDQAGTSSVTVQSSVGSTATGNSDASFVRKSAASMLSGKRPA------PSAQASKKVGTGKPGGGKKDGSVRNEGSKSVEPPEDVEPAEMGLEEIENRLGSLVKPETVSQLKSSVWKERLEATLALKEEIEGLQELDKSVEILVRLLCAVPGWNEKNVQVQQQVIEIITYISSTAAKFPKKCVVLCITGTSERVADIKTRASAMKCLTAFCEAVGPGFVFERLFKIMKEHKNPKVLSEGLLWMVSAVDDFGVSLLKLKDLIDFCKDVGLQSSTAATRNATIKLLGALHKFVGPDIKGFLNDVKPALLSALDTEYEKNPFEGTAAPKRVVKTSVSTSTSSGGLDS----------------LPREDISTKITPNLLKGFESPDWKMRLESIEAVNKILEEANKRIQPTGTGELFGGLRGRLLDSNKNLVMQTLTTIGGVAAAMGPA-VEKASKGILSDVLKCLGDNKKHMRECTLAALDLWLGAVHLDKMIPYIIIALTDGKMGAEGRK--------DLFDWLTKQLTGLS-----------DFVDAI--HLLKPASTAMTDKSADVRKAAEGCISEILRVSGQEMIEKNLKDIQGPALAL----VLEKVRPGF-VQEPFESSKAMAGPVSKGVTKISKSTSNGTLKQGNRSRA--------VPTKGSSQITSVHDIAIQSQALLNTKDSNK-----EDRERVVVRRIKFEELRPEQIQDLENDMMKFFREDLQKRLLSPDFKKQVDGLEILQKALPSVSKEIIEV----LDVLLRWFVLQFCKSNTTCLLKVLEFLPELFNTL-RDEEYCMTEAEAAIFLPCLAEKLGHNIEKVREKMRELMKQIIQAYSVGKTYPYILEGLRSKNNRTRIECTDLIGYLLETCGTEIGGLLKYLNIVASLTAERDGELRKAALNTMATGYQILGADIWKYVGKLTDAQKSMIDDRFKWKAKDM--------------------EKRREG-----KPGEARAALRRSVRDSGPEVAEQSG----DISQTVPGPLFPRQSYGISEQMLERTPVPRTIAGVNGPTDWNEALDII--MFGSPEQSV---EGMKVVCHELAQASNDPEES-----AIDELVKDAD---GLVSCLANKVAKTFDVSLMGASSR-------------SCKYVLNTLMQTFQNKKLAHAVKEGTLESLITELLLWLLDERVPRMEDGSQLLKALNVLMLKILDNADRTSSFVVLISLLRPLDPSRWPSPATAEVYAVRN----QKFSDLVVKCLIKLTKLLQSTIYEVDLDRLLQSIHVYLQDLGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHL-SLVPIDMRPQPIILAYIDLNLETLAAARMLTATGPVGQTHWTD--STANNPSPPANSADVQLKQELGAIFKKIGDKQTSTIGLYDLYHITKSYPKVDIFSQLQNASEAFRTYIRDGLAQV 1833          
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Match: A0A095C1F5 (Cytoskeleton-associated protein 5 OS=Schistosoma haematobium OX=6185 GN=MS3_03636 PE=4 SV=1)

HSP 1 Score: 1159.44 bits (2998), Expect = 0.000e+0
Identity = 737/2018 (36.52%), Postives = 1171/2018 (58.03%), Query Frame = 3
Query:   90 DFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQ----NNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEK-AKQASEAT-----IVLPEKSAVVVAEKPIEPPKA---------------EKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTT-AEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNET---------PVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGI--SGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEP--------IPSKQL------PKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGK----------MPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSAS-CSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNL---LKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGK-PVXXXXXXXXXXXXXXXXXQK--PS--------------RQRENSATREQPKPQISQLPPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGR-LSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERG-QPQISV-------YGSNQLNNSGAAASLDKDNLAYCN----MDPESLLLRLKQLRKNAGL 5849
            D+  L TL K++HK W ARV GYEEA K      +GK P+FN Y+GL+K  V DS+A AQEKAL+ +L +++ A  A K A DIC GI++KC  STR KT++ + E L +++EIER ++V+EELIKGLS K PKVVVGS+  L+E L  FGP +VP+K +FK   +LL+DRD+ +R   K LI+E+YRWIG T  + +L  IKPV +TEL   F  +P  KPV  RYL+SQKPKE   + P  G ++ P    G  P     + VD+D  D++ PVEV+SKIP++Y+ QI EKKW DR+DALE +EK+TN P++VPG++ DL++SL++V++KDTNI+LV L+AKI+ QIA GL+ KFSPY+  T+QA L KFKEKK NVV+ALR+  D A  + S+D  +++++ AL+HKTP+V++E AL L+R F+K S      K+LK     L   C D+VPEVR+ +F  LG AM VV+ K ++P+L ++D+++LA+INE  E+ A + S +      +  P  +    A+    P +A               E ++E + K   S P++KK  A+++     SK   IPTE++++ED+++ KA+++ GEA + Q+ D NWKER  A E +++ + +   SD+P Q++ R +L+KPG+KD N QVL+A+IE I+ +++      +  AE+ ++DL EK+GD K  D  K  +T++++  +L LV   +++T  +  N ++  E L WL+ +I++FGF IP  ++ P ++  +  TNP+VRQ+ + LAGTI LY+ + + +LL  EKP++  L++ E    K    P PTR    +T         P    A   ++  T  + E++ + ++P+ +I+ ++T  LL  L  K  K + E+L  +   IS S  I  S   LQ  +  I K+  D +  ++K A+ +L S  ++  K DA  YIK V P +L    D K + RE AVTAL+ W  +V   +V +   + +ALK++NP+ ++ +  W+   L+ +  N L K     +    ++P +F+++E+R+ + RK +Q  +   + VFG++ ++K+  +  K + K +IM  L+KA+  +    P         PSK +      P   SSN      + +   + +  +      S    K             KS  +L   ++++      S K  R+ +++K+K+ KW+    +    QQL++ F+A+  +PE   LLF TD K+ +KAIE L+  L  D  +  EAT  N+D+IL+W+V+RF ETNP VL + +DYL ++F  +  +S   L EHE   F+P L++K+G+PKD +R   + ILKL+   Y   ++  FL      KT++ RQEC D +  LID   ++V  Q ++   +K +A  I +RD+ VR+AALN L+SA+  IGE + K++  + +K+RSML ERIKR+G+ P+++      ++ +    T +  PS              RQ+  SA   + +  +++L     D++P  K      LI +D ++ +L QP+E   L+     P L   LR+    AS       AIT V+ AI+SN++  S  A+A+ID V+R++     L+++++ ++M ITMQL+    R   +   SE ++  + +  LAT+ S+F+   L  E +R+ L  L QS+L+ +++++   +S G  +IR IN L V ILE+SN TR+LSAL+R++ +C+ NG   +++   I K IW +TK +    ++  + VI  D   F   FPP  W AR+S  DVPLRT+KTL++ +   +G   L+ L  I    + +LE+Y+ ++ LK    + T     +DS  I  ++   +   FV+ +  R   E+L +IF K+G  ++  +GLN+LYDF   YP VDLS YL+ T+ +FQ  I+  L+NIA ER  Q ++SV         ++Q N   A ++ + D  A  +     DP+  + RL  LR+  GL
Sbjct:    6 DWSKLPTLSKVQHKLWNARVAGYEEAFKIFSTETNGKSPVFNEYVGLMKKFVTDSHAGAQEKALDAVLAYIETAAAATKCAGDICAGIISKCLGSTRMKTKDKSIECLLMLIEIERHELVIEELIKGLSTKNPKVVVGSLQTLREALNLFGPTVVPIKPLFKEFGRLLDDRDQGIRNETKNLIVEVYRWIGVTTKD-LLKDIKPVVMTELCELFNSIPPGKPVRLRYLRSQKPKE---ITPDTGAESNPID--GAIPDGTLTDQVDLD--DMITPVEVLSKIPSDYWQQIGEKKWQDRRDALEALEKITNVPRIVPGDFTDLVRSLIQVVNKDTNIILVTLAAKILGQIARGLKSKFSPYSQQTLQACLGKFKEKKPNVVQALRESADGAVSSASLDHFVDDIVAALSHKTPNVRAEAALILSRAFKKCSATSLNKKVLKSFTVPLCVTCNDTVPEVRECSFAALGAAMFVVSAKTIQPFLSELDSIRLAKINECCERIASELSNSNNSGNQLTAPSTNMSTSAKPNTVPRRAAPPVTRPNTASSGTGEANSECATKTPTSGPSSKKSTARTKSVIEKSKF-TIPTENLLTEDEISQKASELLGEALIKQLSDTNWKERLQAVEQMKSNIHSFTSSDVPTQILCRAVLLKPGIKDTNFQVLRARIEYIEAVLSLSVSISSNLAELLLSDLIEKVGDTKVGDVTKIAMTKLAEKTSLELVGGFIMRTLFQIKNPRSQTEGLAWLNQSIQEFGFCIPPQEVGPLLKTGLNATNPSVRQNSLNLAGTIHLYLHDRLPALLAGEKPALITLLNAEFAKNKDKKAPAPTRFSAAQTLLKESVSAAPSGTEALSRDIETTGQIEEMDSDVLLPKVDISDRLTPELLGLLKSKVWKERLEALTTIENFISPSHLIDASNGKLQEPLTMIAKAANDVNKNLAKQALIILSSFASSIPKSDAVNYIKYVEPPILLCLGDSKVQIREAAVTALSSWQSRVPILSVFENNMLADALKMENPFLRAELLRWLQDVLSPMPLNALRKN--ASEITENLIPQVFASLEDRNVEARKQAQLVLPSLIQVFGWEPILKS-TNRLKPTSKDSIMPHLEKARESVANSHPSSMEKKTSSPSKAVRVGNGAPPQPSSNAPATTPENSEESENATQSSGNTSKSVSDTKKKADNKKSINTSKKSGPELATTSIILP--PNKSAKSSRLNDEKKRKLLKWDFDAPTKDHIQQLSTLFTAAGTAPEFHALLFHTDFKQHIKAIEQLSQLL--DTTEGCEATVINVDIILRWIVLRFFETNPVVLGRCMDYLTKLFVFMS-ESGANLSEHEGGSFLPYLVMKVGEPKDIIRQNIRGILKLVVNLYPPSRLFTFLTNGTKAKTSKTRQECLDEMGSLIDRFGLNVC-QPSIPVAIKLIAQQIGDRDSGVRSAALNALLSAYAVIGEQIWKVIGDIPEKERSMLEERIKRAGQIPINTVDNFEPKTPSVRPSTARRDPSDSRNPLEPVPNEFRRQQPVSAAHARARAMLNELG----DLSP-EKAPCMPPLIQLDADINDLFQPVEIPALKAHVRQPVLNALLRTSPDTAS-------AITMVVTAISSNDLLISCHALAEIDTVLRDEKWYL-LLNHVNQVLMLITMQLRQVTSRYFGDPSVSEEQLHTLIRSHLATIESLFSRPTLGREASRETLRELSQSLLQTMLDERTAEMSSGENVIRSINALFVLILEASNGTRILSALIRLLHECISNGHFTNRFTQAILKSIWRITKGMNTAFNNYSVDVILLDCHHFLKAFPPSSWSARKS--DVPLRTIKTLLHVLCGLQGPSILQFLESIPNKEDSELESYLIRT-LKTTSGVTTT----SDSKKI--LASESHSKGFVLSTATR---EKLTEIFKKVG-SKKPDEGLNELYDFTQLYPDVDLSSYLTNTSQFFQAYIKQALRNIAVERARQARLSVNDKEPNTLAAHQTNGILARSNWNPDFDADISNGQLTDPKVFMNRLAMLRRELGL 1979          
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Match: A0A3Q0KG40 (Putative microtubule associated protein xmap215 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1147.88 bits (2968), Expect = 0.000e+0
Identity = 742/2093 (35.45%), Postives = 1188/2093 (56.76%), Query Frame = 3
Query:   90 DFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSV-GKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEK-----------AKQASEATIVL---------PEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPE-IPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTT-AEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRG------LKNETPVVENATDS---EVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGI--SGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFML-VFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQL----PKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGK----------------MPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQF-SASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNL---LKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGK-PVXXX--------XXXXXXXXXXXXXXQKP--------SRQRENSATREQPKPQISQL----PPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGR-LSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPK-FVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERG-QPQISV-------YGSNQLNNSGAAASLDKDNLAYC----NMDPESLLLRLKQLRKNAGL---DKSNFDKTEKQNRLSSPTRDEMESSVISKLVPSGDGXXXXXXXXXXXXNQMNNKRKMSAQDLAAIKQRFEALK 6068
            D+  L TL K++HK W ARV GYEEA K      SGK P+FN Y+GL+K  V DS+A AQEKAL+ +L +++ A  A K A DIC GI++KC  STR KT++ + E L +++EIER ++V+EELIKGLS K PKVVVGS+  L+E L  FGP +VP+K +FK   +LL+DRD+ +R   K LI+E+YRWIG T  + +L  IKPV +TEL   F  +P EKPV  RYL+SQKPKE  +   TG  +     ++ G+   + VD+D  D++ PVEV+ KIP +Y+ +I EKKW DR+DALE +EK+TN P++VPG++ DL+KSL++V++KDTNI+LV L+AKI+ QIA GL+ KFSPY+  T+QA L KFKEKK NVV+ALR+  D A  +TS+D  +++++ AL HKTP+V++E AL L+R F+K S      K+LK     L   C D+ PEVR+ +F  LG AM VV+ K ++P+L ++D+++LA+INE  E+             Q +  +I +         P ++A  V  +P   P     A +               + ++      K    IPTE++++ED+++ KA+++ GEA + Q+ D NWKER  A E +++ + + + SD+P Q++ R +L+KPG+KD N QVL+A+IE I ++++      +  AE+ + DL +K+GD K  D  K+ +T++++  +L LV   V++T  +  N ++  E L WL+ +I +FGF IP  ++ P ++  +  TNP+VRQS + LAGTI LY+ + + +LL DEKP++  L++ E    K    P P R       LK+      + T +   ++  T  + E++ + ++P+ +I+ + T  LL  L  K  K + E+L  + K ++ S  I  S   LQ  +  I K+  D +  ++K A+ +L S  ++  K DA  YIK V P +L    D K + RE AVTAL+ W  +V   +V +   + +ALK++NP+ ++ +  W+   L+ +  N L K     +    ++P +F+++E+R+ + RK +Q  VLP ++ VFG++ ++K+  +  K + K +I+  L+KA+  +    P   ++     PKA            +   + S+ ++   + S  + K                   KS  +L   ++++      S K  R+ +++K+K+ KW+    +    QQL++ F +A  +PE   LLF TD K+ +KAIE L+  L  D  +  EAT  N+D+IL+W+V+RF ETNP VL + +DYL ++F  +  +S   L EHE   F+P L++K+G+PKD VR   + ILKL+   Y   ++  FL      KT++ RQEC D +  LID   ++V  Q ++   +K +A  I +RD+ VR+AALN L+SA+  IGE + K++  + +K+RSML ERIKR+G+ P+++         +     +      ++KP         RQ+  SA   + +  +++L    P K   + P         LI +D ++ +L QP+E   L+     P L   LR+    AS       AIT V+ AI+SN++  S  A+A+ID V+R++     L+++++ ++M ITMQL+    R   +   SE ++  + +  LAT+ S+F+   L  E +R+ L  L QS+L+++++++   +S G  +IR IN L V ILE+SN TR+LSAL+R++ +C+ NG   +++   I K IW +TK +    ++  + VI  D   F   FPP  W AR+S  DVPLRT+KTL++ +   +G   L+ L  I    + +LE+Y+ ++ LK    + T   +P       +I  + N  K FV+ +  R   E+L +IF K+G  ++  +GLN+LYDF   YP VDLS YL+ T+ +FQ  I+  L+NIA ER  Q ++SV         ++Q +   A  + + D  A        DP+  + RL  LR+  GL     +N D     +  +       E+++ + + P+GD P            +   +  MS  +L  +K+R E +K
Sbjct:    6 DWSKLPTLSKVQHKLWNARVAGYEEAFKIFSTETSGKSPVFNEYVGLMKKFVTDSHAGAQEKALDAVLAYIETAAAATKCAGDICSGIISKCLGSTRVKTKDKSIECLLMLIEIERHELVIEELIKGLSTKNPKVVVGSLQTLREALNLFGPTVVPIKPLFKEFGRLLDDRDQGIRNETKNLIVEVYRWIGVTTKD-LLKDIKPVVMTELCELFNSIPPEKPVRLRYLRSQKPKE--ITSDTGTENGPSDGAIPGETLTDQVDLD--DMITPVEVLCKIPNDYWQKIGEKKWQDRRDALEAVEKITNVPRIVPGDFTDLVKSLIQVVNKDTNIILVTLAAKILGQIARGLKSKFSPYSQQTLQACLGKFKEKKPNVVQALRESADGAISSTSLDHFVDDIVAALGHKTPNVRAEAALILSRAFKKCSTTSLNKKILKSFTVPLCVTCNDTDPEVRECSFAALGAAMFVVSAKTIQPFLSELDSIRLAKINECCEQIASELSNSNNSGNQPTATSISISTSAKPNTAPRRAAPPVT-RPNTAPSGTGQATSECATKTPTLGPSSKKSTARTKSVVEKSKSTIPTENLLTEDEISQKASELLGEALIKQLSDTNWKERLQAVEQMKSNIHSFISSDVPVQILCRAVLLKPGIKDTNFQVLRARIEYINEVLSLSISISSNLAELLLPDLIDKVGDTKVGDVTKTAMTKLAEKTSLELVGGFVMRTLFQIKNPRSQTEGLVWLNQSILEFGFCIPAQEVGPLLKAGLNATNPSVRQSSLNLAGTIHLYLNDRLVTLLADEKPALITLLNAEFAKNKDKKAPAPIRFSAAQNLLKDSVSTEPSGTGTLSGDIETTGQIEEMDSDALLPKVDISDRFTPELLGLLKSKIWKERLEALTTIEKFVTPSNLIDASNGKLQEPLTMIAKAANDVNKNLAKQALIILSSFASSMPKSDAVNYIKYVEPPILLCLGDSKVQIREAAVTALSSWQSRVPILSVFENDMLADALKMENPFLRAELLRWLQEVLSPMPLNALRKN--ASEITENLIPQVFASLEDRNVEARKQAQ-IVLPSLIQVFGWEPILKS-ANRLKPTSKDSIIPHLEKARESVANSHPSSMEKKTVSPPKAVRGGNGTRPQPSSNAPENSEESENATQSSDITSKPVSETKKKTDTKKSINTSKKSGPELATTSIILP--PNKSAKSSRLNDEKKRKLLKWDFDTPTKDHIQQLSTLFIAAGTAPEFHALLFHTDFKQHIKAIEQLSQLL--DTTEGCEATVINVDIILRWIVLRFFETNPVVLGRCMDYLTKLFVYMS-ESGANLSEHEGGSFLPYLVMKVGEPKDVVRQNIRGILKLVVNLYPPSRLFTFLTNGTKAKTSKTRQECLDEMGSLIDRFGLNVC-QPSIPIAIKLIAQQIGDRDSGVRSAALNALLSAYAVIGEQIWKVIGDIPEKERSMLEERIKRAGQAPINTVDNFEPKTPSVRPSTARRDPSDSRKPLEPVPNEFRRQQPVSAAHARARAMLNELGDLSPEKAPSMPP---------LIQLDADINDLFQPVEIPALKTHVRQPVLNALLRTSPDTAS-------AITMVVTAISSNDLLISCHALAEIDTVLRDEKWYL-LLNHVNQVLMLITMQLRQVTSRYFGDPSVSEEQLHTLIRSHLATIESLFSRPTLGREASRETLRELSQSLLQMMLDERTSEMSSGENVIRSINALFVLILEASNGTRILSALIRLLHECVSNGHFTNRFTQAILKSIWRITKGMNTAFNNYSVDVILLDCHHFLKAFPPSSWSARKS--DVPLRTIKTLLHVLCGLQGPSILQFLESIPNKEDSELESYLIRT-LKTTSGVTTTTSDPK------KILASENHLKGFVLSTVTR---EKLTEIFKKVG-SKKPDEGLNELYDFTQLYPDVDLSSYLTNTSQFFQAYIKQALRNIAVERARQARLSVNDKEPNTLAAHQTDGVLARPNWNSDFDANIINGQPTDPKVFMNRLAVLRRELGLGGVSTTNMDDNIGSSDEAGIQNTAFETTLRNMVQPNGDSPDENTQP------ETEQRPTMSTTELMDLKRRLERIK 2046          
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Match: G4V7U4 (Putative microtubule associated protein xmap215 OS=Schistosoma mansoni OX=6183 GN=Smp_054790.2 PE=4 SV=1)

HSP 1 Score: 1138.25 bits (2943), Expect = 0.000e+0
Identity = 740/2100 (35.24%), Postives = 1182/2100 (56.29%), Query Frame = 3
Query:   90 DFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGG---DAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEK-----------AKQASEATIVL---------PEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPE-IPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIE--LIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRG------LKNETPVVENATDS---EVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGI--SGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFML-VFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPI----------------------PSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKM--PNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQF-SASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNL---LKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGK-PVXXX--------XXXXXXXXXXXXXXQKP--------SRQRENSATREQPKPQISQL----PPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGR-LSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPK-FVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERG-QPQISV-------YGSNQLNNSGAAASLDKDNLAYC----NMDPESLLLRLKQLRKNAGL---DKSNFDKTEKQNRLSSPTRDEMESSVISKLVPSGDGXXXXXXXXXXXXNQMNNKRKMSAQDLAAIKQRFEALK 6068
            D+  L TL K++HK W ARV GYEEA K      SGK P+FN Y+GL+K  V DS+A AQEKAL+ +L +++ A  A K A DIC GI++KC  STR KT++ + E L +++EIER ++V+EELIKGLS K PKVVVGS+  L+E L  FGP +VP+K +FK   +LL+DRD+ +R   K LI+E+YRWIG T  + +L  IKPV +TEL   F  +P EKPV  RYL+SQKPKE      T  G    A+P +++     + VD+D  D++ PVEV+ KIP +Y+ +I EKKW DR+DALE +EK+TN P++VPG++ DL+KSL++V++KDTNI+LV L+AKI+ QIA GL+ KFSPY+  T+QA L KFKEKK NVV+ALR+  D A  +TS+D  +++++ AL HKTP+V++E AL L+R F+K S      K+LK     L   C D+ PEVR+ +F  LG AM VV+ K ++P+L ++D+++LA+INE  E+             Q +  +I +         P ++A  V  +P   P     A +               + ++      K    IPTE++++ED+++ KA+++ GEA + Q+ D NWKER  A E +++ + + + SD+P Q++ R +L+KPG+KD N QVL   +   +   +  +  ++   AE+ + DL +K+GD K  D  K+ +T++++  +L LV   V++T  +  N ++  E L WL+ +I +FGF IP  ++ P ++  +  TNP+VRQS + LAGTI LY+ + + +LL DEKP++  L++ E    K    P P R       LK+      + T +   ++  T  + E++ + ++P+ +I+ + T  LL  L  K  K + E+L  + K ++ S  I  S   LQ  +  I K+  D +  ++K A+ +L S  ++  K DA  YIK V P +L    D K + RE AVTAL+ W  +V   +V +   + +ALK++NP+ ++ +  W+   L+ +  N L K     +    ++P +F+++E+R+ + RK +Q  VLP ++ VFG++ ++K+  +  K + K +I+  L+KA+  +    P                       PS   P  A  N +   +   ++   S      K+ +     +    KS  +L   ++++      S K  R+ +++K+K+ KW+    +    QQL++ F +A  +PE   LLF TD K+ +KAIE L+  L  D  +  EAT  N+D+IL+W+V+RF ETNP VL + +DYL ++F  +  +S   L EHE   F+P L++K+G+PKD VR   + ILKL+   Y   ++  FL      KT++ RQEC D +  LID   ++V  Q ++   +K +A  I +RD+ VR+AALN L+SA+  IGE + K++  + +K+RSML ERIKR+G+ P+++         +     +      ++KP         RQ+  SA   + +  +++L    P K   + P         LI +D ++ +L QP+E   L+     P L   LR+    AS       AIT V+ AI+SN++  S  A+A+ID V+R++     L+++++ ++M ITMQL+    R   +   SE ++  + +  LAT+ S+F+   L  E +R+ L  L QS+L+++++++   +S G  +IR IN L V ILE+SN TR+LSAL+R++ +C+ NG   +++   I K IW +TK +    ++  + VI  D   F   FPP  W AR+S  DVPLRT+KTL++ +   +G   L+ L  I    + +LE+Y+ ++ LK    + T   +P       +I  + N  K FV+ +  R   E+L +IF K+G  ++  +GLN+LYDF   YP VDLS YL+ T+ +FQ  I+  L+NIA ER  Q ++SV         ++Q +   A  + + D  A        DP+  + RL  LR+  GL     +N D     +  +       E+++ + + P+GD P            +   +  MS  +L  +K+R E +K
Sbjct:    6 DWSKLPTLSKVQHKLWNARVAGYEEAFKIFSTETSGKSPVFNEYVGLMKKFVTDSHAGAQEKALDAVLAYIETAAAATKCAGDICSGIISKCLGSTRVKTKDKSIECLLMLIEIERHELVIEELIKGLSTKNPKVVVGSLQTLREALNLFGPTVVPIKPLFKEFGRLLDDRDQGIRNETKNLIVEVYRWIGVTTKD-LLKDIKPVVMTELCELFNSIPPEKPVRLRYLRSQKPKEITSDTGTENGPSDGAIPGETL----TDQVDLD--DMITPVEVLCKIPNDYWQKIGEKKWQDRRDALEAVEKITNVPRIVPGDFTDLVKSLIQVVNKDTNIILVTLAAKILGQIARGLKSKFSPYSQQTLQACLGKFKEKKPNVVQALRESADGAISSTSLDHFVDDIVAALGHKTPNVRAEAALILSRAFKKCSTTSLNKKILKSFTVPLCVTCNDTDPEVRECSFAALGAAMFVVSAKTIQPFLSELDSIRLAKINECCEQIASELSNSNNSGNQPTATSISISTSAKPNTAPRRAAPPVT-RPNTAPSGTGQATSECATKTPTLGPSSKKSTARTKSVVEKSKSTIPTENLLTEDEISQKASELLGEALIKQLSDTNWKERLQAVEQMKSNIHSFISSDVPVQILCRAVLLKPGIKDTNFQVLSCVLSEIIFVVLSLSISISSNLAELLLPDLIDKVGDTKVGDVTKTAMTKLAEKTSLELVGGFVMRTLFQIKNPRSQTEGLVWLNQSILEFGFCIPAQEVGPLLKAGLNATNPSVRQSSLNLAGTIHLYLNDRLVTLLADEKPALITLLNAEFAKNKDKKAPAPIRFSAAQNLLKDSVSTEPSGTGTLSGDIETTGQIEEMDSDALLPKVDISDRFTPELLGLLKSKIWKERLEALTTIEKFVTPSNLIDASNGKLQEPLTMIAKAANDVNKNLAKQALIILSSFASSMPKSDAVNYIKYVEPPILLCLGDSKVQIREAAVTALSSWQSRVPILSVFENDMLADALKMENPFLRAELLRWLQEVLSPMPLNALRKN--ASEITENLIPQVFASLEDRNVEARKQAQ-IVLPSLIQVFGWEPILKS-ANRLKPTSKDSIIPHLEKARESVANSHPSSMEKKTVSPPKAVRGGNGTRPQPSSNAPGTAPENSEESENATQSSDITSKPVSETKKKTDTKKSINTSKKSGPELATTSIILP--PNKSAKSSRLNDEKKRKLLKWDFDTPTKDHIQQLSTLFIAAGTAPEFHALLFHTDFKQHIKAIEQLSQLL--DTTEGCEATVINVDIILRWIVLRFFETNPVVLGRCMDYLTKLFVYMS-ESGANLSEHEGGSFLPYLVMKVGEPKDVVRQNIRGILKLVVNLYPPSRLFTFLTNGTKAKTSKTRQECLDEMGSLIDRFGLNVC-QPSIPIAIKLIAQQIGDRDSGVRSAALNALLSAYAVIGEQIWKVIGDIPEKERSMLEERIKRAGQAPINTVDNFEPKTPSVRPSTARRDPSDSRKPLEPVPNEFRRQQPVSAAHARARAMLNELGDLSPEKAPSMPP---------LIQLDADINDLFQPVEIPALKTHVRQPVLNALLRTSPDTAS-------AITMVVTAISSNDLLISCHALAEIDTVLRDEKWYL-LLNHVNQVLMLITMQLRQVTSRYFGDPSVSEEQLHTLIRSHLATIESLFSRPTLGREASRETLRELSQSLLQMMLDERTSEMSSGENVIRSINALFVLILEASNGTRILSALIRLLHECVSNGHFTNRFTQAILKSIWRITKGMNTAFNNYSVDVILLDCHHFLKAFPPSSWSARKS--DVPLRTIKTLLHVLCGLQGPSILQFLESIPNKEDSELESYLIRT-LKTTSGVTTTTSDPK------KILASENHLKGFVLSTVTR---EKLTEIFKKVG-SKKPDEGLNELYDFTQLYPDVDLSSYLTNTSQFFQAYIKQALRNIAVERARQARLSVNDKEPNTLAAHQTDGVLARPNWNSDFDANIINGQPTDPKVFMNRLAVLRRELGLGGVSTTNMDDNIGSSDEAGIQNTAFETTLRNMVQPNGDSPDENTQP------ETEQRPTMSTTELMDLKRRLERIK 2051          
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Match: A0A5J4NT36 (Cytoskeleton-associated protein 5 OS=Paragonimus westermani OX=34504 GN=DEA37_0009042 PE=4 SV=1)

HSP 1 Score: 1137.87 bits (2942), Expect = 0.000e+0
Identity = 730/2104 (34.70%), Postives = 1151/2104 (54.71%), Query Frame = 3
Query:   90 DFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVL--------PEKSAVVVAEKPIE--PPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXG--------AASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIV-TNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGL------KNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGD--GLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAEL-----PVPEPIPSKQLPKAASSNGXXX-XXXXXXXXXXXXXXXXXXXXXXXXGKMPNK---------------SNEQLDKDAVVMA--LLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSAS-CSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSATREQPKPQISQLPPKTIDINPLLKEEIGYK------------------------LINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGR-LSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAAS----------LDKDNLAYCNMDPES-----LLLRLKQLRKNAGL--------DKS-------NFDKTEKQNRLSSPTRDEMESSVISKLVPSGDGXXXXXXXXXXXXNQMNNKRKMSAQDLAAIKQRFEALK 6068
            ++  L T++K++H  W ARV+GY EAL      DS   P+FN Y+GL+K  V+DSNA+AQE AL  +L F++ ANVA + A D+C  +V K   +TR KT++ A E L  +VEIER +V  EEL+KGLS K PK+VVG +  L+E+L  FGPK+VP+K + K   +L +DRD+NVR   K L++E YRW G +    +L+ +KPV V ++ A  E+LP EKPVP R+LK Q+PK++    P+ G  A    SV     + V +D  DL+  VEV++ IP +Y+  I EKKW DR+ ALE I+ LTN P + PG++G+L+KSLL VL+KDTN+VL  L+AKI+ Q+A GL+KK++PYA  T+ A L K KE+K + +  LR+ +D+A  +  +D   ++L+N+L HKTP V++E ALFL+R F +SS      KLLK     L     D+  +VR+ +F  LG  M++V  K+++P+L  +D ++L +I E+ EKA   S A            P  +      KP    PP       A+K+ ++S  A      KS   G          S  P + TE+++S++ VT +A ++ GE  +  +   + K+R      +Q   ++   + +P Q++ R+I  KPGLKD N QVL+A++EL++  +  N  M+ T  E+ + DL EKIGD K  + VKS LT +S+     +V + ++K+  E+ N +N  E+L WL+ ++++FG K+P  ++ P +R  +  TNPAVRQ+ + LAG++ LY+ + + SLL DEKP++  L++ E +      PPVPTRG       + +T   + A D + V      EL+ E +  R +I  +IT  L++ LS+K  K ++++L  +  I++A+  I G    LQ L+ AI K+  D++  +SK A+ LL     A  K DA KY++ V PA+L    D KP+ RE A +AL+ W  +V F  +++   +++ALKV+N   ++ +  W++  LT +  N   +K L PD    ++PH+F+A+E+R+PD RK +Q A+   + V G+D  V    +  K++ K T+M  L+KA+  +     P  +       PK     G    ++  +A    +D        +  +   P K               S + +  D   +A  L A  + K  R+ +++K+K+ KWE    +    QQLN  F AS  SPEL   LF +D K+ +K ++ L+ FL  D  +  EAT  N+DLIL+W+V+RF ETNP V+ + LDY  ++F+ L  ++   L EHE   F+P LI+K GD KD VR   + + +L+   Y   ++  FL   + +K  + RQEC D +  LI+   ++V        LK++   I +RD+ VR+AALN LVSA+  +GE L KI+ SL DKDR+ML ERIKR+G+P ++ +  + +           SR    S+ R + +P   + P  ++ + P   E +                           LI +D ++ +L +P+E   L+     P L   LR+    AS       AIT V+ AI+SN++  S  A+A++D V+R++     L+++++ ++M ITMQLK    R   +   S+ ++  + +  LAT+ S+F    L  E +R+ L  L+QS+L+++++++   + +G  +IR IN L V I+E++N TR+LSALLR++ + + NG    ++   I K IW +TK + +TV++    VI  D   F   FP   W+ R+S  DVPLRTVKTL++ +   +G   L  L  I    + +LE Y+ ++   L           T S    +  P+G+  +      +    E L +IF K+G  +Q +QGL +LYDF   YP VDLS +L++T+ +FQ  I   LKNIA ER +   S   +   + S    S          +D   +   N DP S      + RL QLR+  GL        D+S       N D  E      SP+   +E+++ + + P   G  S      + A Q +++  +SAQ+L  IK+R + +K
Sbjct:    6 EWTSLPTIEKVQHSRWNARVQGYTEALNLFTTQDSEDSPVFNEYVGLIKKFVLDSNAIAQEAALSSVLAFLENANVATRCAPDVCCALVTKGLGATRAKTKDKAIECLLQMVEIERHEVACEELLKGLSNKNPKLVVGCLQTLREILNLFGPKVVPLKPLTKEFPRLFDDRDENVRNETKNLVVEFYRWFGQSN-KSLLTGLKPVVVNDITALLEQLPTEKPVPQRFLKGQQPKQTTSTGPSQGS-AGGITSVAMVTDDPVSLD--DLIPAVEVLASIPKDYWTLITEKKWQDRQSALESIDNLTNVPNIAPGDFGELIKSLLHVLNKDTNVVLTTLAAKILGQLANGLKKKYAPYAPQTVSACLAKLKERKASFIAVLRNTLDAAVKSIPLDTVADDLVNSLAHKTPGVRAEVALFLSRFFGRSSPATLNKKLLKTFTVALCETSKDTAGDVRENSFAALGALMRLVGPKQIEPFLADLDAIRLGKIKEYSEKAVDGSTAVGGTNASGAESRPGTAPSATGSKPRRGAPPVQRPATAATKETSESGEATITATTKSSASGPPKRKPTVTKSSKPNVITETLLSDEQVTQQAHELLGEDLVNMLSSSDLKQRLEGVTKIQERSQSVGLATLPAQVLCRVITQKPGLKDTNLQVLRARLELLQQTIEANKSMSSTMVEVLVPDLMEKIGDAKVGEAVKSVLTALSERAGFAVVGTLLLKSVFESKNPRNQAESLQWLAQSVREFGMKLPPQEVPPVLRTGLNATNPAVRQASLSLAGSVHLYLGDPLRSLLADEKPAVVTLLNAEFDKNAGQKPPVPTRGRLEKTGSEGQTVADDGAGDVDTVTE----ELDSEALFERVDIRPQITTELMSLLSNKNWKDRQQALSTIQNILNAAKHIEGSNGALQELLSAIAKACGDANKNLSKFALVLLDEFAKALPKSDAAKYVRFVEPAILLCLGDSKPQVREAAYSALSAWQSRVPFVAMLENDMLSDALKVENANLRADLLRWLTGALTCVPANS--RKQLPPDLTENLMPHVFAAMEDRNPDARKQAQLALPQLIRVLGWD-GVSKAANRLKSTSKDTVMPHLEKAREAVATELHPGDDSTKVAAKPKVVRGGGHKGPSTASSAPADDTDDIDSSPTSASTAAGRPGKKKPDAKKTGNAATTTSKKPIPNDQAAVAAPLQANRAAKSARLTDEKKRKLLKWEFDAPTRDHVQQLNQLFLASGASPELHASLFHSDFKQHVKGLDQLSQFL--DTPEGEEATAVNVDLILRWIVLRFFETNPVVVGRCLDYTTKLFSRLS-EAGLNLTEHEAGAFLPYLILKAGDSKDAVRQSVRGLFRLVVNLYPPSRLFVFLSNGVKSKINKTRQECLDEMGSLIERFGVNVCQPSVPVALKAICQQIGDRDSGVRSAALNALVSAYAIVGEQLWKIIGSLPDKDRTMLEERIKRAGRPPTASSMDTSE-----------SRVPPISSVRTKREPSEGRQPMDSVRMAPKWAEPVSIAQQRARAMLSELGDLSPEKAPNMPDLIQLDADISDLFKPIEVPALKTQARQPVLNALLRTSPDTAS-------AITMVVTAISSNDLLVSCHALAELDMVLRDEKWYL-LLNHVNQILMLITMQLKQVTARYFGDSSISDDQLATLVRCHLATVESLFKRPTLGREASRETLRELIQSLLQVMLDERTTRMPDGENVIRAINALCVNIIEAANGTRVLSALLRLLHESVSNGHFTHRFTQSIMKSIWRITKGMDSTVNNYAFDVILLDCHDFLKAFPSASWKTRKS--DVPLRTVKTLLHVMCRYQGSSILNFLESIPNSEDSELEAYLNRTLKTLGT---------TSSITTHQRKPSGSDARTKPMLPSAATRERLTEIFKKVG-SKQPEQGLEELYDFTQMYPEVDLSVFLTKTSQFFQTYIRQALKNIAVERARQTKSGSAAGDTDRSHMPPSGTPNGMQPGLVDTVRMDILNEDPHSVDPKVFMNRLAQLRRELGLGGVSTTQVDESPGLLGVTNLDGCET----GSPSHPALENTLRNMMNPGEPG--STDQTDQSEATQPDSRPTLSAQELLDIKRRLDRIK 2058          
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Match: A0A158R7R4 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4270 PE=4 SV=1)

HSP 1 Score: 1101.66 bits (2848), Expect = 0.000e+0
Identity = 703/2058 (34.16%), Postives = 1136/2058 (55.20%), Query Frame = 3
Query:  129 KNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVG---KHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPP-KAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGR-MTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLK-------NETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGD-GLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALK---VDNPYQKSTIFAWMSPHLT--KLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFML-VFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPI-PSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMAL-----LAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQF-SASCSPELFQLLFTTDIKKSMKAIELLNSFL--SEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVG--NQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSATREQPKPQISQLPPKTI-----DINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEE-KFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNN--------------------SGAAASLD---------KDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDKTEK----QNRLSSPTRDEMESSVISKLVPSGDGX------XXXXXXXXXXXNQMNNKRKMSAQDLAAIKQRFEALK 6068
            K WKAR+ GY+EA+K +Q   S K  LF  Y GL+K ++ D+NA AQEKAL+V+L FV+ A +A +AA+D+C GIV+KC N++R KT+E   EIL   +E+E+ DVV+EE++KGLS K PKVVVG +  L+  L  FG K++ +K + K   +LLEDRD N+R   KEL++EMYRW G+  +   LS +KPVQ+TEL  EF K   +KPVP+RYLKSQKPK+     P    +A   +  G       N+ ++DPY+L DP+ ++SK+P+++++Q+E KKW DRK+AL ++E L++  +L PG+YG+LMK+L+KV++KDTN +LV  SAKI+ QIA GLRK F PYA  T++  LEKFKEKK+ V+ A+R   DSA   T++DA  E+++ A ++K P V++ET L++ R F   ++     KLLK  I  L     D+  EVR+A+F  LGTAM VVTEK + P+L  +D+++L RI EFYEK  +  +                  +P  K  K    S     +        A   K    +   ++P E ++  D +  + T+ FGEA L ++    WKER AA E  QT ++    S + CQL+ RL++ KPGLKDNN QVL+ K+E+I +I+   + +     ++ + +L EKIGD+K  + VK   T +++     +V +QV+  A +  + KN +EALNWL+ AIKDFGFK+     V F++  +  TN  VRQS I L+G + +Y+   + +LL DEKP++  L++ E   L  + PP PTRGL+        +    +  T +E+ AT   PE   E+++ R NI+ K++  +L  LS K  K +KE L  + +++ A+  I+G   +Q  +  I K  TD + ++ K  + L+ +   AF+K DA+K +K V P++L  F D KP  RE AV AL+ W E+ GF  + +   ++EALK    +NP+ ++ +  W++  +   +LS        L PDF   +   +++  EER+PD R+ + + +LP ++   GYD+M K      K +    +   L+KA+ ++   +   P  ++PK    N     +    +++ S ++  K    K + K P  ++++               L  N  ++ R+ +++K+K+ KW+    S    QQLN+ F  A  SP+L   LF  D K+ +KA+E+L   L  +    D   AT+ NLDLIL+WMV+RF ET+P+ L++GL+Y+ +VF+ +  D+  QL E+E + F+P L++K+GD K+ +R   + I + I+  Y   K+   L   L +KT + RQEC + +  +I+   ++V   +    LK +A  IS+RD+ VRTAALN LV A+  + E L K+L  L +K+RSML ERIKR+G+P    T ++  +++    +++P +Q+   A   Q    I+    + I     D+NP L   +   L+  D+++ EL +P+E   L+       L   LR+    AS       AIT V+  I+SN++     A++QID ++++ D    LV +++ ++  IT+QL+ T  R  ++   SES ++ + + +L T  SIF    LA E +R+ L   + + L ++++++   L EG  I+R IN +++R++  SN TR+L A +R++ + + +    +++  ++ + +W +TK L +T ++  L ++  D   F   FP   W+AR+S  D+PLRT+KT+++S  + +G   L+ +  I      +LE+Y++++   L       LP P   +N  +  PT      V+ S       +L  +F KI +  +++  + +LYD  + YP +DL  +L  +TP+FQ  I   L N+   R +   +   +  +N                      G + +LD          + L    ++P+  + RL  LRK  GL+    D   +    + RLSS     +ES+V   L+   DG        S         N       MS  +L  I++R E +K
Sbjct:    2 KQWKARMAGYDEAVKLLQTQSSEKSNLFGDYAGLLKKIITDNNAFAQEKALDVVLAFVENAAIAPRAASDVCAGIVSKCMNASRPKTKEKGIEILLYYIELEKTDVVLEEVLKGLSVKQPKVVVGCLQTLRTALSLFGSKVISIKLILKDALRLLEDRDPNIRNESKELVVEMYRWAGA-PIKTQLSSLKPVQLTELENEFAKCTGQKPVPTRYLKSQKPKDL----PQQSNNAAATEDPGFNDGEDANDAELDPYELADPINILSKLPSDFFEQMEAKKWQDRKEALSLVENLSDTIRLAPGDYGELMKALIKVIAKDTNAILVGQSAKIVAQIANGLRKDFHPYASETVKVCLEKFKEKKSTVLSAIRSAADSALKATTLDAVQEDVIAATSNKVPGVRAETCLYIGRAFANMTVTTLNKKLLKTFIGPLIKCSADTTMEVREASFSALGTAMFVVTEKNIMPFLADVDSIRLGRIREFYEKVVEERKKVGTSGSGGGGSGVAGTSKPQFKVVKGKSGSAVTPAAAAKPTAAAAGGAKSKPPAGANDLPREQLIPNDAIEPQLTEFFGEALLTELASAVWKERLAAMEVAQTKIR-AADSSLSCQLVCRLMMRKPGLKDNNFQVLRMKVEVITEILLARKPVGEILVDLLLPELIEKIGDMKVGEAVKQAFTALAEATTFEIVGTQVLNAAFQQKSPKNQIEALNWLAGAIKDFGFKLNGRQTVDFLKTGLSATNMYVRQSCIHLSGVLYMYMGATLRTLLADEKPAVIALMEEEWAKLGDSKPPAPTRGLRVIKKDSAGDGADNQAETKAELEAT---PE--PEELVDRTNISEKLSGEVLTLLSSKNWKERKEGLNQIEELLKANPFITGGYEVQEPLALIAKVCTDVNKILGKTTLGLMEAFAKAFSKTDAKKLVKCVEPSILVCFGDSKPVVREAAVAALSAWKERCGFIPMTENDMLSEALKASLAENPFLRAELLGWLTTAMAGLQLSGKAAIASGLAPDFGLNLALAVYAVCEERNPDARQRAHK-ILPVLIRSLGYDVMQKAL-KRLKATSMDAVTPLLEKAREQVAAEDAANPPPEVPKVIRDN----TTTPDVDEEPSMASTVKPAGKKVAAKKPAMTSKRAAALEQAEEAAAVVPLQVNKLRETRMLDEKKRKLLKWDFDTPSKDHVQQLNTLFLVAGASPDLHACLFHADFKQHIKAVEILTRLLDGAWSAVDGEAATRANLDLILRWMVLRFFETSPAFLSRGLEYIHKVFSRMS-DAGQQLTEYEASAFLPYLVMKVGDSKESIRKDVRAIFRAITGIYPPEKLYPHLVGGLKSKTNKARQECLEEIGSMIEHFGLNVCQPSPAASLKVIAAQISDRDSGVRTAALNALVCAYAIVDEPLWKMLGQLPEKERSMLEERIKRAGRPA---TAATTSAASKRSASERPQQQQPYGAGGPQSLHAIAYARAQHILSGLGDLNPELPPALP-SLLQFDRDINELFKPIEIPELKTRDKQTVLNCLLRTSPDAAS-------AITMVVTQISSNDLNVCCYALSQIDTLLQS-DKWQLLVGHINQIITLITIQLRQTNSRFFDDPTISESHLSTVLRCLLVTTESIFKRPLLAREASRESLKEFLFASLHLMVHEKTSELPEGSGIVRAINAITLRVILESNSTRVLGAFIRLLHESVSSSHFNNRFTQVVLRSLWKITKALPDTANNYSLDLVLLDCHNFLKAFPSSSWKARKS--DLPLRTIKTMLHSFCSARGPAVLKFVDLIPNKEESELESYMKRTLKSLANANGGKLP-PALQTN--QKQPTSPPKSAVISSETH---AKLTSLFAKI-LSSKDESYIEELYDITVAYPDLDLQPFLVDSTPFFQTYIRQALYNVGLRRARANPTQATNGNVNGVIDKQGFANVMRERLFKVLRGGNSEALDVFDRLPPLCAEELGQRPVNPKLFMDRLATLRKELGLESGASDDNSRDVDAEGRLSS-GNTAIESTVQLCLLMLQDGAPGRGEGESDTPTTSPQGNHPAAGGGMSQNELMNIRRRLEMIK 2019          

HSP 2 Score: 63.1586 bits (152), Expect = 9.943e-6
Identity = 106/522 (20.31%), Postives = 211/522 (40.42%), Query Frame = 3
Query:   81 EVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVIL-LFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELI-KGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKP-VPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTN-NPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQ-ATLEKFKEKKTNVVKALRDCIDS-----AFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLT------------NLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQ 1580
            ++ +F G   L ++    WK R+   E A   ++ +DS         L + K  + D+N       +EVI  + +    V     + + P ++ K  +    K  E   +    + E    ++V  +++      K+PK  + ++N L   ++DFG K+   ++    +   L   +  VR++   L   +Y ++G+T L  +L+  KP  +  +  E+ KL   KP  P+R L+        ++K    GD    Q+  K  +     +P +LVD   +  K+       +  K W +RK+ L  IE+L   NP +  G       +L+  +  D N +L   +  ++   A    K  +   V  ++ + L  F + K  V +A    + +      F+  + +  + E L A   + P +++E   +L        +   +GK    I  GL              +C +  P+ R  A + L   ++ +    ++  L ++    +  +    EKA++
Sbjct:  560 QLTEFFGEALLTELASAVWKERLAAMEVAQTKIRAADSSLSCQLVCRLMMRKPGLKDNNFQVLRMKVEVITEILLARKPVGEILVDLLLPELIEKIGD---MKVGEAVKQAFTALAEATTFEIVGTQVLNAAFQQKSPKNQIEALNWLAGAIKDFGFKL-NGRQTVDFLKTGLSATNMYVRQSCIHLSGVLYMYMGAT-LRTLLADEKPAVIALMEEEWAKLGDSKPPAPTRGLR--------VIKKDSAGDGADNQAETKA-ELEATPEPEELVDRTNISEKLSGEVLTLLSSKNWKERKEGLNQIEELLKANPFITGGYEVQEPLALIAKVCTDVNKILGKTTLGLMEAFAKAFSKTDAKKLVKCVEPSILVCFGDSKPVVREAAVAALSAWKERCGFIPMTENDMLSEALKASLAENPFLRAELLGWLTTAMAGLQL---SGK--AAIASGLAPDFGLNLALAVYAVCEERNPDARQRAHKILPVLIRSLGYDVMQKALKRLKATSMDAVTPLLEKARE 1062          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Cavefish
Match: ckap5 (cytoskeleton associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-051120-174])

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 586/1887 (31.05%), Postives = 975/1887 (51.67%), Query Frame = 3
Query:  534 DFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVL-------------------------PEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGL--KNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAEL--------PVPEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGN--QKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXX------XXXXQKPSRQ---------RENSATREQPKPQISQLPPKTIDINPLLKEEIGYKLIN----VDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSN-DAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKD----IFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEER-GQPQISV---------------YGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDKTEKQNRLSSP---TRDEMESSVISKL 5939
            +FG KI+ +K + K + KL E R+K VR+  K L +E+Y+WI   AL   L  +  VQ+ EL  E+ KLP   P  SR+L+SQ+  ++   +    G    +       Q +  +DPY+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E LT  PKL  G+YGDL+++L KV+ KD N++LV L+AK +  +ATGLRKKF  YA   +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K PS+K + +LFL R F   +       +LK +         DS PEVRDAAF+ LGTAMKVV EK + P+L  +D +KL +I E  +K + A                                P K A   + K   PPK  K A A     +                 A+   E+  E+ +S +    K+  +   + +  +   NWKER A+ E  Q  V+    S++PCQ ++R++  KPG K+ N QV++ K+ ++  I   G  + T+A + +  L +KIGD+K   N K  LT + +  +LP  A QV+  A    N KN  E+LNWL++A+K+FGF  I +   +  ++ A+  TNPAVR S I L G + LY+   +    +DEKP++   ID E E ++  +PP PTRG   K      E+A + + V   A    ++ D++PR +I+ KIT +++A++SDK  K++KE L +V+ +IS +  I  + +  L +A+     DS+ ++ +  +N+   +  A      +    +  P +++   D KP  R  A+  LN W E+ G    ++G  ++E LK +NP+ +  +  W+S  L  +    +P  L+        +PHL++ +E+R+ DVRK +Q+A+  FM+  GYD M K   S  KTS K  ++  L+KA+A +              P++  P A  ++GK   S  ++ K        K     K       + ++ DK   +  L+  +  ++  ++E++  K+ KW          +QL +Q ++  +  L   LF  D +  +KA+   N+ +   + ++ EA    LDLILKW  +RF +TN S+L K +++L  +FT+L  + ++ L E+E + FIP LI+K+G+ KD VR   + IL ++   Y   K+  FL E   +K ++ R EC + L  LI++  ++V        LK +A+ I +RD  VR AALN +V+A+N  G+ + K++ +L +KD SML ERIKRS K   + +    ++             +KP+++         R  +A  E   P I    P+   ++  + E    ++      V  +++ELL+P+       +P       K+RS S       NS    I  VI  + S ++  SIQA+AQIDEV+R +D    +  ++D  +++  MQL+      +++++  + +I  ++  ++  ++S+F+ + LA E +   L +LM  ++ ++++ ++  + +G  +IR +N+L VR+LE S+QT +LSALL ++ D L        +  L+ KC+W M + L  T++SI+L  I  D+  F   FP    + ++   DVP RT+KTL++++    G   L+ L  I      +LE ++R+                  S N+  +    N  K  ++S+++    ++ D    IF KIG  E  K+GL +LY++K KY   DL  +L  T+ +FQ  +E GL+ I  ER G+ +I                 + S Q+N++G             ++ P     RLK LR+  GL+ S  D+    + LS P   +  +M  S +S+L
Sbjct:   85 EFGSKIITLKPVVKVLPKLFESREKAVRDEAKLLAVEIYKWI-RDALRTPLQNLNSVQLKELEEEWVKLPTGIPKQSRFLRSQQDLKAKFEQQQAAGS--DEADGDDDEQTDTRVDPYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVETLTKIPKLESGDYGDLVRALKKVVGKDANVMLVTLAAKCLAGLATGLRKKFGTYAGLVVPTVLEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPSIKQQASLFLARSFRHCTPSTLPKSVLKPLCAAFLKQVNDSAPEVRDAAFEALGTAMKVVGEKAVNPFLADLDKLKLDKIKECADKVELAGGKKGGGGGEKKEKPAAKAPPVEEPPPKPAAGPSKKA--PSAKAAGPPKKGKPASAPSAKGKK----------------AADTKEV-VETELSLEVCEEKSAAVLPASCMQLLDSANWKERLASMEEFQRAVEQMDKSEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVGLIAGKGTFSKTSALVVLDGLVDKIGDVKCGGNAKEALTNIGEACSLPWTAEQVVSLAFAQKNPKNQAESLNWLANAMKEFGFAGINVKAFINNVKTALGATNPAVRTSAIALLGVMYLYMGAPLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGQTKKGAEEDGEDADEEDGVDRGAG---DIMDLLPRTDISDKITSDMVAKISDKNWKIRKEGLDEVSAVISEAKFIQSN-IGDLPMALKGRLGDSNKLLVQQTLNIFQQIATAMGPSLKQHVRNLGFP-IITVLGDSKPNIRATALATLNSWVEQTGMKEWLEGEDLSEELKRENPFLRQELLGWLSERLPNM--RTVPADLML------FIPHLYACLEDRNGDVRKKAQDALPTFMMHLGYDKMNKA-TSKLKTSSKDQVVAMLEKARAVMPAKPAAPAKAASSKPAQSAPAAKPASGKSSLSLFSSLKSQLIPQWQKSGVVGKKAPAKPAAKDEEDKSGPIFILVPNSKEQR--MKEEKALKILKWNFITPRDEYVEQLKTQMASCLAKWLQDELFHFDFQHHVKAV---NAMIEHMEAEA-EAVLGCLDLILKWFTLRFFDTNTSILIKAMEFLKLLFTMLSRE-NYHLSEYEASSFIPYLILKVGESKDVVRKDVRAILTMLCNVYSANKMFPFLMEGTKSKNSKQRCECLEELGCLIENYGMNVCQPTPAKALKDIAVHIGDRDTTVRNAALNTVVAAYNVCGDQVFKLIGNLSEKDMSMLEERIKRSAKKTPAVSTKQEKAQREHPTNPNATFLRKPAQEDVPNKLNQARSQNAHSEHTAPSI----PREFQLDLDMIENDHTRVSEFPDLVQHKLDELLEPVS------IPE-----PKIRSVSPHFDDLHNSTASTINFVISQVASGDINASIQALAQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADDRLDKKDIFKLYSCIIGNMLSLFSMESLAREASMGVLKDLMHGLITLMLDSRVEDIEDGQQLIRSVNLLVVRVLEKSDQTNILSALLVLLQDSLITTAGSPMFSELVMKCLWRMIRFLPETINSINLDRILLDVHNFMKVFPKE--KLKQLKSDVPHRTLKTLLHTLCKLTGAKILDHLSMIENRNESELEAHLRRVV--------------KHSGNLSGLKSDLNTEKGALRSDDKLIKAKVSDILSEIFKKIGSKENTKEGLTELYEYKQKYSDADLEPFLRNTSQFFQSYVERGLRMIESEREGKSRIQTSAVIPQHSTESYTPSHSSMQVNSNGE------------DLKPAVYYERLKILRQRHGLENSKEDERPPFSSLSKPPLASSTDMLHSKLSQL 1885          

HSP 2 Score: 81.6481 bits (200), Expect = 9.128e-15
Identity = 49/117 (41.88%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  117 KIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVAN----------KAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIER 437
            K EHK WKAR+ GYEEALK  Q     K P +  YLGL+K  V +SNAVAQ K LE  L+FV+ A+VA           K    + P +      + R + + LA EI K I +  R
Sbjct:   15 KCEHKVWKARLNGYEEALKLFQRISDEKSPEWGKYLGLIKKFVTESNAVAQLKGLEAALVFVENAHVAGNEFGSKIITLKPVVKVLPKLFESREKAVRDEAKLLAVEIYKWIRDALR 131          

HSP 3 Score: 75.485 bits (184), Expect = 6.395e-13
Identity = 111/495 (22.42%), Postives = 199/495 (40.20%), Query Frame = 3
Query:  120 IEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVI-----DSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIK-GLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLP-QEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACM--EELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK 1577
            ++  NWK R+   EE  +A++  D  +     P   LV+ +       ++N    +  L ++ L   +   +  +A  +  G+V+K  +    K    A E L  I E        E+++    + K PK    S+N L   +++FG   + +K     V   L   +  VR +   L+  MY ++G+  L       KP  +++++AEFEK+  Q  P P+R    Q  K +         +    +  G         D  DL+   ++  KI ++   +I +K W  RK+ L+ +  + +  K +    GDL  +L   L  D+N +LV  +  I  QIAT +      +  N     +    + K N+       ++S    T +   +  E+L   L  + P ++ E   +L+      +M      L+   IP L     D   +VR  A   L T M  +   K+     K+      ++    EKA+
Sbjct:  525 LDSANWKERLASMEEFQRAVEQMDKSE----MPCQALVRMLAKKPGWKETNFQVMQMKLHIVGLIAGKGTFSKTSALVVLDGLVDKIGDV---KCGGNAKEALTNIGEACSLPWTAEQVVSLAFAQKNPKNQAESLNWLANAMKEFGFAGINVKAFINNVKTALGATNPAVRTSAIALLGVMYLYMGA-PLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTR---GQTKKGAEEDGEDADEEDGVDRGAG---------DIMDLLPRTDISDKITSDMVAKISDKNWKIRKEGLDEVSAVISEAKFIQSNIGDLPMALKGRLG-DSNKLLVQQTLNIFQQIATAMGPSLKQHVRNLGFPIITVLGDSKPNIRATALATLNSWVEQTGMKEWLEGEDLSEELKRENPFLRQELLGWLSERL--PNMRTVPADLM-LFIPHLYACLEDRNGDVRKKAQDALPTFMMHLGYDKMNKATSKLKTSSKDQVVAMLEKAR 995          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Cavefish
Match: ENSAMXT00000018997.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001464.1:100557:121886:-1 gene:ENSAMXG00000018449.2 transcript:ENSAMXT00000018997.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 381/1072 (35.54%), Postives = 579/1072 (54.01%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPT-----GG--GDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTM--------------KATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVK 3224
            M +  ++K L T  K EHK WKAR+ GY EAL+  Q     K P +  Y GL+K  V DSNAVAQ K LE  L +++ A++A++ A ++  G+V K FN  + + +EL  +I  + +EIE+ + V EEL+KGL  K PK+ +  + VL+  + +FG K+V +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I  V + EL  E+ KLP   P  SR+L+SQ+   +   +       GG  GDA P             +D Y+L++ VE++SK+P +++++IE KKW +RK+ALE +E LT NPKL  GEYGD++K+L KV+ KD+N++LV ++AK +  +A GLRKKFS YA + +   LEKFKEKK  VV+AL++ ID+ F++T++    E+ L  +++K PSV+ + +LFL R F   +       LLK     L     DS PEVRDAAF+ LGTAMKVV E+ + P+L  +D +K+ +I E  EK + A       P K           PPKAE  AE                A ++  G   K P      +   D                  +A  +   + +  +   NWKER AA E      +     ++PCQ ++R++  KPG K+ N QV++ K+++I  +   G  + T+A   +  + EK+GD+K     K  LT +++   LP  A QV+  A    N KN  EALNWL +AIK+FGF  + +   +  ++ A+  TNPAVR S I L   + LYV   +    + EK ++   ID E E +K   PP P RG    +   E     E          ++ D++PR +I+ KIT  +L+++ DK  K++KE L +VT ++S +  I   G+  L  A+    TDS+ ++ +  +++L  +  A      ++YIK +   + +  +D K   R   +T LN W E+ G    ++G  + E +K +NP+ +  +  W+   L  L    +P  LL        LPHL+S +E+R+ DVRK +QEA+  FM+  GYD M K
Sbjct:    1 MGDDSEWKKLPTDQKCEHKVWKARLSGYTEALQQFQRITDEKSPEWGKYQGLIKKFVTDSNAVAQLKGLEAALAYIENAHLASRTAGEVVSGVVCKVFNQPKARAKELGSDICLMYIEIEKAEAVQEELLKGLDNKNPKIALACVEVLRRAISEFGSKVVTLKPVVKVLPKLFESREKAVRDEAKLLAVEVYRWI-RDALRPPLQNINSVLLKELEEEWAKLPTSAPRQSRFLRSQQDLRAKFEQQQQNAGDGGDEGDAAPA------------VDAYELLEAVEILSKLPKDFHEKIEAKKWQERKEALEALETLTKNPKLESGEYGDVVKALNKVIGKDSNVMLVTIAAKCVAGLAAGLRKKFSTYAGHLVPTILEKFKEKKAQVVQALQEAIDAVFLSTTLQNVSEDTLAVMDNKNPSVRQQASLFLARSFRHCTPTTLPKSLLKPFCVALLKQVNDSAPEVRDAAFEALGTAMKVVGERAVNPFLADVDKLKIDKIKECSEKVELAGGKKPAGPAKEKA--------PPKAEPPAE----------------APAKPSGPPKKAPAAKVNHLQRWDSFIHSCFFTRVLPEVCEERAGAVLPASCMQTLDSANWKERLAAMEEFHKAAEQMDSKEMPCQALVRMLAKKPGWKETNFQVMQLKMQVIATVAQRGTFSRTSALAVLEPVVEKVGDVKCGVKAKEALTGVAEACGLPWTAEQVVSLAFGQKNPKNQAEALNWLCNAIKEFGFAGVNVKAFINNVKTALAATNPAVRTSAISLLSVMFLYVGAPLRMFFEGEKAALLSQIDAEFEKVKCQTPPAPIRGGSKASGGEEADEQEEEAEAGD----DVVDLLPRTDISDKITSEMLSKIGDKNWKIRKEGLDEVTAVLSEAKFIK-PGVGELPTALKARLTDSNKILVQQTLSILQQMATAMGPA-IKQYIKSLGFPIFTVLTDSKNTVRAAGLTTLNGWVEQTGMKLWLEGEELAEEMKKENPFLRQELLGWLVVKLPAL--RSVPSDLLL------CLPHLYSCLEDRNADVRKKAQEALPVFMMHLGYDKMNK 1021          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Cavefish
Match: ENSAMXT00000053947.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001464.1:86793:103542:-1 gene:ENSAMXG00000018434.2 transcript:ENSAMXT00000053947.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.491 bits (589), Expect = 1.096e-63
Identity = 183/609 (30.05%), Postives = 314/609 (51.56%), Query Frame = 3
Query: 3627 LFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXX-----XXXXXXXXXXQKPSRQ---------RENSATREQPKPQISQLPPKTIDINPL----LKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITD-MFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKS 5387
            L + LF TD +K +KAI    S +   D + +EAT   LDLILKW  +RF +TN SVL K L+YL  +F  L  +  + L EHE + FIP LI+K+G+PKD VR   + I+ L+   Y   ++  FL +   +K ++ R EC + L  L+    + V  Q     L+ +A+ I +RD  VR AALN +V A+N  GE + K++  L +KD SML ERIKRS K  S+   S      +  SA+    +KPS           R   A  +QP PQ S   P+   ++P     L E I   L+ V+        PL+    ++         +L S S   S   +S+ +I  VI  + S++ + S+Q +A+I +V++ +   +  + ++D  +++  MQL+     RL++E+    +  D ++  ++ TL S+    +LA E +   L +L+ ++L ++++ Q    S+   +IR IN++ + + ++++ T  LSALL ++ +   +    S++  ++ KC W M + L   + ++ L  I  DI  F    P  I + + +   +  RTVKTL++++    G   ++ L  I      ++E ++R++
Sbjct:    9 LMEDLFHTDFQKHIKAI---GSMMEHLDAE-VEATVGCLDLILKWFTLRFFDTNTSVLMKALEYLKLLFIALS-NQDYHLTEHEASSFIPYLILKVGEPKDVVRKDVRSIISLLRRVYPASRVFPFLMDGTKSKNSKQRAECLEELGCLVGLCGMSVFQQTATKALREIAVHIGDRDTAVRNAALNAVVMAYNVCGEQVYKLIGQLSEKDMSMLEERIKRSAKKPSTAAASKPPEEKVAGSANASMLRKPSSNEAPLKLSEIRSQKAAEQQP-PQPSSTVPREFQLDPNFIVDLPETIMPDLLVVESVETAEATPLDVPEFKF---------RLPSISSSCSTREDSS-SINLVISQVASSDAKISVQGLAKIGKVLQEESKWSLFLGHVDEFIVAALMQLRLLASKRLADERTERQQQVDKLYSLVINTLNSLVMVGKLAQEASPGVLKDLVYALLSLILDPQHQDSSKESPLIRSINVVLLALCKNADPTNTLSALLMLLQEACTSTACSSEFSEMVMKCHWRMIRLLPEKIEALYLDKILLDIHNFMKLIPKEILKQKSNA--MAQRTVKTLLHTLYRLVGPKIMDHLSLIENRSESEVEAHLRRA 599          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Cavefish
Match: ENSAMXT00000052533.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001464.1:83947:102121:-1 gene:ENSAMXG00000018434.2 transcript:ENSAMXT00000052533.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 230.335 bits (586), Expect = 2.283e-63
Identity = 183/609 (30.05%), Postives = 314/609 (51.56%), Query Frame = 3
Query: 3627 LFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXX-----XXXXXXXXXXQKPSRQ---------RENSATREQPKPQISQLPPKTIDINPL----LKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITD-MFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKS 5387
            L + LF TD +K +KAI    S +   D + +EAT   LDLILKW  +RF +TN SVL K L+YL  +F  L  +  + L EHE + FIP LI+K+G+PKD VR   + I+ L+   Y   ++  FL +   +K ++ R EC + L  L+    + V  Q     L+ +A+ I +RD  VR AALN +V A+N  GE + K++  L +KD SML ERIKRS K  S+   S      +  SA+    +KPS           R   A  +QP PQ S   P+   ++P     L E I   L+ V+        PL+    ++         +L S S   S   +S+ +I  VI  + S++ + S+Q +A+I +V++ +   +  + ++D  +++  MQL+     RL++E+    +  D ++  ++ TL S+    +LA E +   L +L+ ++L ++++ Q    S+   +IR IN++ + + ++++ T  LSALL ++ +   +    S++  ++ KC W M + L   + ++ L  I  DI  F    P  I + + +   +  RTVKTL++++    G   ++ L  I      ++E ++R++
Sbjct:    9 LMEDLFHTDFQKHIKAI---GSMMEHLDAE-VEATVGCLDLILKWFTLRFFDTNTSVLMKALEYLKLLFIALS-NQDYHLTEHEASSFIPYLILKVGEPKDVVRKDVRSIISLLRRVYPASRVFPFLMDGTKSKNSKQRAECLEELGCLVGLCGMSVFQQTATKALREIAVHIGDRDTAVRNAALNAVVMAYNVCGEQVYKLIGQLSEKDMSMLEERIKRSAKKPSTAAASKPPEEKVAGSANASMLRKPSSNEAPLKLSEIRSQKAAEQQP-PQPSSTVPREFQLDPNFIVDLPETIMPDLLVVESVETAEATPLDVPEFKF---------RLPSISSSCSTREDSS-SINLVISQVASSDAKISVQGLAKIGKVLQEESKWSLFLGHVDEFIVAALMQLRLLASKRLADERTERQQQVDKLYSLVINTLNSLVMVGKLAQEASPGVLKDLVYALLSLILDPQHQDSSKESPLIRSINVVLLALCKNADPTNTLSALLMLLQEACTSTACSSEFSEMVMKCHWRMIRLLPEKIEALYLDKILLDIHNFMKLIPKEILKQKSNA--MAQRTVKTLLHTLYRLVGPKIMDHLSLIENRSESEVEAHLRRA 599          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Cavefish
Match: ENSAMXT00000018984.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001464.1:83947:101318:-1 gene:ENSAMXG00000018434.2 transcript:ENSAMXT00000018984.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 6.894e-50
Identity = 155/550 (28.18%), Postives = 278/550 (50.55%), Query Frame = 3
Query: 3804 KGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXX-----XXXXXXXXXXQKPSRQ---------RENSATREQPKPQISQLPPKTIDINPL----LKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLG-RLSEEKFSESEITD-MFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKS 5387
            K L+YL  +F  L  +  + L EHE + FIP LI+K+G+PKD VR   + I+ L+   Y   ++  FL +   +K ++ R EC + L  L+    + V  Q     L+ +A+ I +RD  VR AALN +V A+N  GE + K++  L +KD SML ERIKRS K  S+   S      +  SA+    +KPS           R   A  +QP PQ S   P+   ++P     L E I   L+ V+        PL+    ++         +L S S   S   +S+ +I  VI  + S++ + S+Q +A+I +V++ +   +  + ++D  +++  MQL+     RL++E+    +  D ++  ++ TL S+    +LA E +   L +L+ ++L ++++ Q    S+   +IR IN++ + + ++++ T  LSALL ++ +   +    S++  ++ KC W M + L   + ++ L  I  DI  F    P  I + + +   +  RTVKTL++++    G   ++ L  I      ++E ++R++
Sbjct:    2 KALEYLKLLFIALS-NQDYHLTEHEASSFIPYLILKVGEPKDVVRKDVRSIISLLRRVYPASRVFPFLMDGTKSKNSKQRAECLEELGCLVGLCGMSVFQQTATKALREIAVHIGDRDTAVRNAALNAVVMAYNVCGEQVYKLIGQLSEKDMSMLEERIKRSAKKPSTAAASKPPEEKVAGSANASMLRKPSSNEAPLKLSEIRSQKAAEQQP-PQPSSTVPREFQLDPNFIVDLPETIMPDLLVVESVETAEATPLDVPEFKF---------RLPSISSSCSTREDSS-SINLVISQVASSDAKISVQGLAKIGKVLQEESKWSLFLGHVDEFIVAALMQLRLLASKRLADERTERQQQVDKLYSLVINTLNSLVMVGKLAQEASPGVLKDLVYALLSLILDPQHQDSSKESPLIRSINVVLLALCKNADPTNTLSALLMLLQEACTSTACSSEFSEMVMKCHWRMIRLLPEKIEALYLDKILLDIHNFMKLIPKEILKQKSNA--MAQRTVKTLLHTLYRLVGPKIMDHLSLIENRSESEVEAHLRRA 537          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009507.1 (pep scaffold:Pmarinus_7.0:GL477430:472908:497137:1 gene:ENSPMAG00000008554.1 transcript:ENSPMAT00000009507.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 403/1098 (36.70%), Postives = 617/1098 (56.19%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL-VKPTGGGDAVPQQSVGKHPQNNVD----IDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEK----------------AKQASEATIVLPEKSA----VVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAK 3290
            MA+  ++  L    + EHK WKAR+ GYEEALK  Q  D  K P F+ YLGL+K  V DSNAVAQ K LE  L+FV+ ANVA K   ++  GIVNK FN  + + +EL  +I  + +EI++ D V EE++KGL  K PK+VV  I   ++ L +FG KIV +K + K + KL E RDK VR+  K L +E+YRWI   AL   L  I P+Q+ EL  E+EK+P      +R+++SQ+        + T  GD      V    ++  D    +DPYDL++P+E++SK+P ++YD++E KKW +RK+ALE +E L  +PKL PG+YGD+++ L KV+ KD+N++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  VV+AL++ ID  F+TT++    E++L  L++K PS+K + +LFL R F   +       LLK     L     DS PEVRDAA++ L TA+KVV EK + PYLD++D +KL +I E  EK                +K AS +    P  SA       + +P  PPK    A         K AA    A ++    A K  E+  E  +S +    KA  +   + L Q+   NWKER A+ E  Q  V+     ++PCQ +IR++  KPG K+ N QV++ K++++  +   G  + T+A + +  L +KIGD+K  +  K  LT +S+  NLP  A +++  A    N KN  E L WL++AIK+FGF  + +   +  ++ A+  TNPAVR S I + G + LY+   +    +DEKP++   ID E E  K   PP P RG            D E      +  +N++D++ R +I +KIT +L+ +L DK  K++KE L +V  I++ +  I+ + +  L  A+     DS+ ++ +  + +L  +  A    + +++++ +   ++++  D K   R  A+  LN W E+ G  + ++G  ++E LK +NPY +  +  W++         KLP     P   +  +P+L+++IE+R+ DVRK +Q+AV+PFM+  GY+ M K      K S K  +M  LDK +
Sbjct:    1 MADDSEWMKLPVDQRCEHKVWKARLNGYEEALKIFQKLDE-KSPEFSKYLGLIKKFVTDSNAVAQLKGLEAGLIFVENANVAGKTGGEVVAGIVNKVFNQPKARAKELGMDICLMYIEIDKPDPVQEEMLKGLDNKNPKIVVACIETFRKALCEFGSKIVQLKPIVKLLPKLFESRDKPVRDEAKSLAVEIYRWI-RDALRAPLKNINPLQLKELEDEWEKMPNTPAKQTRFMRSQQDLRMKFEQQQTDNGD------VAAGHEDEADAAPALDPYDLLEPMEILSKLPKDFYDKVEAKKWQERKEALEALEVLLKHPKLEPGDYGDVVRVLKKVIGKDSNVMLVALAAKCLGCLAAGLRKKFHTYAPHVMSTLLEKFKEKKPAVVQALQEAIDEVFLTTTLQVVSEDVLAVLDNKNPSIKQQASLFLARSFRHCTTSTLPKSLLKPFCVALLKQTNDSAPEVRDAAYEALATALKVVGEKAVNPYLDEVDKLKLEKIKECAEKVELAQGGKKVGGTATASKSASPSAKAGPTASAETARSTTSSRPSGPPKKVAAAGVKPGGPPRKAAAGGKAATAKGKKGAEKQDEVEHE--LSTEACEEKAAAVLPPSCLQQLDSSNWKERLASMEEFQKAVETMGKDEMPCQALIRMLAKKPGWKETNFQVMQLKLQIVALVAQKGNFSKTSARIALEGLVDKIGDVKCGNFAKDALTAVSEACNLPWTAEEIVAMAFGQKNPKNQSETLTWLANAIKEFGFAGVNVRAFISHVKTALSATNPAVRTSAIAILGVMYLYMGPPLRMFFEDEKPALLNQIDAEFEKTKGQTPPAPFRGQSKRGEDASEDADGETEVDCVM--VNVQDLVTRIDICNKITPDLVTKLGDKNWKIRKEGLDEVVAILNEAKFITAN-IGDLPGALKSRLNDSNKILMQQTLGILQQVATAMG-PNVKQHVRSLGFPIIATLGDAKNTVRAAALATLNTWVEQTGMKDWLEGEDLSEELKKENPYLRQELLGWLA--------EKLPDLRTVPADLALCVPYLYASIEDRNGDVRKKAQDAVIPFMMHLGYEKMTKA-TGKLKASSKDPVMAVLDKCR 1075          

HSP 2 Score: 171.4 bits (433), Expect = 9.910e-43
Identity = 109/288 (37.85%), Postives = 164/288 (56.94%), Query Frame = 3
Query: 3441 KMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQ---QLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQ--KNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGK 4289
            K  +K+N + D+D      +   + K+QR++E+R  KV KW  +    +   QL +Q S+  +  L + LF  D +   KA+ ++   + E +KD   +    LDL+LKW+ +RF ETN SVL K L+YL  +F  +  D  + L + E N FIP LI+K+G+ KD +R   + I+  I   Y   K+  F+ + + +K ++ R EC + L  LID   I+V        LK +A  I +RDN+VR AALN +V A+N  GE +LK++ +L DKD SML ERIKRS K
Sbjct: 1178 KTASKTNLKEDEDRGGAIFIVVPNGKEQRVKEERALKVLKWNFTTPRDEYIEQLKTQISSCVARWLLEELFHADFQHHNKALGIMTERM-ESEKDGCLSC---LDLVLKWVTLRFFETNTSVLMKVLEYLKILFLTISADG-YCLTDFEANSFIPYLILKVGESKDTIRKDVRMIMNTICKVYPASKMFVFVLDGIKSKNSKQRAECLEELGVLIDSYGINVCQPTPAKALKEIATQIGDRDNSVRNAALNTIVVAYNLAGEQVLKMIGNLADKDMSMLEERIKRSAK 1460          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Yeast
Match: STU2 (Microtubule-associated protein (MAP) of the XMAP215/Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p [Source:SGD;Acc:S000004035])

HSP 1 Score: 135.961 bits (341), Expect = 1.695e-32
Identity = 141/552 (25.54%), Postives = 250/552 (45.29%), Query Frame = 3
Query:   81 EVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMS--DSGKDPLFNPYL---GLVKNMVIDSNAVAQEKALEVILLFVQE-ANVANKAANDIC------PGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEEL-IKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMK----EMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTA--LNPVL-SQIKPVQVTELNAEFEKLPQEKPVPSRYL-----------KSQ----KPKESALVKPTG------GGDAVPQQSVGKHP---QNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALE----IIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRK-KFSP-YAVNTIQATLEKFKEKKTNVVKALRDCI-------DSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVF--EKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINE 1559
            E +D+  L   +++ +K WKAR+E Y+E  +  + S  D  +D     Y     L    + DSN VAQE+A+  +   +   A+ + K A++I       P +V K   S+R  T+  +   +  +  ++       EL I     K PK++  + N + E++  FG   V ++    E+ K V +L    D+NVR     LI+E+Y+  G+ +  L  +L  ++KP+QV +L+  F K+  E P  S+ L           +SQ    + ++S L    G       GD +        P   Q+ V ID + ++    ++ K+P ++ ++I   KW DR +ALE     +   T   K     Y +L+     ++ KD NI  VAL+A+ +  I   L+   FS  Y        L++ KEKK +V++A+R  +       D    +   +  ++++L  + HKTP ++ E     N     EK         L  +++P +  +  D+ P +R   F++    +K+         L+ +DN+K  +I E
Sbjct:    5 EEVDYTTLPLEERLTYKLWKARLEAYKELNQLFRNSVGDISRDDNIQIYWRDPTLFAQYITDSNVVAQEQAIVALNSLIDAFASSSLKNAHNITLISTWTPLLVEKGLTSSRATTKTQSMSCILSLCGLDTSITQSVELVIPFFEKKLPKLIAAAANCVYELMAAFGLTNVNVQTFLPELLKHVPQLAGHGDRNVRSQTMNLIVEIYKVTGNNSDLLEEILFKKLKPIQVKDLHKLFAKVGDE-PSSSKMLFEWEKRELEKKRSQEEEARKRKSILSNDEGEYQIDKDGDTLMGMETDMPPSKQQSGVQIDTFSMLPEETILDKLPKDFQERITSSKWKDRVEALEEFWDSVLSQTKKLKSTSQNYSNLLGIYGHIIQKDANIQAVALAAQSVELICDKLKTPGFSKDYVSLVFTPLLDRTKEKKPSVIEAIRKALLTICKYYDPLASSGRNEDMLKDILEHMKHKTPQIRMECTQLFNASMKEEKDGYSTLQRYLKDEVVPIVIQIVNDTQPAIRTIGFESFAILIKIFGMNTFVKTLEHLDNLKRKKIEE 555          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Nematostella
Match: EDO43210 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZB8])

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 686/1990 (34.47%), Postives = 1078/1990 (54.17%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEA--NVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESV----MSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGR-MTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLK----NETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASS---QQLNSQFSASCSPELF-QLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQK--NLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSATREQPKPQISQLPPKTIDINPLLKEEIGYKLIN--------------VDKEVEELL-QPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATL-GRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLK-------NGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLP--NPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKDNL-AYCNMDPESLLLRLKQLRKNAGL-DKSNFDKTEKQNRLSSPTRDE 5912
            MA  LD   ++  D++ HK WKARV GYEE ++  + +D      F+ YLG +K MV+D+NAVAQ+K LE +L F++ A  +++ + A D+  G + KC N+ R KT+E   EI+ + VE+E+QD+V EEL+KGL  K PK+V   INV  +++  FG KI  +K + K + KL +  DK+VRE  K L IE+Y+WI   AL   L  IKPVQ+ EL+ E+ KLP   P P+R  ++Q+ K     +  G  DA P    G      +DIDPY+++D VE++SK+P ++Y+ +E KKW  RK+ALE +EKL +NPKL  G+YG+LM +L K++SKD N+++V L+AK +  +ATGLRKKFS Y+   + A L+KFKEKKT VV ALRD ID+ ++TT++ A  E+LL AL++K PS+K ETA FL R F KS         +K I   L     D+   VRDA  ++LGT  K++ EK + PY+DK+D +K  ++ EF +KA+        +  K          E  K    ++ +     SKPA       + K G     P      V    ++++DV  KA D+F    L ++   NWKER A  E L   V++     + CQ++IR++  KPG KDNN QVLK+K +L   I   G+  +  +AE  I  L EKIGDIK  D VK TL  +S+ +NL  V+ +V + A    N K + E+L+WL  A+KDFGFKI +   V +++ A+ +TNPAVR   I L G + +YV   I    ++EK ++   ID+E+  +K   PP PTRGLK    +     E   D            NLED+IPR +I+++I  +L+  L+DK  KV+ E L  V +I++A+  I+ D L  L  A+     DS+  +    +N+  ++  A    + +++   + PA+ S+ +D KP  R   +TALN W +++G    ++G  +  AL  +NP+ +  +  W+        + KLP +   P   S ILP ++S +E+R+ DVRK +Q AV   M   GYD+M+K   +  K + K  ++G L+K +  +P P    +K   K+ASS  +  ++  A     S  +K  K   + S +    S ++ + +      L  N+ K +RI++++  KV KW  S       +QL  Q S   S  +  QL    D K+ +KAI  L    +E   +++    Q+LD+ILK++ +RF +TN +VL K L++L  +FT+L  +S +Q+LEHE + FIP L+ K+GDPKD VR   + + KLI+  Y   K+  ++ E + +K ++ R EC + L  LI    ++V        + ++A  I +RDN VR AALN +V A+  +GE + K    L+DKD S+L ERIKRS K     T ++ +      R + P+   +    + QP  + +  P    D N   +  + Y  I                 + VE+L+ +P+++ T +  P  P L        G  S++ ++  A+  VI  I SN++  S QA+ Q++ V+RN+     +V ++D  + +  +QL   L   +  E+  E  +T +   ++  ++S+F    LA E++RD L +L+QS+L  V++D+LVSL EG  IIR  N+L  +I++ +N T  + AL+R++ D +K       N  +  K++ LI K +W M ++L  T+  ++  ++  DI  F    PP +W +R    D PLRT++++++S+   KG   L     I      ++  Y+ K+      P  T  P  N T+ S   +    G++   V K N     E+L +IF  I   E  ++GL  LYD KL+YP  D   +L +T+P+F+  IE GL+NI  ER   +    G+N+  +S +    +   +       P + + RL+ LR  +GL + +N D T+ +     P   E
Sbjct:    1 MAADLDLTKISLDDRLTHKVWKARVNGYEELVQIFKRTDDETSSEFSKYLGFMKKMVVDNNAVAQDKGLEAVLAFLEGAAPSISGRVAGDVICGCITKCLNA-RTKTKEKGIEIILMYVEVEKQDIVQEELLKGLENKQPKIVAACINVFTQIISLFGGKIFLLKPIVKVLPKLFDHSDKSVREEAKLLAIEIYQWI-RDALRQQLQNIKPVQLKELDEEWGKLPPAPPAPTRLTRTQQKKLEEQ-QAQGISDA-PYADDGGAVAETIDIDPYEMMDAVEILSKLPKDFYENLEAKKWQTRKEALEALEKLASNPKLEGGQYGELMSALKKIISKDANVMVVTLAAKCVAHLATGLRKKFSAYSAMMVSAILDKFKEKKTTVVTALRDAIDAVYLTTTLPAMQEDLLAALDNKNPSIKEETAKFLTRTFCKSVPSQVPKAFMKPICANLVKKMDDTAGPVRDAVAESLGTLTKLIGEKAMTPYIDKLDKLKADKVKEFADKAE--------IKAKPGSGGGGGGGEGAKPVAASKPAAAAPASKPAPPPKKKPAVKAGGKKAGPSATFNEVKEPELTDEDVQAKAADLFPADLLEKLAHTNWKERMAGMEELHKLVESMDDKTMECQVLIRVLGKKPGWKDNNFQVLKSKFQLCGIIAGKGKTFSSRSAEYAIPGLVEKIGDIKLKDAVKETLMIISEKLNLGYVSLKVSQIAGGQKNPKVISESLSWLGSALKDFGFKIDLKPHVQYLKDALANTNPAVRTEAISLIGVLHMYVGPTIRVFFEEEKAALLSQIDDEIAKVKDEKPPAPTRGLKPAAADGDDDGEEGGDDAGGDEDDGSSANLEDLIPRNDISNEIKPDLIDMLADKNWKVRGEGLQKVQEILAAAKFITPD-LGDLPSALKARLGDSNKNLVITTLNICGTIATAMG-ANVKRHFGTLGPAMFSTLADAKPHLRAAGITALNAWHKEIGMVAFIEGEILFGALSTENPFLRIEVLGWL--------EEKLPGEQKLPPALSTILPPMYSCLEDRNGDVRKKAQAAVPAVMAHLGYDVMLKQ-ANKLKPASKPVVVGILEKLRGTVPEPAKSATKTSSKSASSKTESASTTSATPAANSGPSKRPKSAVQSSKQPAKTSKKKANVEEETGPPLIANNEKDKRIKDEKDLKVMKWNFSTPRDEFIEQLKEQMSKCFSKTIMSQLFHPNDFKQQLKAIATLQQVYAEYKTEAM----QSLDMILKYLTLRFFDTNTTVLIKCLEFLVALFTMLA-ESDYQMLEHEASSFIPYLVTKVGDPKDVVRKMIRSLFKLITKVYPASKMFNYVSEGISSKNSKTRMECLEELGCLIQVYGMNVCQPTPPKAIAAIASQIGDRDNGVRNAALNAVVEAYFLVGETVYKYAGRLNDKDMSLLEERIKRSAKN-RPSTAAAPEEPKPVARQRGPTADNDKKPAKAQPVARPATAPALKRDDNIKREFALDYDTIEGGSSEADVFVPNLVSHESVEDLISEPIQRPTTK-TPSSPHL--------GVFSRT-SAPAALNYVISQIASNDIMASTQALVQLEVVLRNKS-DGAIVKHVDQFLNAAALQLNIILTTHIGNEEVDEQAVTRLLNCLVDAIMSLFANPSLAAEVSRDTLKHLVQSMLTTVLDDRLVSLKEGTQIIRTFNVLMAKIIDRTNPTVCMGALIRLLQDSVKMLQDHVGNSLSSPKFVELIMKGMWKMVRSLPKTIKDVNAELVLLDIHKFLVAHPPQVWRSR--ADDTPLRTIRSVLHSLAKLKGIDILGCTNLIEDAEQSEVYGYLHKALKTGYKPPSTSDPINNSTEESKNEKNGHAGSRGTSVTKLN-----EKLAEIFRMIASKENTREGLAQLYDLKLRYPQADTDPFLQKTSPFFRNYIERGLRNIEMERKGKK----GANENTSSSSTVISNPPEVPQQAGEGPAAYMDRLRILRMKSGLGNNTNMDATKDRENNQKPISQE 1939          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Medaka
Match: ckap5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:101172655])

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 558/1685 (33.12%), Postives = 913/1685 (54.18%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL-VKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGF-KIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTR-GLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQ---QLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGN--QKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQ----RENSATREQPKPQISQLPPK-TIDINPLLKEEIG--YKLIN-VDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLK-ATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCL 5078
            MA+  ++  L    K EHK WKAR+ GYEEALK  Q  +  K P +  YLGL+K  V DSNAVAQ K LE  L FV+ A+VAN+   ++  G+V K FN  + + +EL  +I  + +EIE+ +VV EEL+KGL  K PK+VV  +  L++ L +FG KIV +K + K + K  E R+K VR+  + L +E+Y+WI   AL P L  I  VQ+ EL  E+ KLP   P  SR+L+SQ+  ++    +   GG+     S+G      + +DPY+L++PVE++SK+P ++YD+IE KKW +RK+ALE IE LT NPKL  G+YGDL+++L KV+ KD N++LV+L+AK +  +ATGLRKKF  Y+   +   LEKFKEKK  VV+AL++ ID+ F+TT++    E++L  +++K PS+K + +LFL R F   S       +LK     L     DS PEVRDAAF+ LGT MKVV EK + P+L  +D +KL ++     +     +   +      +   +    PPK  K A   K                     AS V E+ TE+ +S+      A  +  E  L  +   NWKER A+ E  Q  V+      +PCQ ++R++  KPG K+ N QV++ K+ ++  +   G+ + T+A + +  L +K+GD+K   N K  LT + +  +LP  A Q++  A    N KN  EALNWL++A+K+FGF  I +   +  ++ A+  TNP VR + I L G + LY+   +    +DEKP++   ID E E ++  +PP P R   K+ +   E     E          ++ D++PR +I+ KIT +L++++ DK  K++KE L +   IIS +  I    +  L  A+     DS+ ++ +  +++L  L  A      ++++K +   +++   D K   R  A+T L  W ++ G  + ++G  ++E LK +NP+ +  +  W++  L  L    +P  L+        +P L++ +E+R+ DVRK +Q+A+  FM+  GYD M K      K + K  ++  L+KA+A +P     P+K      S++     +         +  K +      + K   K  ++ DK   +   +   + K+QRI+E+++ K+ KW       +   QL +Q S   +  L   L+  D ++ +KAI ++   L  +     EAT   LDLILKW  +RF +TN +VL K L+YL  +F +L  D ++ L E+E N FIP LI+K+G+ KD VR   + IL ++   Y   K+  FL E   +K ++ R EC + L  LI+   ++V        LK +A+ I +RD +VR AALN +V+ +N  G+ + K++ ++  +  S LL  I +S    +    +        E  Q+ S Q    REN A R   KPQ   LP +  +D+  + ++ I   YK+ + ++  ++ELL+P+         + P  +  L  +      S  S   I  VI  + S ++ TSIQA+AQIDEV+R +D    +  ++D L+++  MQL+      L++++  + ++  ++  ++ +L+S+F+ + LA E +   L +LM  ++ ++++ ++  + EG  +IR +N+L +R+LE S+ T ++ +++     CL
Sbjct:    1 MADDSEWMKLPVDQKCEHKVWKARLNGYEEALKLFQRIEDAKSPEWGKYLGLIKKFVTDSNAVAQLKGLEAALAFVENAHVANRTTGEVVSGVVTKVFNQPKARAKELGMDICLMYIEIEKAEVVQEELLKGLDNKNPKIVVACLETLRKALGEFGSKIVTLKPVVKILPKQFESREKAVRDEARLLAVEIYKWI-RDALRPSLQNINSVQLKELEEEWVKLPSTPPKQSRFLRSQQDLKAKFEQQQVQGGEHSDGGSLG------ISVDPYELLEPVEILSKMPKDFYDKIEAKKWQERKEALEAIETLTKNPKLENGDYGDLVRALKKVVGKDANVMLVSLAAKCLAGLATGLRKKFGTYSGQVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNLSEDILAVMDNKNPSIKQQASLFLARSFRHCSQATLPKSVLKPFCAALIKQVNDSAPEVRDAAFEALGTVMKVVGEKAVNPFLADLDKLKLDKVRFIAAETVYCWKPAALNFRSCNLFFLQPSAGPPKKGKPASGGKAKK-----------------VASDVKEV-TEAELSDGVCEELAAGVLPENCLQALDSANWKERLASMEEFQKAVETMDTVTMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALVAQRGQFSKTSASVVLEGLVDKVGDVKCGGNAKEGLTAIGEACSLPWTAEQLVSLAFAQKNPKNQAEALNWLANAMKEFGFTGINVKAFINNVKTALGATNPGVRTAAITLLGVMYLYMGAPLRMFFEDEKPALLAQIDAEFEKMQGQSPPAPIRFNRKSASAEDEVDEGEEQDEDGGGGGQDIMDLLPRSDISDKITSDLVSKIGDKNWKIRKEGLDEAAAIISEAKFIK-PTIGELPFALKGRLADSNKILVQQTLSILQQLATAMGP-GIKQHVKSLGIPIITVLGDSKANVRSAALTTLQAWVDQTGMKDWLEGEDLSEELKRENPFLRQEVLGWLAEKLPAL--RTVPGDLML------CVPQLYTCLEDRNGDVRKKAQDALPTFMMHLGYDKMNKA-TGKLKPASKDQVVAMLEKARAVMPAKPAAPAKAGGGKGSAD--LGGTASEHPDGKPEVKKIRGGAGPGTKKPAAKGLKEEDKSGPIFIFVP--NAKEQRIKEEKQLKILKWNFITPRDEYVEQLKTQMSTCLAKWLQDELYHLDFQRHVKAIGVMIERLESER----EATIGCLDLILKWFTLRFFDTNTTVLMKALEYLKLLFIMLN-DENYHLTEYEANSFIPYLILKVGESKDGVRKDVRAILTMLCKVYPASKVFPFLMEGTKSKNSKQRAECLEELGCLIEGYGMNVCQPTPAKSLKEIAVHIGDRDTSVRNAALNTVVAVYNVCGDQVYKLIGNVR-RTHSFLLGSIHQSAFIPAVRKRNEHAGGEDQEVGQEGSSQAERLRENPA-RTSSKPQRHLLPQEFKLDLEKIEEDMIRDEYKMPDLIEHNLDELLEPI---------IIPKFIRNLSLHFDDVHNSTAST--INYVISQVASGDINTSIQALAQIDEVLRQEDKADAMSGHIDQLLIATIMQLRLINSTHLADDRVDKKDVIKLYSCIMGSLLSLFSMESLAREASMGILKDLMHGLIMLMLDSRVEDIEEGTQVIRSVNLLVIRVLEKSDPTNLIRSVITGFHSCL 1627          
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Match: SMESG000045143.1 (SMESG000045143.1)

HSP 1 Score: 3043.83 bits (7890), Expect = 0.000e+0
Identity = 1602/1630 (98.28%), Postives = 1612/1630 (98.90%), Query Frame = 3
Query: 1188 KFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSATREQPKPQISQLPPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDKTEKQNRLSSPTRDEMESSVISKLVPSGDGXXXXXXXXXXXXNQMNNKRKMSAQDLAAIKQRFEALKRPN 6077
            + + +K    + LRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEASKKPAQSKPAAKKPVAKSQKPGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAE+YIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFKSSTKTSPKSTIMGFLDKAKAELPVPEPIPSKQLPKAAS+NGKPPASKEAANKKASDSAKPK        K  +KSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLD+SFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVSSETESSIQSSASTERTQKPSRQRENSATREQPKPQISQLPPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSN RPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPY+DLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDKTEKQNR+SSPTRDEMESSVISKLVPSGDGPVSPPAAVVAAANQMNNKRKMSAQDLAAIKQRFEALKRPN
Sbjct:  263 EIQREKDKCSEGLRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEASKKPAQSKPAAKKPVAKSQKPGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAERYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFKSSTKTSPKSTIMGFLDKAKAELPVPEPIPSKQLPKAASTNGKPPASKEAANKKASDSAKPK--------KEDSKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDNSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVSSETESSIQSSASTERTQKPSRQRENSATREQPKPQISQLPPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNTRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYIDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDKTEKQNRVSSPTRDEMESSVISKLVPSGDGPVSPPAAVVAAANQMNNKRKMSAQDLAAIKQRFEALKRPN 1884          

HSP 2 Score: 510.375 bits (1313), Expect = 4.821e-149
Identity = 247/248 (99.60%), Postives = 247/248 (99.60%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTG 818
            MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKES LVKPTG
Sbjct:    1 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESTLVKPTG 248          

HSP 3 Score: 57.3806 bits (137), Expect = 1.414e-7
Identity = 30/39 (76.92%), Postives = 30/39 (76.92%), Query Frame = 2
Query: 1145 VLSICSQYNSSNSREIQREKDKCSEGFT*LHRFCICYDF 1261
            VLSICSQYNSSNSREIQREKDKCSEG     R CI   F
Sbjct:  249 VLSICSQYNSSNSREIQREKDKCSEGL----RDCIDSAF 283          
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Match: SMESG000045143.1 (SMESG000045143.1)

HSP 1 Score: 3006.08 bits (7792), Expect = 0.000e+0
Identity = 1588/1630 (97.42%), Postives = 1598/1630 (98.04%), Query Frame = 3
Query: 1188 KFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFXXXXXXXXXXXIMGFLDKAKAELPVPEPIPSKQLPKAASSNGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKMPNKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVXXXXXXXXXXXXXXXXXQKPSRQRENSATREQPKPQISQLPPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRSYSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDKTEKQNRLSSPTRDEMESSVISKLVPSGDGXXXXXXXXXXXXNQMNNKRKMSAQDLAAIKQRFEALKRPN 6077
            + + +K    + LRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEASKKPAQSKPAAKKPVAKSQKPGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAE+YIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFKSSTKTSPKSTIMGFLDKAKAELPVPEPIPSKQLPKAAS+NGKPPASKEAANKKASDSAKPK        K  +KSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLD+SFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVSSETESSIQSSASTERTQKPSRQRENSATREQPKPQISQLPPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRY              SGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSN RPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPY+DLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDKTEKQNR+SSPTRDEMESSVISKLVPSGDGPVSPPAAVVAAANQMNNKRKMSAQDLAAIKQRFEALKRPN
Sbjct:  263 EIQREKDKCSEGLRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEASKKPAQSKPAAKKPVAKSQKPGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKDIVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPPVPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLLAQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLVISKMAINLLVSLCNAFTKKDAERYIKIVVPALLSSFSDPKPKNREDAVTALNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKLPKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVKNFKSSTKTSPKSTIMGFLDKAKAELPVPEPIPSKQLPKAASTNGKPPASKEAANKKASDSAKPK--------KEDSKSNEQLDKDAVVMALLAKNSNKKQRIQEDRKKKVTKWETSLASSQQLNSQFSASCSPELFQLLFTTDIKKSMKAIELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLCRVFTILCLDNSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISCCYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKSVALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERIKRSGKPVSSETESSIQSSASTERTQKPSRQRENSATREQPKPQISQLPPKTIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRY--------------SGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQLVSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAKELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILESSNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSIDLVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGALEALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGNKPKFVVKSNTRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYIDLSRYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKDNLAYCNMDPESLLLRLKQLRKNAGLDKSNFDKTEKQNRVSSPTRDEMESSVISKLVPSGDGPVSPPAAVVAAANQMNNKRKMSAQDLAAIKQRFEALKRPN 1870          

HSP 2 Score: 510.76 bits (1314), Expect = 3.324e-149
Identity = 247/248 (99.60%), Postives = 247/248 (99.60%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTG 818
            MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKES LVKPTG
Sbjct:    1 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESTLVKPTG 248          

HSP 3 Score: 57.3806 bits (137), Expect = 1.461e-7
Identity = 30/39 (76.92%), Postives = 30/39 (76.92%), Query Frame = 2
Query: 1145 VLSICSQYNSSNSREIQREKDKCSEGFT*LHRFCICYDF 1261
            VLSICSQYNSSNSREIQREKDKCSEG     R CI   F
Sbjct:  249 VLSICSQYNSSNSREIQREKDKCSEGL----RDCIDSAF 283          
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Match: SMESG000045157.1 (SMESG000045157.1)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 414/501 (82.63%), Postives = 451/501 (90.02%), Query Frame = 3
Query:   75 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK 1577
            M E +  K LNT +KI HKNWKARVEGYEEALK MQ+ DS  DP FN YL L+KNMVIDSNA AQEKALEV+LLF Q  NV NKAA DICPGIVNKCFNS RQKTRELAFEILKVIVEIERQDVVM+EL+KGL+ K PKVV GS  +LKE+L DFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTI+  LEKFKEKK+N+V  +R+CID +F   +I+ C+++L+NA  HK P++++ET LF+NR+FEKS+ME W+GKLL Q+IP LT LC DS+PEVR+AAF+TLGTAMKV+ EKKLKPYLD + N+KL RINEF EKAK
Sbjct:    1 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDSRNDPSFNSYLELLKNMVIDSNAFAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSQRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFDAININCCIDDLINASKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNVANLKLVRINEFCEKAK 501          
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Match: SMESG000045157.1 (SMESG000045157.1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 290/340 (85.29%), Postives = 317/340 (93.24%), Query Frame = 3
Query:  558 MKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK 1577
            MKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTI+  LEKFKEKK+N+V  +R+CID +F   +I+ C+++L+NA  HK P++++ET LF+NR+FEKS+ME W+GKLL Q+IP LT LC DS+PEVR+AAF+TLGTAMKV+ EKKLKPYLD + N+KL RINEF EKAK
Sbjct:    1 MKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFDAININCCIDDLINASKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNVANLKLVRINEFCEKAK 340          
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Match: SMESG000045133.1 (SMESG000045133.1)

HSP 1 Score: 303.908 bits (777), Expect = 4.259e-84
Identity = 214/789 (27.12%), Postives = 405/789 (51.33%), Query Frame = 3
Query:  129 KNWKARVEGYEEALKAMQMSDSGKDPLF----NPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAKQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEXXXXXXXXXXXXXXXXXXXXXXGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERSAAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKD--IVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLT--EMSDIINLPLVASQVIKTATENVNIKNLVEALNWLSDAIKDFGFK-IPINDLVPFIRLAVQHTNPAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTN 2468
            KNWK +++ Y + ++ + +    + P+     NP   ++K++  + NA+A EK+LE+++ + + + +  +        I+ KCF ST+ + R    +IL ++ E    DVV E L++ +      +V G +  L  +++    K + +K++ K +  +++ RDK  R+  K+L IE+  + G   + P L  IKPV ++EL +EF+K+ +   +                                       I+  D   PV+++S I  + Y++I+  +  +RK+ LE + ++ +N  L+ G Y +L++ L ++ +KD+ I  V L+ K++ QIA GL+K FS Y+   +++  EKFKEKK  V+   R+CID+AF+TT+++ C E +L +L +K P+++ ET  FL R+ E   +     K  K+++P L  LC D+  +VR+  FQ +G  + +V EK +KP+L+K+D+ KL  IN    K+   ++ +      +A   +   I+P      +E                 K        K+ +   E ++SE D+  K    FG+    ++V + WK R  A + +  +VK+     + CQ+I++    KPGLKD+N QV+K K++++ +  +    R++    ++C+ D+ E++GD+K    VK TL+   ++   N P V +  +   ++  + K+L + L W    + D  FK + + +++P I+  +Q  N  ++Q  + L   + L   E +S   + EKP+I  +I+ E++  +  N
Sbjct:   16 KNWKEKIDTYAKVIEEIDL----QSPIVFLDNNP--EIIKDLFNECNALAFEKSLEMVISYCKVSEIGKRNVKLELKLIIEKCFLSTKSQIRSYGIDILIILSEKYCIDVV-EILLENILSNKRSIVNGILETLMIMIKQV--KKLQIKDIIKQIPNVIDARDKLTRDLSKKLAIEICTYYGRNRIEPCLKDIKPVLLSELQSEFDKVIENINISV-------------------------------------IENEDCKLPVDLLSHISTDMYEKIDGSR-QERKEVLEKLNEVIDNSPLINGNYRELIRKLCQIFTKDSQIASVILAGKLLTQIANGLKKNFSTYSSMLVESCFEKFKEKKPQVLSVTRECIDAAFMTTNLENCFEGILKSLENKNPTIRVETISFLLRITENLQVISSLKKNFKRLMPCLRKLCDDNDVKVREEVFQLIGKIICIVGEKNIKPFLEKLDSTKLQIINSITSKSVPGNQISNNDNNDAAASASIPTIQPLHKIISSE-----------DLLNHVKDNIFKKPVKLIKPFKEMLLSESDLLEKYLQYFGKEVTDKLVSQVWKFRLEACDKVLEFVKSNQIDRMLCQVIVQFTFRKPGLKDSNIQVVKKKLQILNESFLKCENRLSMIVVDLCLNDIIERMGDVKLGAQVKETLSIICLNTTPNEP-VFTNCVHCLSKCKSTKSLSDCLGWFVQFLTDNKFKCLSVKEMLPSIQQLLQSQNAVIKQLVVSLIALLRLDYGEFVSKYFESEKPNIVDMINKEIKKREKLN 745          
The following BLAST results are available for this feature:
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CKAP50.000e+033.50cytoskeleton associated protein 5 [Source:HGNC Sym... [more]
CKAP50.000e+032.61cytoskeleton associated protein 5 [Source:HGNC Sym... [more]
CKAP50.000e+032.61cytoskeleton associated protein 5 [Source:HGNC Sym... [more]
CKAP51.966e-3347.41cytoskeleton associated protein 5 [Source:HGNC Sym... [more]
CKAP51.890e-835.29cytoskeleton associated protein 5 [Source:HGNC Sym... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zyg-91.321e-4630.98Zygote defective protein 9 [Source:UniProtKB/Swis... [more]
F54A3.21.885e-2127.40pep chromosome:WBcel235:II:2243642:2254323:1 gene:... [more]
T08D2.89.441e-1430.52pep chromosome:WBcel235:X:192834:197901:1 gene:WBG... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msps8.973e-2335.64gene:FBgn0027948 transcript:FBtr0304802[more]
msps4.525e-2435.64gene:FBgn0027948 transcript:FBtr0304801[more]
msps3.903e-2435.64gene:FBgn0027948 transcript:FBtr0304803[more]
msps3.903e-2435.64gene:FBgn0027948 transcript:FBtr0301479[more]
msps8.931e-2335.64gene:FBgn0027948 transcript:FBtr0301480[more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ckap50.000e+032.40cytoskeleton associated protein 5 [Source:ZFIN;Acc... [more]
ckap54.686e-8936.62cytoskeleton associated protein 5 [Source:ZFIN;Acc... [more]
ckap58.229e-9229.79cytoskeleton associated protein 5 [Source:ZFIN;Acc... [more]
ckap55.380e-3351.18cytoskeleton associated protein 5 [Source:ZFIN;Acc... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CKAP51.467e-1232.13cytoskeleton associated protein 5 [Source:NCBI gen... [more]
CKAP50.000e+032.22cytoskeleton associated protein 5 [Source:NCBI gen... [more]
CKAP51.082e-3435.85cytoskeleton associated protein 5 [Source:NCBI gen... [more]
CKAP51.146e-3435.55cytoskeleton associated protein 5 [Source:NCBI gen... [more]
CKAP53.128e-8436.96cytoskeleton associated protein 5 [Source:NCBI gen... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ckap50.000e+033.25cytoskeleton associated protein 5 [Source:MGI Symb... [more]
Ckap50.000e+033.25cytoskeleton associated protein 5 [Source:MGI Symb... [more]
Ckap50.000e+033.15cytoskeleton associated protein 5 [Source:MGI Symb... [more]
Ckap50.000e+032.36cytoskeleton associated protein 5 [Source:MGI Symb... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14008|CKAP5_HUMAN0.000e+033.50Cytoskeleton-associated protein 5 OS=Homo sapiens ... [more]
sp|A2AGT5|CKAP5_MOUSE0.000e+033.20Cytoskeleton-associated protein 5 OS=Mus musculus ... [more]
sp|Q9VEZ3|MSPS_DROME8.953e-2235.64Protein mini spindles OS=Drosophila melanogaster O... [more]
sp|Q9PT63|CKAP5_XENLA2.796e-7635.80Cytoskeleton-associated protein 5-A OS=Xenopus lae... [more]
sp|Q94FN2|MOR1_ARATH2.742e-13826.13Protein MOR1 OS=Arabidopsis thaliana OX=3702 GN=MO... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095C1F50.000e+036.52Cytoskeleton-associated protein 5 OS=Schistosoma h... [more]
A0A3Q0KG400.000e+035.45Putative microtubule associated protein xmap215 OS... [more]
G4V7U40.000e+035.24Putative microtubule associated protein xmap215 OS... [more]
A0A5J4NT360.000e+034.70Cytoskeleton-associated protein 5 OS=Paragonimus w... [more]
A0A158R7R49.943e-634.16Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ckap59.128e-1531.05cytoskeleton associated protein 5 [Source:ZFIN;Acc... [more]
ENSAMXT00000018997.20.000e+035.54pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000053947.11.096e-6330.05pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052533.12.283e-6330.05pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000018984.26.894e-5028.18pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009507.19.910e-4336.70pep scaffold:Pmarinus_7.0:GL477430:472908:497137:1... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
STU21.695e-3225.54Microtubule-associated protein (MAP) of the XMAP21... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO432100.000e+034.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ckap50.000e+033.12cytoskeleton associated protein 5 [Source:NCBI gen... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045143.14.821e-14998.28SMESG000045143.1[more]
SMESG000045143.13.324e-14997.42SMESG000045143.1[more]
SMESG000045157.10.000e+082.63SMESG000045157.1[more]
SMESG000045157.10.000e+085.29SMESG000045157.1[more]
SMESG000045133.14.259e-8427.12SMESG000045133.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004281 ID=SMED30004281|Name=Cytoskeleton-associated protein 5-A|organism=Schmidtea mediterranea sexual|type=transcript|length=6256bp
ATCTGCTAAAATTATTATTGCCTGTATTTTGATTTATTAATTATACAAAT
AATTTATATTTAGAAACCTAATAAATGGCAGAAGTTTTAGATTTTAAAGG
TTTAAATACTTTGGACAAAATTGAACACAAAAATTGGAAAGCTCGAGTTG
AAGGATATGAAGAAGCTTTAAAGGCAATGCAAATGTCAGATAGCGGAAAA
GATCCATTATTTAATCCATATTTAGGCTTAGTAAAAAATATGGTTATTGA
TAGTAATGCAGTTGCCCAAGAAAAAGCTTTGGAAGTGATTTTACTTTTTG
TGCAAGAAGCCAATGTGGCTAACAAAGCAGCAAATGATATTTGTCCAGGT
ATTGTGAATAAATGTTTCAATTCAACACGACAGAAGACAAGAGAGTTAGC
TTTTGAAATTCTAAAAGTTATAGTTGAAATTGAAAGACAAGATGTGGTAA
TGGAAGAATTGATTAAAGGTCTTAGTTGCAAAACCCCAAAAGTTGTAGTT
GGATCAATAAATGTTCTTAAGGAGGTTTTACGTGATTTTGGCCCAAAAAT
AGTACCAATGAAGGAAATGTTCAAAACTGTCCATAAACTGCTGGAAGATC
GAGATAAAAACGTCAGAGAAGCAGGCAAAGAGTTAATTATAGAAATGTAT
CGATGGATCGGTTCTACCGCGTTGAATCCGGTTTTGTCTCAAATAAAACC
CGTCCAAGTTACCGAACTTAACGCGGAATTCGAAAAATTACCGCAAGAGA
AACCGGTACCGAGCCGATATTTGAAGTCCCAGAAACCGAAAGAATCAGCT
CTAGTAAAACCAACAGGAGGTGGCGATGCAGTGCCACAACAAAGCGTTGG
GAAACACCCTCAGAACAATGTTGATATTGACCCGTATGATTTAGTAGACC
CAGTGGAAGTGATATCGAAAATCCCAGCCAATTATTACGATCAAATAGAA
GAAAAGAAATGGACCGATAGAAAGGATGCGTTGGAAATCATTGAAAAGCT
GACAAATAATCCAAAATTAGTCCCAGGAGAATACGGAGACCTGATGAAAT
CACTTCTGAAAGTGCTATCAAAGGATACAAATATTGTACTAGTGGCTCTT
TCAGCGAAAATAATTTACCAAATCGCCACCGGTCTACGTAAAAAGTTCTC
TCCATATGCAGTCAATACAATTCAAGCAACTCTAGAGAAATTCAAAGAGA
AAAAGACAAATGTAGTGAAGGCTTTACGTGATTGCATCGATTCTGCATTT
GTTACGACTTCTATCGACGCCTGCATGGAGGAGTTGTTAAATGCTTTGAA
TCACAAAACTCCAAGCGTTAAATCGGAAACTGCATTGTTCTTGAATCGAG
TATTTGAAAAAAGTTCAATGGAAATGTGGACGGGAAAGCTGTTAAAGCAG
ATTATTCCCGGCCTTACTAATCTATGCCTCGACAGTGTTCCGGAGGTGCG
AGATGCTGCTTTTCAAACTTTAGGAACAGCAATGAAAGTTGTAACTGAGA
AAAAATTGAAGCCTTATTTGGATAAAATGGATAATGTTAAATTGGCACGA
ATAAATGAATTTTATGAGAAAGCAAAGCAAGCATCTGAAGCAACAATAGT
TTTACCCGAAAAATCAGCTGTTGTTGTTGCCGAAAAACCGATTGAACCTC
CGAAAGCCGAGAAACACGCAGAAGCATCCAAAAAACCAGCTCAATCGAAA
CCTGCAGCAAAGAAACCGGTTGCAAAATCACAGAAACCAGGGGCTGCTTC
CAAGGTGCCAGAAATACCCACGGAATCCGTAATGAGTGAGGACGATGTTA
CAATGAAGGCTACAGATATATTCGGTGAAGCGTTTCTTGCACAAATCGTC
GATAAGAATTGGAAAGAACGTTCTGCTGCTTTCGAAACCTTGCAAACATA
TGTCAAAAATCAAGTTCCCTCGGATATACCATGTCAATTAATTATCAGAC
TGATTTTAATGAAGCCAGGACTCAAAGATAATAATAATCAGGTGCTTAAA
GCAAAAATCGAATTAATTAAAGACATTGTAACAAATGGAAGAATGACTTG
GACGACTGCTGAAATGTGTATCACAGATCTCACCGAGAAAATCGGTGATA
TTAAAAATGCGGACAATGTTAAAAGTACTCTCACAGAAATGAGTGATATT
ATCAATCTGCCATTGGTTGCTAGTCAGGTCATTAAAACAGCAACAGAAAA
TGTTAATATCAAAAATCTTGTTGAAGCTCTTAATTGGCTTAGTGATGCAA
TAAAGGATTTTGGATTCAAAATCCCAATCAATGATCTTGTACCATTTATT
CGATTGGCTGTCCAGCATACTAATCCTGCAGTTCGTCAATCTGGAATAAA
ACTAGCTGGGACTATTTCTCTTTATGTAAGAGAAGTAATATCTAGTCTTT
TAAAGGACGAAAAACCTTCTATTAAACAATTAATTGACAATGAAGTTGAA
TCTTTAAAATCAACTAATCCACCCGTGCCAACCCGAGGTCTTAAAAATGA
AACACCTGTTGTGGAAAACGCAACTGATTCTGAAGTTGTCGCTACTCATG
CTGTTCCCGAGTTGAATTTAGAAGACATGATTCCACGTGAGAACATAACT
CATAAAATTACTGACAATTTACTTGCTCAATTATCCGACAAAACAACAAA
AGTTAAAAAAGAATCACTCGGAGATGTAACGAAAATTATTAGTGCTTCTG
CTGGAATATCTGGAGATGGTTTACAAGGTCTCATAGTTGCCATAGTAAAA
AGTACAACAGATTCAAGTCTTGTGATTAGTAAAATGGCTATCAACCTATT
GGTTTCACTTTGTAACGCATTTACTAAAAAAGACGCAGAAAAATATATCA
AAATCGTAGTTCCTGCGTTATTGTCTAGTTTCAGTGATCCTAAACCAAAG
AACAGAGAAGATGCTGTAACCGCACTAAATGTATGGACAGAAAAGGTTGG
TTTTCCAAACGTGGTAGATGGTGGCACGGTTACGGAAGCATTAAAAGTTG
ACAATCCTTATCAGAAGTCAACAATATTTGCATGGATGTCACCACATTTA
ACAAAATTATCACAAAATAAGCTACCAAAAAAACTGCTCTATCCAGATTT
TCCTTCTGAAATACTTCCACATCTATTTTCAGCAATCGAAGAAAGGAGCC
CAGATGTCAGGAAATTTTCCCAGGAAGCTGTTCTGCCATTTATGCTAGTA
TTTGGATATGATCTTATGGTGAAAAATTTTAAAAGCAGCACCAAAACGAG
TCCTAAAAGCACAATTATGGGATTTTTGGACAAAGCAAAAGCAGAATTAC
CGGTCCCAGAACCGATTCCTAGCAAGCAACTTCCTAAAGCGGCATCTTCA
AACGGCAAACCACCCGCTTCTAAAGAAGCAGCAAATAAGAAAGCTTCGGA
CTCTGCAAAACCTAAAAAAGAAGATTCAAAAAAAAGTGGAAAAATGCCGA
ACAAGAGCAATGAGCAACTGGATAAGGATGCAGTAGTAATGGCATTACTG
GCAAAAAATAGTAACAAGAAGCAAAGAATACAGGAAGATAGAAAAAAGAA
GGTCACTAAATGGGAAACGAGTCTTGCAAGTTCTCAACAATTAAATAGTC
AATTTTCTGCCAGCTGTTCTCCAGAGTTATTTCAATTATTGTTTACCACT
GATATTAAAAAATCCATGAAAGCAATTGAACTGTTAAACAGCTTTTTATC
AGAAGATGATAAAGATTCAATTGAAGCAACTAAACAAAATCTGGATTTAA
TCCTCAAATGGATGGTTATCAGATTTAACGAAACAAATCCTTCCGTCTTA
ACTAAAGGACTGGATTATTTGTGCCGAGTGTTTACCATATTATGTTTGGA
CAGTTCGTTTCAATTATTGGAACATGAAGTCAACGGATTTATTCCGGAAT
TAATTGTTAAAATGGGTGATCCTAAAGACCAAGTTAGAGCACCTTCACAA
AAAATACTGAAATTAATATCTTGTTGTTATGACACTCTCAAAATTGTACA
ATTTTTGGAGGAAAATTTAGTCAATAAAACCGCACGAGTTCGACAAGAAT
GTGCTGATTTTCTAAAATATTTGATAGATGACAGAAAAATCGACGTAGGA
AATCAGAAAAACTTGTTAAAATCCGTGGCATTATTAATATCGGAAAGGGA
TAATAATGTCCGTACTGCAGCATTGAATTGTTTAGTTTCAGCACATAACT
TTATCGGCGAAGACTTGCTGAAAATTCTTGATTCACTCCATGATAAAGAT
CGTTCAATGTTATTGGAGCGAATAAAACGCTCAGGTAAACCTGTTTCATC
TGAAACCGAAAGTTCGATTCAATCATCAGCGTCAACAGAAAGAACTCAGA
AACCATCCAGACAAAGAGAAAACTCAGCTACAAGGGAGCAACCTAAACCT
CAAATTTCACAGCTACCTCCAAAGACAATCGACATCAATCCCTTGTTAAA
AGAGGAAATCGGATATAAATTAATAAATGTAGACAAAGAAGTTGAAGAAC
TTTTGCAGCCGTTAGAAAAAATCACACTTCGCTACCTCCCAATGGGACCT
TCTTTATTAGATAAATTGCGCAGTTATTCTGGCAAAGCCTCGCAATCAGT
GAATTCAAACGACGCTATCACATCGGTAATACATGCTATTAATTCCAATG
AAGTTCAAACTAGCATCCAAGCCATGGCACAAATCGATGAAGTCATCAGA
AATCAGGATGTCCGTACACAGTTGGTCAGTTATATGGATAACCTTGTGAT
GTCCATAACTATGCAACTAAAAGCCACCTTAGGTAGATTATCCGAAGAGA
AATTCAGTGAATCTGAAATCACAGATATGTTTAAAGGAATGTTAGCAACT
CTCGTTTCTATATTCAATGCTAAAGAACTGGCAGTTGAATTAAATCGTGA
TAGACTTATGAACTTGATGCAGTCAATTTTGCGAATAGTGATCAATGATC
AGCTGGTTTCTCTCTCTGAAGGTGGGACGATAATTCGCGGGATCAATATT
CTGAGCGTTCGCATCCTGGAATCATCAAATCAGACCCGCATGCTCAGTGC
TCTGCTCAGAATGATGAGTGATTGTTTGAAAAATGGTGACACCGGTAGCA
AGTATTTAAATCTCATATTCAAATGCATTTGGTCGATGACAAAGAATTTG
GTTAATACTGTGCATTCTATCGATCTGGTTGTTATTTTTAAAGACATACA
ATTATTTTATACGGATTTCCCTCCACATATATGGGAAGCTAGAGAAAGTG
GAAGAGATGTTCCATTAAGAACAGTGAAAACCCTTGTGTATTCCATCATT
AATAATAAAGGTGGAGGAGCCTTGGAAGCTTTGTATCAAATATCGGCTGG
GCCAAACAAAGATTTAGAAACATATATTCGAAAATCCTATTTAAAACTTA
ACGTTCCAATACCGACAGTGTTACCGAATCCCACAGACTCTTCTAACATT
CCAGAGATATCACCTACTGGCAACAAACCTAAATTTGTAGTTAAGTCGAA
TAATCGTCCATATCTTGAAGAACTGAAAGACATTTTTGGAAAAATCGGCA
TTCCTGAACAAAACAAACAAGGGCTAAACGATCTTTATGATTTCAAACTT
AAATATCCGTATGTCGATCTGTCGAGATATCTGTCGCAAACCACGCCGTA
TTTTCAGCGAACTATTGAAACTGGGTTGAAAAATATCGCCGAAGAACGGG
GTCAACCTCAAATATCCGTTTACGGATCCAACCAATTGAATAACAGTGGT
GCAGCGGCTTCTTTGGATAAGGATAACTTGGCGTATTGCAATATGGATCC
GGAATCTTTACTTCTACGTTTAAAGCAGTTGCGCAAAAATGCCGGTCTTG
ATAAGTCCAATTTCGACAAAACTGAAAAACAGAATCGCCTTTCATCTCCG
ACTAGAGATGAAATGGAATCCTCAGTCATATCGAAATTGGTTCCATCGGG
AGACGGGCCCGTTTCACCCCCAGCAGCAGTTGTTGCTGCTGCTAATCAGA
TGAATAACAAGCGGAAAATGTCCGCTCAAGATTTAGCAGCGATTAAGCAA
CGCTTTGAAGCACTGAAACGACCGAACTGAGAACTTTATGATGAATTATA
AATTCCCGAGTTTCCCTATTATAGATTGTTCCAGAAAATGGATTTATTAT
ACATTTTTGTTATTGTAAAGTTTTTCAGTTTATATAAATTTTGCATGTGC
ATTTTTGATTTGGGTTTTTTATTTTTATAATTTAAATGGATTTTTTTAAT
AAAAAA
back to top

protein sequence of SMED30004281-orf-1

>SMED30004281-orf-1 ID=SMED30004281-orf-1|Name=SMED30004281-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2002bp
MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYL
GLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNS
TRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKE
VLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTAL
NPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGG
DAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRK
DALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQI
ATGLRKKFSPYAVNTIQATLEKFKEKKTNVVKALRDCIDSAFVTTSIDAC
MEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNL
CLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKA
KQASEATIVLPEKSAVVVAEKPIEPPKAEKHAEASKKPAQSKPAAKKPVA
KSQKPGAASKVPEIPTESVMSEDDVTMKATDIFGEAFLAQIVDKNWKERS
AAFETLQTYVKNQVPSDIPCQLIIRLILMKPGLKDNNNQVLKAKIELIKD
IVTNGRMTWTTAEMCITDLTEKIGDIKNADNVKSTLTEMSDIINLPLVAS
QVIKTATENVNIKNLVEALNWLSDAIKDFGFKIPINDLVPFIRLAVQHTN
PAVRQSGIKLAGTISLYVREVISSLLKDEKPSIKQLIDNEVESLKSTNPP
VPTRGLKNETPVVENATDSEVVATHAVPELNLEDMIPRENITHKITDNLL
AQLSDKTTKVKKESLGDVTKIISASAGISGDGLQGLIVAIVKSTTDSSLV
ISKMAINLLVSLCNAFTKKDAEKYIKIVVPALLSSFSDPKPKNREDAVTA
LNVWTEKVGFPNVVDGGTVTEALKVDNPYQKSTIFAWMSPHLTKLSQNKL
PKKLLYPDFPSEILPHLFSAIEERSPDVRKFSQEAVLPFMLVFGYDLMVK
NFKSSTKTSPKSTIMGFLDKAKAELPVPEPIPSKQLPKAASSNGKPPASK
EAANKKASDSAKPKKEDSKKSGKMPNKSNEQLDKDAVVMALLAKNSNKKQ
RIQEDRKKKVTKWETSLASSQQLNSQFSASCSPELFQLLFTTDIKKSMKA
IELLNSFLSEDDKDSIEATKQNLDLILKWMVIRFNETNPSVLTKGLDYLC
RVFTILCLDSSFQLLEHEVNGFIPELIVKMGDPKDQVRAPSQKILKLISC
CYDTLKIVQFLEENLVNKTARVRQECADFLKYLIDDRKIDVGNQKNLLKS
VALLISERDNNVRTAALNCLVSAHNFIGEDLLKILDSLHDKDRSMLLERI
KRSGKPVSSETESSIQSSASTERTQKPSRQRENSATREQPKPQISQLPPK
TIDINPLLKEEIGYKLINVDKEVEELLQPLEKITLRYLPMGPSLLDKLRS
YSGKASQSVNSNDAITSVIHAINSNEVQTSIQAMAQIDEVIRNQDVRTQL
VSYMDNLVMSITMQLKATLGRLSEEKFSESEITDMFKGMLATLVSIFNAK
ELAVELNRDRLMNLMQSILRIVINDQLVSLSEGGTIIRGINILSVRILES
SNQTRMLSALLRMMSDCLKNGDTGSKYLNLIFKCIWSMTKNLVNTVHSID
LVVIFKDIQLFYTDFPPHIWEARESGRDVPLRTVKTLVYSIINNKGGGAL
EALYQISAGPNKDLETYIRKSYLKLNVPIPTVLPNPTDSSNIPEISPTGN
KPKFVVKSNNRPYLEELKDIFGKIGIPEQNKQGLNDLYDFKLKYPYVDLS
RYLSQTTPYFQRTIETGLKNIAEERGQPQISVYGSNQLNNSGAAASLDKD
NLAYCNMDPESLLLRLKQLRKNAGLDKSNFDKTEKQNRLSSPTRDEMESS
VISKLVPSGDGPVSPPAAVVAAANQMNNKRKMSAQDLAAIKQRFEALKRP
N*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR034085TOG
IPR024395CLASP_N_dom
IPR000357HEAT
IPR011989ARM-like
IPR021133HEAT_type_2
IPR016024ARM-type_fold
IPR003133T_Ag_DNA-bd
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO:0003688DNA replication origin binding
GO:0008017microtubule binding
GO:0043021ribonucleoprotein complex binding
GO:0051010microtubule plus-end binding
GO:0098641cadherin binding involved in cell-cell adhesion
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0007049cell cycle
GO:0007051spindle organization
GO:0007067mitotic nuclear division
GO:0030951establishment or maintenance of microtubule cytoskeleton polarity
GO:0046785microtubule polymerization
GO:0050658RNA transport
GO:0051297centrosome organization
GO:0051298centrosome duplication
GO:0051301cell division
GO:0098609cell-cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0000775chromosome, centromeric region
GO:0000776kinetochore
GO:0000777condensed chromosome kinetochore
GO:0000922spindle pole
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005856cytoskeleton
GO:0005913cell-cell adherens junction
GO:0016020membrane
GO:0043234protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR034085TOG domainSMARTSM01349TOG_3coord: 766..1009
e-value: 1.8E-36
score: 137.1
coord: 169..400
e-value: 3.5E-40
score: 149.5
coord: 434..677
e-value: 3.4E-29
score: 113.0
IPR000357HEAT repeatPFAMPF02985HEATcoord: 43..72
e-value: 0.001
score: 19.1
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 1..100
e-value: 2.6E-26
score: 94.6
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 169..411
e-value: 4.2E-49
score: 169.6
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 430..676
e-value: 4.2E-48
score: 166.1
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 739..1005
e-value: 4.5E-67
score: 228.4
IPR024395CLASP N-terminal domainPFAMPF12348CLASP_Ncoord: 838..993
e-value: 1.0E-6
score: 28.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1527..1542
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1527..1549
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 999..1050
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 705..730
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 677..732
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1007..1024
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 123..137
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 123..169
NoneNo IPR availablePANTHERPTHR12609MICROTUBULE ASSOCIATED PROTEIN XMAP215coord: 1..1502
IPR021133HEAT, type 2PROSITEPS50077HEAT_REPEATcoord: 43..81
score: 10.602
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 186..1003
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 3..85