Kinase

Overview
NameKinase
Smed IDSMED30004278
Length (bp)2160
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinase (SMED30004278) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinase (SMED30004278) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinase (SMED30004278) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinase (SMED30004278) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004278

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004278SMESG000019079.1 dd_Smed_v4_3687_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004278SMESG000019079.1 dd_Smed_v4_3687_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004278SMESG000019079.1 dd_Smed_v4_3687_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004278SMESG000019079.1 dd_Smed_v4_3687_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004278SMESG000019079.1 dd_Smed_v4_3687_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30004278SMESG000019079.1 dd_Smed_v4_3687_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30004278SMESG000019079.1 dd_Smed_v4_3687_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004278SMESG000019079.1 dd_Smed_v4_3687_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30004278SMESG000019079.1 SMED30004278smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinase vs. Ensembl Human
Match: ITPKB (inositol-trisphosphate 3-kinase B [Source:HGNC Symbol;Acc:HGNC:6179])

HSP 1 Score: 316.235 bits (809), Expect = 1.072e-94
Identity = 157/306 (51.31%), Postives = 198/306 (64.71%), Query Frame = 3
Query:  957 SSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSD 1874
            S SWRK+K    W+PF+    + +YPWIQ+AGH G+FK    G ILKK+   E  CL  +  DVL  FVP +  ++  +GERY  M DLLA F+ P ++D KMG RTYLEEEL KA+  P  R+DMY+KM+E+D   PTE E + +A+ KPRYMQWRET+SST TLGFRIEG+K    K D   GT +RD+K+TK RE+V +   +F     +IL  +  RL  ++  L  S FF  HE IGSSLLF+HDK   A  WMIDFGKT PLP    + H   W EGN EDGYL GL NL++I  E+  D
Sbjct:  645 SKSWRKIKNMVHWSPFVMSF-KKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIK----KED---GTVNRDFKKTKTREQVTEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQD 942          
BLAST of Kinase vs. Ensembl Human
Match: ITPKB (inositol-trisphosphate 3-kinase B [Source:HGNC Symbol;Acc:HGNC:6179])

HSP 1 Score: 316.235 bits (809), Expect = 1.072e-94
Identity = 157/306 (51.31%), Postives = 198/306 (64.71%), Query Frame = 3
Query:  957 SSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSD 1874
            S SWRK+K    W+PF+    + +YPWIQ+AGH G+FK    G ILKK+   E  CL  +  DVL  FVP +  ++  +GERY  M DLLA F+ P ++D KMG RTYLEEEL KA+  P  R+DMY+KM+E+D   PTE E + +A+ KPRYMQWRET+SST TLGFRIEG+K    K D   GT +RD+K+TK RE+V +   +F     +IL  +  RL  ++  L  S FF  HE IGSSLLF+HDK   A  WMIDFGKT PLP    + H   W EGN EDGYL GL NL++I  E+  D
Sbjct:  645 SKSWRKIKNMVHWSPFVMSF-KKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIK----KED---GTVNRDFKKTKTREQVTEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQD 942          
BLAST of Kinase vs. Ensembl Human
Match: ITPKC (inositol-trisphosphate 3-kinase C [Source:HGNC Symbol;Acc:HGNC:14897])

HSP 1 Score: 307.76 bits (787), Expect = 6.865e-94
Identity = 149/310 (48.06%), Postives = 206/310 (66.45%), Query Frame = 3
Query:  927 NAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
             A +   R+ S  W+KLK    ++PF+    +H YPW+Q++GH GNF+ GE G ILK++   E   L+ + +D L  FVP +   +  +G+ +  M+DLLA F  PS++D KMG+RTYLEEELVKA+  P+PR+DMYEKM+ +D   PT  EH+  A+ KPRYMQWRET+SST TLGFRIEG+K       K  GT + ++K+T+  E+V ++L DF+D    IL+ ++  L +L+ AL  S FF  HE +GSSLLFVHD  G A  WMIDFGKT+ LP +  + H   W EGN EDGYL+GL+N++ + 
Sbjct:  376 GASDPEDRSGSKPWKKLKTVLKYSPFVVSFRKH-YPWVQLSGHAGNFQAGEDGRILKRFCQCEQRSLEQLMKDPLRPFVPAYYGMVLQDGQTFNQMEDLLADFEGPSIMDCKMGSRTYLEEELVKARERPRPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQWRETMSSTSTLGFRIEGIK-------KADGTCNTNFKKTQALEQVTKVLEDFVDGDHVILQKYVACLEELREALEISPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQTLSHRLPWAEGNREDGYLWGLDNMICLL 677          
BLAST of Kinase vs. Ensembl Human
Match: ITPKA (inositol-trisphosphate 3-kinase A [Source:HGNC Symbol;Acc:HGNC:6178])

HSP 1 Score: 286.189 bits (731), Expect = 2.330e-88
Identity = 141/304 (46.38%), Postives = 191/304 (62.83%), Query Frame = 3
Query:  966 WRKLKAAF---IWTPFIQQCARHRYPWIQIAGHQGNFKP-GEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            W+K++      + +PF     + RY W+Q+AGH G+FK  G  G ILK+ +  E  CL  +  D L   VP F   ++ +GE Y+ +QDLL  F+ P ++D KMG RTYLEEEL KA+  PK R+DMY+KM+ +D   PTE EH+ +A+ KPRYMQWRE +SS+ TLGFRIEG+K       K  G+ S D+K T+ RE+V ++  +F+    ++L  ++ RL  ++  L  S FF  HE IGSSLLFVHD    A  W+IDFGKT PLP    +DH   W EGN EDGYL GL+NL+ I   +
Sbjct:  167 WQKIRTMVNLPVISPF-----KKRYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYCLARLMADALRGCVPAFHGVVERDGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIK-------KADGSCSTDFKTTRSREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKTTPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASL 458          
BLAST of Kinase vs. Ensembl Human
Match: ITPKA (inositol-trisphosphate 3-kinase A [Source:HGNC Symbol;Acc:HGNC:6178])

HSP 1 Score: 191.43 bits (485), Expect = 2.938e-55
Identity = 95/209 (45.45%), Postives = 134/209 (64.11%), Query Frame = 3
Query:  966 WRKLKAAF---IWTPFIQQCARHRYPWIQIAGHQGNFKP-GEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFI 1580
            W+K++      + +PF     + RY W+Q+AGH G+FK  G  G ILK+ +  E  CL  +  D L   VP F   ++ +GE Y+ +QDLL  F+ P ++D KMG RTYLEEEL KA+  PK R+DMY+KM+ +D   PTE EH+ +A+ KPRYMQWRE +SS+ TLGFRIEG+K       K  G+ S D+K T+ RE+V ++  +F+
Sbjct:   62 WQKIRTMVNLPVISPF-----KKRYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYCLARLMADALRGCVPAFHGVVERDGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIK-------KADGSCSTDFKTTRSREQVLRVFEEFV 258          
BLAST of Kinase vs. Ensembl Celegans
Match: lfe-2 (Inositol-trisphosphate 3-kinase homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95Q62])

HSP 1 Score: 201.445 bits (511), Expect = 1.006e-57
Identity = 111/284 (39.08%), Postives = 167/284 (58.80%), Query Frame = 3
Query: 1035 WIQIAGHQGNFKPGEQGTILKKYTGR--ESICLQMMNED-VLVEFVPQFKSEIDYEGERYICMQDLLAKFNQP---SLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRD-ILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            W+Q++GH+G+  P    T+ KK      E    + +++D  L  F P++  E++   E +I ++DLL +F+ P   +++DIK+GTRT+LE E+   K     R D+YEKM+ ID +EPTE E    AI K RYMQ+RE  SST  LGFRIE  K+         G   +++K+ +  E+V    +DF   +R  + +  I+RL  ++ A+  S FF  HE +GSS+L V D       WMIDF K+ P+P    ++H +TWI GN+EDGYL G++NL+ I  E+
Sbjct:   97 WVQLSGHEGSIVPATPHTLYKKQCANCGEGRAYKNISKDPALDGFTPKYYDELEKNEEHFIEIEDLLQQFHDPTKTAIMDIKIGTRTFLESEVSNTKK----RADLYEKMVAIDNDEPTEEERKCGAITKLRYMQFRERESSTAQLGFRIEAAKRLE-------GALEKNFKKVRTVEDVTTTFMDFFGTQRSRVRQQLIERLKSMRKAIEHSSFFNSHEVVGSSILIVFDTE-KVGCWMIDFAKSSPVPNGRTLNHRTTWIPGNNEDGYLIGIDNLVKILEEL 368          
BLAST of Kinase vs. Ensembl Celegans
Match: lfe-2 (Inositol-trisphosphate 3-kinase homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95Q62])

HSP 1 Score: 201.83 bits (512), Expect = 1.499e-57
Identity = 111/284 (39.08%), Postives = 167/284 (58.80%), Query Frame = 3
Query: 1035 WIQIAGHQGNFKPGEQGTILKKYTGR--ESICLQMMNED-VLVEFVPQFKSEIDYEGERYICMQDLLAKFNQP---SLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRD-ILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            W+Q++GH+G+  P    T+ KK      E    + +++D  L  F P++  E++   E +I ++DLL +F+ P   +++DIK+GTRT+LE E+   K     R D+YEKM+ ID +EPTE E    AI K RYMQ+RE  SST  LGFRIE  K+         G   +++K+ +  E+V    +DF   +R  + +  I+RL  ++ A+  S FF  HE +GSS+L V D       WMIDF K+ P+P    ++H +TWI GN+EDGYL G++NL+ I  E+
Sbjct:  128 WVQLSGHEGSIVPATPHTLYKKQCANCGEGRAYKNISKDPALDGFTPKYYDELEKNEEHFIEIEDLLQQFHDPTKTAIMDIKIGTRTFLESEVSNTKK----RADLYEKMVAIDNDEPTEEERKCGAITKLRYMQFRERESSTAQLGFRIEAAKRLE-------GALEKNFKKVRTVEDVTTTFMDFFGTQRSRVRQQLIERLKSMRKAIEHSSFFNSHEVVGSSILIVFDTE-KVGCWMIDFAKSSPVPNGRTLNHRTTWIPGNNEDGYLIGIDNLVKILEEL 399          
BLAST of Kinase vs. Ensembl Celegans
Match: lfe-2 (Inositol-trisphosphate 3-kinase homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95Q62])

HSP 1 Score: 202.601 bits (514), Expect = 1.705e-57
Identity = 111/284 (39.08%), Postives = 167/284 (58.80%), Query Frame = 3
Query: 1035 WIQIAGHQGNFKPGEQGTILKKYTGR--ESICLQMMNED-VLVEFVPQFKSEIDYEGERYICMQDLLAKFNQP---SLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRD-ILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            W+Q++GH+G+  P    T+ KK      E    + +++D  L  F P++  E++   E +I ++DLL +F+ P   +++DIK+GTRT+LE E+   K     R D+YEKM+ ID +EPTE E    AI K RYMQ+RE  SST  LGFRIE  K+         G   +++K+ +  E+V    +DF   +R  + +  I+RL  ++ A+  S FF  HE +GSS+L V D       WMIDF K+ P+P    ++H +TWI GN+EDGYL G++NL+ I  E+
Sbjct:  152 WVQLSGHEGSIVPATPHTLYKKQCANCGEGRAYKNISKDPALDGFTPKYYDELEKNEEHFIEIEDLLQQFHDPTKTAIMDIKIGTRTFLESEVSNTKK----RADLYEKMVAIDNDEPTEEERKCGAITKLRYMQFRERESSTAQLGFRIEAAKRLE-------GALEKNFKKVRTVEDVTTTFMDFFGTQRSRVRQQLIERLKSMRKAIEHSSFFNSHEVVGSSILIVFDTE-KVGCWMIDFAKSSPVPNGRTLNHRTTWIPGNNEDGYLIGIDNLVKILEEL 423          
BLAST of Kinase vs. Ensembl Celegans
Match: lfe-2 (Inositol-trisphosphate 3-kinase homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95Q62])

HSP 1 Score: 201.445 bits (511), Expect = 4.624e-57
Identity = 111/284 (39.08%), Postives = 168/284 (59.15%), Query Frame = 3
Query: 1035 WIQIAGHQGNFKPGEQGTILKKYTGR--ESICLQMMNED-VLVEFVPQFKSEIDYEGERYICMQDLLAKFNQP---SLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRD-ILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            W+Q++GH+G+  P    T+ KK      E    + +++D  L  F P++  E++   E +I ++DLL +F+ P   +++DIK+GTRT+LE E+   K     R D+YEKM+ ID +EPTE E    AI K RYMQ+RE  SST  LGFRIE  K       ++ G   +++K+ +  E+V    +DF   +R  + +  I+RL  ++ A+  S FF  HE +GSS+L V D       WMIDF K+ P+P    ++H +TWI GN+EDGYL G++NL+ I  E+
Sbjct:  164 WVQLSGHEGSIVPATPHTLYKKQCANCGEGRAYKNISKDPALDGFTPKYYDELEKNEEHFIEIEDLLQQFHDPTKTAIMDIKIGTRTFLESEVSNTKK----RADLYEKMVAIDNDEPTEEERKCGAITKLRYMQFRERESSTAQLGFRIEAAK-------RLEGALEKNFKKVRTVEDVTTTFMDFFGTQRSRVRQQLIERLKSMRKAIEHSSFFNSHEVVGSSILIVFDTE-KVGCWMIDFAKSSPVPNGRTLNHRTTWIPGNNEDGYLIGIDNLVKILEEL 435          
BLAST of Kinase vs. Ensembl Celegans
Match: lfe-2 (Inositol-trisphosphate 3-kinase homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95Q62])

HSP 1 Score: 201.445 bits (511), Expect = 6.212e-57
Identity = 111/284 (39.08%), Postives = 167/284 (58.80%), Query Frame = 3
Query: 1035 WIQIAGHQGNFKPGEQGTILKKYTGR--ESICLQMMNED-VLVEFVPQFKSEIDYEGERYICMQDLLAKFNQP---SLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRD-ILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            W+Q++GH+G+  P    T+ KK      E    + +++D  L  F P++  E++   E +I ++DLL +F+ P   +++DIK+GTRT+LE E+   K     R D+YEKM+ ID +EPTE E    AI K RYMQ+RE  SST  LGFRIE  K+         G   +++K+ +  E+V    +DF   +R  + +  I+RL  ++ A+  S FF  HE +GSS+L V D       WMIDF K+ P+P    ++H +TWI GN+EDGYL G++NL+ I  E+
Sbjct:  177 WVQLSGHEGSIVPATPHTLYKKQCANCGEGRAYKNISKDPALDGFTPKYYDELEKNEEHFIEIEDLLQQFHDPTKTAIMDIKIGTRTFLESEVSNTKK----RADLYEKMVAIDNDEPTEEERKCGAITKLRYMQFRERESSTAQLGFRIEAAKRLE-------GALEKNFKKVRTVEDVTTTFMDFFGTQRSRVRQQLIERLKSMRKAIEHSSFFNSHEVVGSSILIVFDTE-KVGCWMIDFAKSSPVPNGRTLNHRTTWIPGNNEDGYLIGIDNLVKILEEL 448          
BLAST of Kinase vs. Ensembl Fly
Match: IP3K2 (gene:FBgn0283680 transcript:FBtr0344168)

HSP 1 Score: 345.125 bits (884), Expect = 3.812e-111
Identity = 172/344 (50.00%), Postives = 235/344 (68.31%), Query Frame = 3
Query:  858 STLVQGDDVSLSNNKIPSI--LQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPG-EQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYE-GERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDI 1877
             +L  G+DV   ++ +  I  L V +A    K+ +SS WRK++    WTPF Q   + RYPW+Q+AGHQGNFK G E GT+LKK   +E  C Q++  D+L  +VP +K ++  E GE Y+ +QDLL+ + QP ++D K+G RTYLEEEL KAK  PK R+DMY+KM++ID + PT  EH+ KA+ KPRYM WRET+SST TLGFRIEG+K    K+D   GT S+D+K TK RE++K   ++F+     IL  +I+RL  ++  L  S FF  HE IGSSLLFVHD+  +A+ W+IDF KT+ LPP  +IDHYS W  GNHEDGYL G+ NL++IF+E+ + +
Sbjct:   99 GSLAFGEDVCRCDDCLLGIVDLYVISAAEAAKK-KSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDGELYLQLQDLLSDYVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIK----KSD---GTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHEVIGSSLLFVHDQT-HASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIFVELQASM 433          
BLAST of Kinase vs. Ensembl Fly
Match: IP3K2 (gene:FBgn0283680 transcript:FBtr0346134)

HSP 1 Score: 345.125 bits (884), Expect = 3.812e-111
Identity = 172/344 (50.00%), Postives = 235/344 (68.31%), Query Frame = 3
Query:  858 STLVQGDDVSLSNNKIPSI--LQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPG-EQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYE-GERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDI 1877
             +L  G+DV   ++ +  I  L V +A    K+ +SS WRK++    WTPF Q   + RYPW+Q+AGHQGNFK G E GT+LKK   +E  C Q++  D+L  +VP +K ++  E GE Y+ +QDLL+ + QP ++D K+G RTYLEEEL KAK  PK R+DMY+KM++ID + PT  EH+ KA+ KPRYM WRET+SST TLGFRIEG+K    K+D   GT S+D+K TK RE++K   ++F+     IL  +I+RL  ++  L  S FF  HE IGSSLLFVHD+  +A+ W+IDF KT+ LPP  +IDHYS W  GNHEDGYL G+ NL++IF+E+ + +
Sbjct:   99 GSLAFGEDVCRCDDCLLGIVDLYVISAAEAAKK-KSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDGELYLQLQDLLSDYVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIK----KSD---GTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHEVIGSSLLFVHDQT-HASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIFVELQASM 433          
BLAST of Kinase vs. Ensembl Fly
Match: IP3K2 (gene:FBgn0283680 transcript:FBtr0344169)

HSP 1 Score: 345.125 bits (884), Expect = 3.812e-111
Identity = 172/344 (50.00%), Postives = 235/344 (68.31%), Query Frame = 3
Query:  858 STLVQGDDVSLSNNKIPSI--LQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPG-EQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYE-GERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDI 1877
             +L  G+DV   ++ +  I  L V +A    K+ +SS WRK++    WTPF Q   + RYPW+Q+AGHQGNFK G E GT+LKK   +E  C Q++  D+L  +VP +K ++  E GE Y+ +QDLL+ + QP ++D K+G RTYLEEEL KAK  PK R+DMY+KM++ID + PT  EH+ KA+ KPRYM WRET+SST TLGFRIEG+K    K+D   GT S+D+K TK RE++K   ++F+     IL  +I+RL  ++  L  S FF  HE IGSSLLFVHD+  +A+ W+IDF KT+ LPP  +IDHYS W  GNHEDGYL G+ NL++IF+E+ + +
Sbjct:   99 GSLAFGEDVCRCDDCLLGIVDLYVISAAEAAKK-KSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDGELYLQLQDLLSDYVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIK----KSD---GTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHEVIGSSLLFVHDQT-HASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIFVELQASM 433          
BLAST of Kinase vs. Ensembl Fly
Match: IP3K2 (gene:FBgn0283680 transcript:FBtr0344171)

HSP 1 Score: 345.125 bits (884), Expect = 1.365e-108
Identity = 163/310 (52.58%), Postives = 219/310 (70.65%), Query Frame = 3
Query:  954 ESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPG-EQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYE-GERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDI 1877
            +SS WRK++    WTPF Q   + RYPW+Q+AGHQGNFK G E GT+LKK   +E  C Q++  D+L  +VP +K ++  E GE Y+ +QDLL+ + QP ++D K+G RTYLEEEL KAK  PK R+DMY+KM++ID + PT  EH+ KA+ KPRYM WRET+SST TLGFRIEG+K    K+D   GT S+D+K TK RE++K   ++F+     IL  +I+RL  ++  L  S FF  HE IGSSLLFVHD+  +A+ W+IDF KT+ LPP  +IDHYS W  GNHEDGYL G+ NL++IF+E+ + +
Sbjct:  334 KSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDGELYLQLQDLLSDYVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIK----KSD---GTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHEVIGSSLLFVHDQT-HASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIFVELQASM 635          
BLAST of Kinase vs. Ensembl Fly
Match: IP3K2 (gene:FBgn0283680 transcript:FBtr0344170)

HSP 1 Score: 345.125 bits (884), Expect = 1.365e-108
Identity = 163/310 (52.58%), Postives = 219/310 (70.65%), Query Frame = 3
Query:  954 ESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPG-EQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYE-GERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDI 1877
            +SS WRK++    WTPF Q   + RYPW+Q+AGHQGNFK G E GT+LKK   +E  C Q++  D+L  +VP +K ++  E GE Y+ +QDLL+ + QP ++D K+G RTYLEEEL KAK  PK R+DMY+KM++ID + PT  EH+ KA+ KPRYM WRET+SST TLGFRIEG+K    K+D   GT S+D+K TK RE++K   ++F+     IL  +I+RL  ++  L  S FF  HE IGSSLLFVHD+  +A+ W+IDF KT+ LPP  +IDHYS W  GNHEDGYL G+ NL++IF+E+ + +
Sbjct:  334 KSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDGELYLQLQDLLSDYVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIK----KSD---GTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHEVIGSSLLFVHDQT-HASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIFVELQASM 635          
BLAST of Kinase vs. Ensembl Zebrafish
Match: itpkb (inositol-trisphosphate 3-kinase B [Source:ZFIN;Acc:ZDB-GENE-041014-166])

HSP 1 Score: 336.265 bits (861), Expect = 2.830e-105
Identity = 162/327 (49.54%), Postives = 218/327 (66.67%), Query Frame = 3
Query:  876 DDVSLSNNKIPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
            DD+S    + P+ LQ     +K       SW+K+K    W+PF+    + +YPWIQ+AGH GNFK G  G ILKK+   E  CL  +  D+L  +VP +  +++ +GERY  M+DLLA F+ P ++D KMG RTYLEEEL KA+  P  R DMY+KM+E+D + PTE E+  KA+ KPRYMQWRET+SST TLGFRIEG+KK         GT +RD+K+TK RE+V +   DF+   ++IL +++ RL +++  L  S FF  HE IGSSLLFVHDK   A  WMIDFGKT PLP   ++ H +TW+EGN EDGYL+GL++L++I 
Sbjct:  337 DDISSDPERSPAFLQTQQKAHK-------SWKKIKNMVHWSPFVMSF-KKKYPWIQLAGHAGNFKAGANGRILKKHCECEQQCLDRLMRDILKPYVPAYHGDVEKDGERYNQMEDLLADFDLPCVMDCKMGIRTYLEEELTKARKKPSLRADMYQKMIEVDPDAPTEKENEQKAVTKPRYMQWRETISSTATLGFRIEGIKKED-------GTVNRDFKKTKTREQVTEAFQDFVKGNKNILHSYLNRLKEIRDTLEMSPFFKTHEVIGSSLLFVHDKRELAKVWMIDFGKTTPLPEGQELSHRATWMEGNREDGYLYGLDHLIDII 648          
BLAST of Kinase vs. Ensembl Zebrafish
Match: itpkb (inositol-trisphosphate 3-kinase B [Source:ZFIN;Acc:ZDB-GENE-041014-166])

HSP 1 Score: 336.265 bits (861), Expect = 2.830e-105
Identity = 162/327 (49.54%), Postives = 218/327 (66.67%), Query Frame = 3
Query:  876 DDVSLSNNKIPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
            DD+S    + P+ LQ     +K       SW+K+K    W+PF+    + +YPWIQ+AGH GNFK G  G ILKK+   E  CL  +  D+L  +VP +  +++ +GERY  M+DLLA F+ P ++D KMG RTYLEEEL KA+  P  R DMY+KM+E+D + PTE E+  KA+ KPRYMQWRET+SST TLGFRIEG+KK         GT +RD+K+TK RE+V +   DF+   ++IL +++ RL +++  L  S FF  HE IGSSLLFVHDK   A  WMIDFGKT PLP   ++ H +TW+EGN EDGYL+GL++L++I 
Sbjct:  337 DDISSDPERSPAFLQTQQKAHK-------SWKKIKNMVHWSPFVMSF-KKKYPWIQLAGHAGNFKAGANGRILKKHCECEQQCLDRLMRDILKPYVPAYHGDVEKDGERYNQMEDLLADFDLPCVMDCKMGIRTYLEEELTKARKKPSLRADMYQKMIEVDPDAPTEKENEQKAVTKPRYMQWRETISSTATLGFRIEGIKKED-------GTVNRDFKKTKTREQVTEAFQDFVKGNKNILHSYLNRLKEIRDTLEMSPFFKTHEVIGSSLLFVHDKRELAKVWMIDFGKTTPLPEGQELSHRATWMEGNREDGYLYGLDHLIDII 648          
BLAST of Kinase vs. Ensembl Zebrafish
Match: itpkcb (inositol-trisphosphate 3-kinase Cb [Source:ZFIN;Acc:ZDB-GENE-080225-27])

HSP 1 Score: 312.383 bits (799), Expect = 2.382e-98
Identity = 160/323 (49.54%), Postives = 213/323 (65.94%), Query Frame = 3
Query:  906 PSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSD 1874
            PS+   P+ +     T + SWRKLK+    +PF+    + RYPW+Q+AGH G+F+ GE G +LKKY   E  CL+ +  D L  FVP +   +    + Y  M DLL  F+ PS++D KMG+RTYLEEELVKA+  P+ R+DMYEKM+ +D   P+  E S +A+LKPRYMQWRETLSST TLGFRIEG+K       K  GT +  +K+TK  E+V +   DF+D   ++L  ++ RL +L+ AL  S FF  HE +GSSLLFVHD +G A  WMIDFGKT+PLPP   +DH + W EGN EDGYL+GL+NL++IF  +  D
Sbjct:  140 PSMFASPDEL-----TGAKSWRKLKSMVHCSPFVVS-FKKRYPWVQLAGHAGSFQAGENGKLLKKYCECEQQCLEKLMNDDLRPFVPGYYGVVQQNEQDYNIMDDLLKDFDSPSIMDCKMGSRTYLEEELVKARERPRLRKDMYEKMVAVDPTAPSPEERSQQAVLKPRYMQWRETLSSTATLGFRIEGIK-------KADGTCNTSFKKTKHEEQVMKAFGDFVDGNTNLLRNYLLRLEELRCALENSHFFRTHEVVGSSLLFVHDASGLARVWMIDFGKTVPLPPPQILDHRTPWAEGNREDGYLWGLDNLIHIFTNMLKD 449          
BLAST of Kinase vs. Ensembl Zebrafish
Match: itpkca (inositol-trisphosphate 3-kinase Ca [Source:ZFIN;Acc:ZDB-GENE-030131-6009])

HSP 1 Score: 305.449 bits (781), Expect = 2.179e-96
Identity = 149/297 (50.17%), Postives = 195/297 (65.66%), Query Frame = 3
Query:  966 WRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
            W+K K    W+P   +  + R PW+Q+ GH GNF+    G +LKKY   E  C   +  D L  FVP +      + + Y  M DLLA F+ P ++D KMG+RTYLEEEL KA+ CP+PR+DMYEKM+ +D   PTE E   +A+LK RYMQWRETLSST TLGFRIEG+KK         GT + ++KRTK ++EV Q L DF+D+   IL ++ +RL +L+  L +S FF  HE +GSSLLFVHD  G A  WMIDFGKT+P+ P   +DH S W+EGN EDGYL+GL+N ++I 
Sbjct:  122 WKKSKNMVNWSP-PPETVKKRSPWVQVVGHAGNFQTDSDGRLLKKYCESEQQCFLQLMSDSLRPFVPGYYGVTQRDEQDYNLMDDLLADFDSPCIMDCKMGSRTYLEEELKKARECPQPRKDMYEKMIAVDPEAPTEEERLQQAVLKTRYMQWRETLSSTATLGFRIEGIKKSD-------GTCNTNFKRTKCKDEVVQALEDFVDNNMLILRSYQQRLKELRDILEKSDFFKAHEVVGSSLLFVHDVTGKAGIWMIDFGKTVPMTPPLTLDHRSPWLEGNREDGYLWGLDNFIDIL 410          
BLAST of Kinase vs. Ensembl Zebrafish
Match: itpka (inositol-trisphosphate 3-kinase A [Source:ZFIN;Acc:ZDB-GENE-030616-116])

HSP 1 Score: 305.064 bits (780), Expect = 7.038e-96
Identity = 152/332 (45.78%), Postives = 217/332 (65.36%), Query Frame = 3
Query:  870 QGDDVSLSNNKIPS--ILQVPNAVNKIKRTE-SSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
            + +D  LS+N+  S  I+ + +  + +   E +++W KLK   +  P +    R R  W+Q+AGH+G+FK G++G+ILKK++  E+ C + + ED L  FVP +   +  +GE ++ M DLLA F+ P+++D KMG RTYLE+ELV+A+  PK R+D+Y KM+E+D   PT  E   KA+ KPRYMQWRE+LSST TLGFRIEG+K+    N         D+K+T+ +E+V Q+  DFI+  ++I+ ++I RL ++K AL  S FF  HE IGSSLLF+HD    A  W+IDFGKT  LP    +DHY  W EGN EDGYL+GL+NLL   
Sbjct:  120 ESEDDLLSDNETKSKGIVTLEHLGDSVDSAEQTNAWWKLKT-IVKCPLVAS-QRRRLSWVQLAGHKGSFKAGDEGSILKKFSENENRCFERLKEDALHGFVPGYYGLVKRDGELFLKMTDLLASFDTPNVMDCKMGVRTYLEDELVRARVKPKLREDLYNKMLEVDSGAPTAEERQQKAVTKPRYMQWRESLSSTHTLGFRIEGIKRGETCNT--------DFKKTRSKEDVTQVFKDFIEGNKNIINSYITRLEEIKRALKASEFFKKHEVIGSSLLFIHDHTERAEVWLIDFGKTTALPDGQYLDHYRPWEEGNREDGYLWGLDNLLQTL 441          
BLAST of Kinase vs. Ensembl Xenopus
Match: itpkc (inositol-trisphosphate 3-kinase C [Source:NCBI gene;Acc:779709])

HSP 1 Score: 344.354 bits (882), Expect = 8.230e-110
Identity = 165/303 (54.46%), Postives = 215/303 (70.96%), Query Frame = 3
Query:  957 SSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            S SW+KLK    W+PF+    + +YPWIQ+AGH GNFK GE G ILKK+   E  CL  +N D+L  FVP +   ++ EGE Y  M+DLL++F+ PS++D KMG RTYLEEELVKA+  PK R+DMYEKM+ +D N PTE EH  KAILKPRYMQWRETLSST T+GFRIEG+K       +  G+   ++K+T+ +E+V   L DF+D  ++IL  ++ RL +L+ AL +S FF  HE +GSSLLFVHD +  A  WMIDFGKT+ LP    ++H S W+EGN EDGYL+GL+NL+NIF E+
Sbjct:  221 SKSWKKLKNMVHWSPFVVS-FKKQYPWIQLAGHAGNFKAGEYGKILKKFCESEQQCLVGLNRDILRPFVPGYYGVVEKEGENYNQMEDLLSEFDSPSIMDCKMGVRTYLEEELVKAREKPKLRKDMYEKMIAVDPNAPTEEEHRQKAILKPRYMQWRETLSSTATMGFRIEGIK-------RADGSCDTNFKKTRHKEQVINALRDFVDGNKNILRKYLVRLKELRTALEKSEFFKSHEVVGSSLLFVHDSSEQAKVWMIDFGKTVRLPCTQMLNHRSPWVEGNREDGYLWGLDNLINIFTEM 515          
BLAST of Kinase vs. Ensembl Xenopus
Match: ITPKB (inositol-trisphosphate 3-kinase B [Source:NCBI gene;Acc:100497340])

HSP 1 Score: 315.849 bits (808), Expect = 8.938e-98
Identity = 158/333 (47.45%), Postives = 213/333 (63.96%), Query Frame = 3
Query:  876 DDVSLSNNKIPS----ILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLE 1862
            DD+S    K P      LQ    + + K   S SWRK+K    W+P +    + +YPWIQ+AGH G+FK    G ILKK+   E  CL  +  DVL  +VP +  ++  +GERY  M DLL++F+ P ++D KMG RTYLEEEL+KA+  P  R+DMY KM+E+D   PTE E   +A+ KPRYM WRET+SST TLGFRIEG+K          GT +RD+K+TK RE+V +    F    + IL+ +++RL D+++ L +S FF  HE IGSSLLF+HD+   A  WMIDFGKT PLP    + H ++W+EGN EDGYL+GL+NL++I  E
Sbjct:  280 DDISSDPEKSPEKSTPFLQT---IEQPKPRVSKSWRKIKNMVHWSPIVMS-FKKKYPWIQLAGHAGSFKAAANGKILKKHCDCEQRCLSQLMNDVLKPYVPAYHGDVLKDGERYNQMDDLLSEFDGPCVMDCKMGVRTYLEEELMKARKKPSLRKDMYLKMVEVDPEAPTEEERQQRAVTKPRYMTWRETISSTSTLGFRIEGIKDGD-------GTVNRDFKKTKTREQVMEAFRGFTKGNQKILKLYLERLEDMRVTLEKSPFFETHEVIGSSLLFIHDRKEKAKVWMIDFGKTTPLPEGDVLTHRNSWLEGNREDGYLWGLDNLIDILTE 601          
BLAST of Kinase vs. Ensembl Xenopus
Match: ITPKB (inositol-trisphosphate 3-kinase B [Source:NCBI gene;Acc:100497340])

HSP 1 Score: 316.235 bits (809), Expect = 1.480e-97
Identity = 158/335 (47.16%), Postives = 214/335 (63.88%), Query Frame = 3
Query:  876 DDVSLSNNKIPS----ILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIH 1868
            DD+S    K P      LQ    + + K   S SWRK+K    W+P +    + +YPWIQ+AGH G+FK    G ILKK+   E  CL  +  DVL  +VP +  ++  +GERY  M DLL++F+ P ++D KMG RTYLEEEL+KA+  P  R+DMY KM+E+D   PTE E   +A+ KPRYM WRET+SST TLGFRIEG+K          GT +RD+K+TK RE+V +    F    + IL+ +++RL D+++ L +S FF  HE IGSSLLF+HD+   A  WMIDFGKT PLP    + H ++W+EGN EDGYL+GL+NL++I  E +
Sbjct:  325 DDISSDPEKSPEKSTPFLQT---IEQPKPRVSKSWRKIKNMVHWSPIVMS-FKKKYPWIQLAGHAGSFKAAANGKILKKHCDCEQRCLSQLMNDVLKPYVPAYHGDVLKDGERYNQMDDLLSEFDGPCVMDCKMGVRTYLEEELMKARKKPSLRKDMYLKMVEVDPEAPTEEERQQRAVTKPRYMTWRETISSTSTLGFRIEGIKDGD-------GTVNRDFKKTKTREQVMEAFRGFTKGNQKILKLYLERLEDMRVTLEKSPFFETHEVIGSSLLFIHDRKEKAKVWMIDFGKTTPLPEGDVLTHRNSWLEGNREDGYLWGLDNLIDILTETN 648          
BLAST of Kinase vs. Ensembl Xenopus
Match: ITPKB (inositol-trisphosphate 3-kinase B [Source:NCBI gene;Acc:100497340])

HSP 1 Score: 315.079 bits (806), Expect = 3.971e-97
Identity = 158/338 (46.75%), Postives = 215/338 (63.61%), Query Frame = 3
Query:  876 DDVSLSNNKIPS----ILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDI 1877
            DD+S    K P      LQ    + + K   S SWRK+K    W+P +    + +YPWIQ+AGH G+FK    G ILKK+   E  CL  +  DVL  +VP +  ++  +GERY  M DLL++F+ P ++D KMG RTYLEEEL+KA+  P  R+DMY KM+E+D   PTE E   +A+ KPRYM WRET+SST TLGFRIEG+K          GT +RD+K+TK RE+V +    F    + IL+ +++RL D+++ L +S FF  HE IGSSLLF+HD+   A  WMIDFGKT PLP    + H ++W+EGN EDGYL+GL+NL++I  E  + +
Sbjct:  298 DDISSDPEKSPEKSTPFLQT---IEQPKPRVSKSWRKIKNMVHWSPIVMSF-KKKYPWIQLAGHAGSFKAAANGKILKKHCDCEQRCLSQLMNDVLKPYVPAYHGDVLKDGERYNQMDDLLSEFDGPCVMDCKMGVRTYLEEELMKARKKPSLRKDMYLKMVEVDPEAPTEEERQQRAVTKPRYMTWRETISSTSTLGFRIEGIKDGD-------GTVNRDFKKTKTREQVMEAFRGFTKGNQKILKLYLERLEDMRVTLEKSPFFETHEVIGSSLLFIHDRKEKAKVWMIDFGKTTPLPEGDVLTHRNSWLEGNREDGYLWGLDNLIDILTETWAPL 624          
BLAST of Kinase vs. Ensembl Xenopus
Match: ENSXETT00000050857.1 (inositol-trisphosphate 3-kinase A [Source:NCBI gene;Acc:100486229])

HSP 1 Score: 292.738 bits (748), Expect = 1.192e-90
Identity = 144/303 (47.52%), Postives = 201/303 (66.34%), Query Frame = 3
Query:  966 WRKLKAAF---IWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            W+K++      +++PF ++       W+Q+AGH G+FK    GTILK+Y+  E    +++ +D LV  VP +   ++ +GE YI + DLL  F++P ++D KMG RTYLEEEL KA+  PK R+DMY+KM+E++   PTE E++ +A+ KPRYMQWRET+SST TLGFRIEG+KK         GT + ++K TK R+++ Q  + FID  +DIL  +I RL +++  +  S FF  HE IGSSLLFVHDK G AN W+IDFGKT  LP    +DH   W EGN EDGYL+G +NL++I   I
Sbjct:  180 WQKIRTMVNIPVFSPFKRR-------WVQLAGHTGSFKAAANGTILKRYSENEKNAFELVMKDSLVHCVPAYHGVVERDGESYIQLDDLLNSFDEPCVMDCKMGIRTYLEEELTKARGKPKLRKDMYKKMIEVNPLAPTEEENAQQAVTKPRYMQWRETISSTSTLGFRIEGIKKGD-------GTCNTNFKTTKTRDQIDQAFLQFIDGDKDILNKYICRLQEIRTIVESSEFFKKHEVIGSSLLFVHDKKGKANVWLIDFGKTTQLPEGQVLDHRIPWQEGNREDGYLYGFDNLIDILSSI 468          
BLAST of Kinase vs. Ensembl Mouse
Match: Itpkc (inositol 1,4,5-trisphosphate 3-kinase C [Source:MGI Symbol;Acc:MGI:2442554])

HSP 1 Score: 319.701 bits (818), Expect = 1.200e-98
Identity = 152/303 (50.17%), Postives = 202/303 (66.67%), Query Frame = 3
Query:  948 RTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
            R  S  W+KLK    ++PF+    +H YPW+Q++GH GNF+ GE G ILK++   E   L+++  D L  FVP +   +  +G+ +  M+DLLA F  PS++D KMG+RTYLEEELVKA+  PKPR+DMYEKM+ +D   PT  EH+  AI KPRYMQWRETLSST TLGFRIEG+K       K  GT + ++K+T+  E+V ++L DF++    IL  ++ RL DL+  L  S FF  HE +GSSLLFVHD  G A  WMIDFGKT+ LP +  + H   W EGN EDGYL+GL+NL+ + 
Sbjct:  377 RAGSKPWKKLKTVLKYSPFVVSFHKHYYPWVQLSGHAGNFQAGEDGRILKRFCQCEQRSLELLMGDPLRPFVPAYYGMVQRDGQAFNQMEDLLADFEGPSIMDCKMGSRTYLEEELVKARERPKPRKDMYEKMVAVDPGAPTPEEHAQGAITKPRYMQWRETLSSTSTLGFRIEGIK-------KADGTCNTNFKKTQALEQVTKVLEDFVNGDLGILRKYVARLEDLRETLENSPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQMLSHRLPWTEGNREDGYLWGLDNLICLL 672          
BLAST of Kinase vs. Ensembl Mouse
Match: Itpkb (inositol 1,4,5-trisphosphate 3-kinase B [Source:MGI Symbol;Acc:MGI:109235])

HSP 1 Score: 315.849 bits (808), Expect = 8.259e-95
Identity = 155/303 (51.16%), Postives = 199/303 (65.68%), Query Frame = 3
Query:  957 SSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            S SWRK+K    W+PF+    + +YPWIQ+AGH G+FK    G ILKK+   E  CL  +  DVL  FVP +  ++  +GERY  M DLLA F+ P ++D KMG RTYLEEEL KA+  P  R+DMY+KM+E+D   PTE E + +A+ KPRYMQWRET+SST TLGFRIEG+K    K D   G+ +RD+K+TK RE+V +   +F    ++IL  +  RL  ++  L  S FF  HE IGSSLLF+HDK   A  WMIDFGKT PLP    + H   W EGN EDGYL GL+NL++I  E+
Sbjct:  641 SKSWRKIKNMVQWSPFVMSF-KKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGVRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIK----KED---GSVNRDFKKTKTREQVTEAFREFTKGNQNILIAYRDRLKAIRATLEISPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLDNLIDILTEM 935          
BLAST of Kinase vs. Ensembl Mouse
Match: Itpka (inositol 1,4,5-trisphosphate 3-kinase A [Source:MGI Symbol;Acc:MGI:1333822])

HSP 1 Score: 288.886 bits (738), Expect = 1.949e-89
Identity = 144/308 (46.75%), Postives = 194/308 (62.99%), Query Frame = 3
Query:  954 ESSSWRKLKAAF---IWTPFIQQCARHRYPWIQIAGHQGNFKP-GEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            + S W+K++      + +PF     R RY W+Q+AGH G+FK  G  G ILK+ +  E  CL  +  DVL   VP F   ++ +GE Y+ +QDLL  F+ P ++D KMG RTYLEEEL KA+  PK R+DMY+KM+ +D   PTE EH+ +A+ KPRYMQWRE +SS+ TLGFRIEG+K       K  G+ S D+K T+ RE+V ++  +F+    ++L  ++ RL  ++  L  S FF  HE IGSSLLFVHD    A  W+IDFGKT PLP    +DH   W EGN EDGYL GL+NL+ I   +
Sbjct:  161 QKSHWQKIRTMVNLPVMSPF-----RKRYSWVQLAGHTGSFKAAGTSGLILKRSSEPEHYCLVRLMADVLRGCVPAFHGIVERDGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIK-------KADGSCSTDFKTTRSREQVTRVFEEFMQGDAEVLRRYLNRLQQIRDTLEISDFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKTTPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASL 456          
BLAST of Kinase vs. UniProt/SwissProt
Match: sp|Q7TS72|IP3KC_MOUSE (Inositol-trisphosphate 3-kinase C OS=Mus musculus OX=10090 GN=Itpkc PE=1 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 8.394e-98
Identity = 152/303 (50.17%), Postives = 202/303 (66.67%), Query Frame = 3
Query:  948 RTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
            R  S  W+KLK    ++PF+    +H YPW+Q++GH GNF+ GE G ILK++   E   L+++  D L  FVP +   +  +G+ +  M+DLLA F  PS++D KMG+RTYLEEELVKA+  PKPR+DMYEKM+ +D   PT  EH+  AI KPRYMQWRETLSST TLGFRIEG+K       K  GT + ++K+T+  E+V ++L DF++    IL  ++ RL DL+  L  S FF  HE +GSSLLFVHD  G A  WMIDFGKT+ LP +  + H   W EGN EDGYL+GL+NL+ + 
Sbjct:  377 RAGSKPWKKLKTVLKYSPFVVSFHKHYYPWVQLSGHAGNFQAGEDGRILKRFCQCEQRSLELLMGDPLRPFVPAYYGMVQRDGQAFNQMEDLLADFEGPSIMDCKMGSRTYLEEELVKARERPKPRKDMYEKMVAVDPGAPTPEEHAQGAITKPRYMQWRETLSSTSTLGFRIEGIK-------KADGTCNTNFKKTQALEQVTKVLEDFVNGDLGILRKYVARLEDLRETLENSPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQMLSHRLPWTEGNREDGYLWGLDNLICLL 672          
BLAST of Kinase vs. UniProt/SwissProt
Match: sp|Q80ZG2|IP3KC_RAT (Inositol-trisphosphate 3-kinase C OS=Rattus norvegicus OX=10116 GN=Itpkc PE=1 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 4.059e-97
Identity = 151/303 (49.83%), Postives = 203/303 (67.00%), Query Frame = 3
Query:  948 RTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
            R+ S  W+KLK    ++PF+    +H YPW+Q++GH GNF+ GE G ILK++   E   L+++  D L  FVP +   +  +G+ +  M+DLLA F  PS++D KMG+RTYLEEELVKA+  PKPR+DMYEKM+ +D   PT  EH+  A+ KPRYMQWRETLSST TLGFRIEG+K       K  GT + ++K+T+  E+V ++L DF++    IL  ++ RL DL+  L  S FF  HE +GSSLLFVHD  G A  WMIDFGKT+ LP +  + H   W EGN EDGYL+GL+NL+ + 
Sbjct:  377 RSGSKPWKKLKTVLKYSPFVVSFHKHYYPWVQLSGHAGNFQAGEDGRILKRFCQCEQRSLELLMGDPLRPFVPTYYGMVQRDGQAFNQMEDLLADFEGPSIMDCKMGSRTYLEEELVKARERPKPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQWRETLSSTSTLGFRIEGIK-------KADGTCNTNFKKTQALEQVTKVLEDFVNGDVGILRKYVARLEDLRDTLENSPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQMLSHRLPWAEGNREDGYLWGLDNLICLL 672          
BLAST of Kinase vs. UniProt/SwissProt
Match: sp|P27987|IP3KB_HUMAN (Inositol-trisphosphate 3-kinase B OS=Homo sapiens OX=9606 GN=ITPKB PE=1 SV=5)

HSP 1 Score: 316.235 bits (809), Expect = 5.148e-94
Identity = 157/306 (51.31%), Postives = 198/306 (64.71%), Query Frame = 3
Query:  957 SSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSD 1874
            S SWRK+K    W+PF+    + +YPWIQ+AGH G+FK    G ILKK+   E  CL  +  DVL  FVP +  ++  +GERY  M DLLA F+ P ++D KMG RTYLEEEL KA+  P  R+DMY+KM+E+D   PTE E + +A+ KPRYMQWRET+SST TLGFRIEG+K    K D   GT +RD+K+TK RE+V +   +F     +IL  +  RL  ++  L  S FF  HE IGSSLLF+HDK   A  WMIDFGKT PLP    + H   W EGN EDGYL GL NL++I  E+  D
Sbjct:  645 SKSWRKIKNMVHWSPFVMSF-KKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIK----KED---GTVNRDFKKTKTREQVTEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQD 942          
BLAST of Kinase vs. UniProt/SwissProt
Match: sp|P42335|IP3KB_RAT (Inositol-trisphosphate 3-kinase B OS=Rattus norvegicus OX=10116 GN=Itpkb PE=1 SV=3)

HSP 1 Score: 313.923 bits (803), Expect = 2.655e-93
Identity = 155/303 (51.16%), Postives = 198/303 (65.35%), Query Frame = 3
Query:  957 SSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            S SWRK+K    W+PF+    + +YPWIQ+AGH G+FK    G ILKK+   E  CL  +  DVL  FVP +  ++  +GERY  M DLLA F+ P ++D KMG RTYLEEEL KA+  P  R+DMY+KM+E+D   PTE E + +A+ KPRYMQWRET+SST TLGFRIEG+K    K D   G+ +RD+K+TK RE+V +   +F    ++IL  +  RL  ++  L  S FF  HE IGSSLLF+HDK   A  WMIDFGKT PLP    + H   W EGN EDGYL GL NL++I  E+
Sbjct:  633 SKSWRKIKNMVQWSPFVMSF-KKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIK----KED---GSVNRDFKKTKTREQVTEAFREFTKGNQNILIAYRDRLKAIRETLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLIDILTEM 927          
BLAST of Kinase vs. UniProt/SwissProt
Match: sp|Q96DU7|IP3KC_HUMAN (Inositol-trisphosphate 3-kinase C OS=Homo sapiens OX=9606 GN=ITPKC PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 3.297e-93
Identity = 149/310 (48.06%), Postives = 206/310 (66.45%), Query Frame = 3
Query:  927 NAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
             A +   R+ S  W+KLK    ++PF+    +H YPW+Q++GH GNF+ GE G ILK++   E   L+ + +D L  FVP +   +  +G+ +  M+DLLA F  PS++D KMG+RTYLEEELVKA+  P+PR+DMYEKM+ +D   PT  EH+  A+ KPRYMQWRET+SST TLGFRIEG+K       K  GT + ++K+T+  E+V ++L DF+D    IL+ ++  L +L+ AL  S FF  HE +GSSLLFVHD  G A  WMIDFGKT+ LP +  + H   W EGN EDGYL+GL+N++ + 
Sbjct:  376 GASDPEDRSGSKPWKKLKTVLKYSPFVVSFRKH-YPWVQLSGHAGNFQAGEDGRILKRFCQCEQRSLEQLMKDPLRPFVPAYYGMVLQDGQTFNQMEDLLADFEGPSIMDCKMGSRTYLEEELVKARERPRPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQWRETMSSTSTLGFRIEGIK-------KADGTCNTNFKKTQALEQVTKVLEDFVDGDHVILQKYVACLEELREALEISPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQTLSHRLPWAEGNREDGYLWGLDNMICLL 677          
BLAST of Kinase vs. TrEMBL
Match: V4BAA2 (Kinase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_212354 PE=3 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 1.164e-114
Identity = 163/308 (52.92%), Postives = 224/308 (72.73%), Query Frame = 3
Query:  954 ESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDI 1877
            + SSW+K+++   W+PF+Q   ++RYPWIQ+AGHQGNF+ G+ G++LKK   RE  C + + ED+L  +VP+++ ++++ GE Y+ +QDLL +FN P ++DIKMG RTYLEEEL KA+  P  R+DMY+KM+E+D N PTE EH  KA+ KPRYMQWR+ +SS++ L FRIEGVKK         G  S+D+K+TK R +VK  L+ FI D  D+L  +I+RL  ++I    S FF  HE IGSSLLFVHD++GNA+ W+IDFGKT  +P N  IDH S WIEGNHEDGYL GL+NL++I  EI +++
Sbjct:    7 QQSSWKKIRSIIRWSPFVQVFKKNRYPWIQLAGHQGNFQAGDAGSVLKKLDKREQNCFKKVMEDILRPYVPEYRGDVEHMGEMYLQLQDLLCEFNSPCVMDIKMGVRTYLEEELSKARKNPSLRKDMYQKMIEVDPNAPTEEEHQQKAVTKPRYMQWRDEMSSSVNLAFRIEGVKKSD-------GASSKDFKKTKTRNKVKDTLISFIGDNTDMLTKYIQRLRAIRITQESSEFFKRHEVIGSSLLFVHDESGNASVWVIDFGKTESIPSNITIDHRSEWIEGNHEDGYLTGLDNLVSILEEIENEL 307          
BLAST of Kinase vs. TrEMBL
Match: A0A1S3JIA2 (Kinase OS=Lingula unguis OX=7574 GN=LOC106173514 PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 2.397e-111
Identity = 162/315 (51.43%), Postives = 227/315 (72.06%), Query Frame = 3
Query:  939 KIKRTES-SSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDIT 1880
            ++KR  + SSWRK++    W+PF+QQ  +HRYPWIQ+AGHQGNFK G+QGTILKK   +E  CLQ + +D++  +VP++K E++ +G +YI MQDLL +F+  SL+D K+G RTYLEEEL KA+  PK R+DMY+KM+E+D NEPTE EH+ +AI KPRYM WRET+SST   GFRIEG+K       K  G+ SRD+K T+ RE++    + + D+ ++I+  +++RL  ++  L  S FF  HE IGSSLLFVHD    A  WMIDFGK+ P+P +  I H + W+EGN EDGYL G++N+++IF E++++ T
Sbjct:  108 QMKRIRTMSSWRKIRNMVHWSPFVQQFKKHRYPWIQLAGHQGNFKAGDQGTILKKLCSKEQTCLQQLMKDIIRPYVPEYKGEVERDGIKYIQMQDLLCEFDCSSLMDCKIGVRTYLEEELQKARENPKLRKDMYQKMIEVDPNEPTEEEHAQQAITKPRYMIWRETVSSTANQGFRIEGIK-------KADGSSSRDFKTTRTREQILDCFISYTDNNKNIILKYMRRLKAIRATLEASPFFARHELIGSSLLFVHDNTEQACVWMIDFGKSNPIPNDATISHRAPWVEGNREDGYLTGIDNIIDIFEEMYTNAT 415          
BLAST of Kinase vs. TrEMBL
Match: A0A2T7PG18 (Kinase OS=Pomacea canaliculata OX=400727 GN=C0Q70_07796 PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 3.953e-111
Identity = 167/330 (50.61%), Postives = 222/330 (67.27%), Query Frame = 3
Query:  879 DVSLSNNKIPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIH 1868
            D S S++++PS           +R   SSW+K+++   W+PFIQ   +HRYPWIQ+AGHQGNF+ GE G++LKK   RE  C Q +  D L  FVP+F+  ++  G+RY+ +QDLL +F+ P ++DIKMG RTYLEEEL KA+  P  R+DMY+KM+EID+N PT  E+  +A+ KPRYMQWR+ +SS++ LGFRIEG+KK         G  S+D+K+TK RE VK+ L  F+     IL  +++RL D+      S FF  HE IGSSLLFVHD   N   WMIDFGKT PLP    IDH + W+EGNHEDGYLFGL+N++ I  E+H
Sbjct:  124 DSSASDDELPSA----------RRRRQSSWKKIRSIIRWSPFIQVFKKHRYPWIQLAGHQGNFQAGEAGSVLKKLDNREYTCFQQLMNDRLQPFVPEFRGVVEKNGDRYVQLQDLLCEFSSPCVMDIKMGVRTYLEEELEKARKKPSLRKDMYQKMVEIDQNAPTVEENGQRAVTKPRYMQWRDEMSSSVDLGFRIEGIKKSD-------GASSKDFKKTKTRENVKEALKSFVGSNDKILVKYMQRLRDICATQESSKFFQSHEVIGSSLLFVHDAQENVCVWMIDFGKTEPLPEGVVIDHRAPWVEGNHEDGYLFGLDNIICILQELH 436          
BLAST of Kinase vs. TrEMBL
Match: A0A034VJ73 (Kinase (Fragment) OS=Bactrocera dorsalis OX=27457 GN=IP3KB PE=3 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 1.938e-110
Identity = 173/357 (48.46%), Postives = 240/357 (67.23%), Query Frame = 3
Query:  816 RTNISETGSSRCPSSTLVQGDDVSLSNNKIPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPG-EQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYE-GERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDIT 1880
            R +  ++ SS     +LV GDDV   ++ +  I+ +     +  + + S WRKL+    WTPF Q   + RYPW+Q+AGHQGNFK G EQGT+LKK   +E  C +++ +DVL  +VPQ+K ++  E GE Y+ +QDLL+ FNQP ++D K+G RTYLEEEL KAK  PK R+DMYEKM++ID + P+E EH  K + KPRYM WRET+SST TLGFRIEG+KK         GT ++D+K TK R+++KQ   +F++  +  +  +I RL  ++  L  S FF  HE +GSSLLFVHD + +A+ W+IDF KT+ LP N KIDH STW  GNHEDGYL G+ NL++IF E+ +++ 
Sbjct:   21 RADSLDSASSIGSLGSLVLGDDVCRCDDCLLGIVDLYVISAEASKKKPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEQGTVLKKLCPKEEDCFRVLMKDVLRPYVPQYKGQVTSEDGELYLQLQDLLSDFNQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYEKMIQIDPDAPSEEEHKAKGVTKPRYMVWRETISSTATLGFRIEGIKKSD-------GTSTKDFKTTKSRQQIKQAFREFVNGFQHAMPRYIHRLQAIRATLECSDFFQTHEVVGSSLLFVHD-HYHASVWLIDFAKTVGLPENQKIDHRSTWTVGNHEDGYLIGINNLIDIFTELDAEMA 369          
BLAST of Kinase vs. TrEMBL
Match: A0A1S3JJ04 (Kinase OS=Lingula unguis OX=7574 GN=LOC106173514 PE=3 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 4.791e-110
Identity = 160/307 (52.12%), Postives = 222/307 (72.31%), Query Frame = 3
Query:  960 SSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDIT 1880
            SSWRK++    W+PF+QQ  +HRYPWIQ+AGHQGNFK G+QGTILKK   +E  CLQ + +D++  +VP++K E++ +G +YI MQDLL +F+  SL+D K+G RTYLEEEL KA+  PK R+DMY+KM+E+D NEPTE EH+ +AI KPRYM WRET+SST   GFRIEG+K       K  G+ SRD+K T+ RE++    + + D+ ++I+  +++RL  ++  L  S FF  HE IGSSLLFVHD    A  WMIDFGK+ P+P +  I H + W+EGN EDGYL G++N+++IF E++++ T
Sbjct:  314 SSWRKIRNMVHWSPFVQQFKKHRYPWIQLAGHQGNFKAGDQGTILKKLCSKEQTCLQQLMKDIIRPYVPEYKGEVERDGIKYIQMQDLLCEFDCSSLMDCKIGVRTYLEEELQKARENPKLRKDMYQKMIEVDPNEPTEEEHAQQAITKPRYMIWRETVSSTANQGFRIEGIK-------KADGSSSRDFKTTRTREQILDCFISYTDNNKNIILKYMRRLKAIRATLEASPFFARHELIGSSLLFVHDNTEQACVWMIDFGKSNPIPNDATISHRAPWVEGNREDGYLTGIDNIIDIFEEMYTNAT 613          
BLAST of Kinase vs. Ensembl Cavefish
Match: itpkcb (inositol-trisphosphate 3-kinase C [Source:NCBI gene;Acc:103032762])

HSP 1 Score: 342.428 bits (877), Expect = 1.020e-108
Identity = 167/339 (49.26%), Postives = 226/339 (66.67%), Query Frame = 3
Query:  876 DDVSLSNNK----IPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDIT 1880
            DDV+ S+ +     P +   P  +     T + SWRKLK+   ++PF+    + RYPW+Q+AGH G+F+ GE G +LK+Y   E  CLQ +  D L  FVP +   +  + + Y  M DLLA F+ PS++D KMG+RTYLEEELVKA+  PK R+DMYEKM+ +D + PT  E + +A+LKPRYMQWRETLSST TLGFRIEG+K       K  GT + ++K+TK RE+V + L DF+D  + IL ++++RL +L+  L  S FF  HE +GSSLLFVHD +G A  WMIDFGKT+PLPP+  +DH + W EGN EDGYL+GL+NL+ I   + SD  
Sbjct:  238 DDVTGSDAEPAALSPCLFGSPEEL-----TGAKSWRKLKSMVHFSPFVVSF-KKRYPWVQLAGHAGSFQAGEDGKLLKRYCECEQQCLQKLMSDTLKPFVPGYYGVVQRDDQEYNLMDDLLADFDSPSIMDCKMGSRTYLEEELVKARERPKLRKDMYEKMVAVDPDAPTPEERARQAVLKPRYMQWRETLSSTATLGFRIEGIK-------KADGTCNTNFKKTKHREQVMKALDDFVDGNKQILRSYLQRLKELRSGLETSEFFRSHEVVGSSLLFVHDASGQARVWMIDFGKTVPLPPHQTLDHRTPWAEGNREDGYLWGLDNLVEILGAMLSDTA 563          
BLAST of Kinase vs. Ensembl Cavefish
Match: itpkca (inositol-trisphosphate 3-kinase C-like [Source:NCBI gene;Acc:103040434])

HSP 1 Score: 325.094 bits (832), Expect = 4.259e-104
Identity = 164/362 (45.30%), Postives = 232/362 (64.09%), Query Frame = 3
Query:  801 SSDQDRTNISETGSSRCPSSTLVQGDDVSLSNNKIPSILQVPNAVNKIKRTESSS-----WRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHS 1871
            S+  + +  S++G S  P+S+LV    +   +N   + L   +++ + +     S     W++ K    W+P +    + R PW+Q+ GH GNF+ G  G +LKKY   E  CLQ + EDVL  FVP +      + + Y  M DLLA F+ P ++D KMG+RTYLEEEL KA+  P+PR+DMYEKM+ ++   PT  E + +A+LK RYMQWRETLSST T+GFRIEG+KK         GT + ++KRTKDREEV Q L DF+D    +L+++++RL +L++ L +S FF  HE +GSSLLFVHD +G A  WMIDFGKT+P+PP   +DH S W+EGN EDGYL+GL+N ++I   + S
Sbjct:   64 SNTDEESLCSDSGFSGSPASSLV----LRKLSNSSSAGLSPTSSIEEYEEEGQGSMNHELWKRNKNMVNWSPVVVPLEK-RSPWVQVVGHAGNFQTGSDGKLLKKYCACEQQCLQRLMEDVLRPFVPGYHGLTQRDEQDYNLMDDLLAYFDSPCIMDCKMGSRTYLEEELKKARKNPQPRKDMYEKMVAVEPEAPTPEERTQQAVLKTRYMQWRETLSSTATMGFRIEGIKKSD-------GTCNTNFKRTKDREEVMQALEDFVDHNLSVLKSYLQRLKELRVQLEKSDFFKAHEVVGSSLLFVHDHSGRAGVWMIDFGKTVPVPPPLTLDHRSPWVEGNREDGYLWGLDNFIDILTNMLS 413          
BLAST of Kinase vs. Ensembl Cavefish
Match: itpkca (inositol-trisphosphate 3-kinase C-like [Source:NCBI gene;Acc:103040434])

HSP 1 Score: 326.25 bits (835), Expect = 5.345e-104
Identity = 154/305 (50.49%), Postives = 207/305 (67.87%), Query Frame = 3
Query:  957 SSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHS 1871
            S  W++ K    W+P +    + R PW+Q+ GH GNF+ G  G +LKKY   E  CLQ + EDVL  FVP +      + + Y  M DLLA F+ P ++D KMG+RTYLEEEL KA+  P+PR+DMYEKM+ ++   PT  E + +A+LK RYMQWRETLSST T+GFRIEG+KK         GT + ++KRTKDREEV Q L DF+D    +L+++++RL +L++ L +S FF  HE +GSSLLFVHD +G A  WMIDFGKT+P+PP   +DH S W+EGN EDGYL+GL+N ++I   + S
Sbjct:  149 SELWKRNKNMVNWSPVVVPLEK-RSPWVQVVGHAGNFQTGSDGKLLKKYCACEQQCLQRLMEDVLRPFVPGYHGLTQRDEQDYNLMDDLLAYFDSPCIMDCKMGSRTYLEEELKKARKNPQPRKDMYEKMVAVEPEAPTPEERTQQAVLKTRYMQWRETLSSTATMGFRIEGIKKSD-------GTCNTNFKRTKDREEVMQALEDFVDHNLSVLKSYLQRLKELRVQLEKSDFFKAHEVVGSSLLFVHDHSGRAGVWMIDFGKTVPVPPPLTLDHRSPWVEGNREDGYLWGLDNFIDILTNMLS 445          
BLAST of Kinase vs. Ensembl Cavefish
Match: itpka (inositol-trisphosphate 3-kinase A [Source:NCBI gene;Acc:103040266])

HSP 1 Score: 317.775 bits (813), Expect = 8.594e-101
Identity = 149/310 (48.06%), Postives = 207/310 (66.77%), Query Frame = 3
Query:  954 ESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDITP 1883
            E+ +W KLK    W P +    R R  W+Q+AGH+G+FK  E+GTILKKY+  E  C + + +D L  FVP +   ++ +G+ ++ M DLL  F+ P+++D KMG RTY EEEL +A+  PK R+D+Y KM+E+D   PT  E   +AI KPRYMQWRE+LSST TLGFRIEGVK       K  GT   D+K+T+ RE+V Q+  DF+ +  +I+ ++I+RL +++ AL  S FF  HE IGSSLLF+H+    A  W+IDFGKT PLP    +DH+S W EGN EDGYL+GLENLL+    ++++ +P
Sbjct:  142 EAKAWWKLKTVVHW-PLVA-SHRKRLSWVQLAGHKGSFKAAEEGTILKKYSENEKRCFESLRDDALQRFVPAYHGVVERDGDLFLQMNDLLVNFDGPNVMDCKMGVRTYQEEELERAREKPKLRRDLYNKMLEVDSEAPTAEEQKQQAITKPRYMQWRESLSSTNTLGFRIEGVK-------KADGTCHTDFKKTRSREDVTQVFRDFVSENGNIISSYIRRLEEIRQALKASEFFMKHEVIGSSLLFIHNHTERAEVWLIDFGKTTPLPDGQTVDHWSPWQEGNREDGYLWGLENLLHTLTSLNTECSP 442          
BLAST of Kinase vs. Ensembl Cavefish
Match: itpkb (inositol-trisphosphate 3-kinase B [Source:ZFIN;Acc:ZDB-GENE-041014-166])

HSP 1 Score: 311.227 bits (796), Expect = 5.488e-96
Identity = 156/327 (47.71%), Postives = 212/327 (64.83%), Query Frame = 3
Query:  876 DDVSLSNNKIPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
            DD+S    + P+ LQ     +K       SW+K+K    W+PF+    + +YPWIQ+AGH  +FK G  G ILKK+   E  CL  + +DVL  +VP +  +++ +GE+Y  M DLLA+F+ P ++D KMG  TYLEEEL KA+  P  R DMY KM+++D + PT+ E   KA+ KPRYMQWRET+SST TLGFRIEG+K+ G  N        RD+K+TK RE+V +   DF+    +IL +++ RL +++  L  SMFF  HE IGSSLLFVHDK  +A  WMIDFGKT PLP    + H   W+EGN EDGYL+GL++L++I 
Sbjct:  323 DDISSDPERTPAFLQTQQKAHK-------SWKKIKNMVHWSPFVMSF-KKKYPWIQLAGH-ASFKAGANGRILKKHCECEQRCLDWLMKDVLRPYVPAYHGDVEKDGEKYNQMDDLLAEFDMPCVMDCKMGV-TYLEEELTKARKKPSLRSDMYLKMIDVDPDAPTQEEKDQKAVTKPRYMQWRETISSTATLGFRIEGIKEDGTVN--------RDFKKTKSREQVTEAFHDFVKGNVNILNSYLIRLKEIRDTLEVSMFFKTHEVIGSSLLFVHDKREHAKVWMIDFGKTTPLPEGQVLSHRDNWVEGNREDGYLWGLDHLIDII 631          
BLAST of Kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003389.1 (pep scaffold:Pmarinus_7.0:GL479042:591:3502:-1 gene:ENSPMAG00000003101.1 transcript:ENSPMAT00000003389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.711 bits (439), Expect = 1.283e-50
Identity = 80/176 (45.45%), Postives = 120/176 (68.18%), Query Frame = 3
Query:  954 ESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQ-GTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVK 1478
            +  +W+++++    TPFI   +   Y ++ +    GNFK GEQ G +LK++   E  CL+++  D L  FVP +  E++ +G RY+ M+DLL  F+ P ++D KMG RTYLEEEL +A+  P+ R+DMY+KM+ ++   PT  EH+ +A+ KPRYMQWRET+SS+ TLGFRIEG+K
Sbjct:    9 QHKAWKRIQSIMHRTPFIV-ASEASYNYVNLWWDAGNFKTGEQQGVVLKRFCEGEQRCLRLLMGDALRPFVPAYLGEMENDGVRYVQMEDLLTDFHAPCIMDCKMGVRTYLEEELARAREKPRLRKDMYQKMVAVEPGAPTAEEHTQRAVTKPRYMQWRETISSSATLGFRIEGIK 183          
BLAST of Kinase vs. Ensembl Nematostella
Match: EDO46853 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP53])

HSP 1 Score: 304.294 bits (778), Expect = 2.651e-98
Identity = 147/297 (49.49%), Postives = 207/297 (69.70%), Query Frame = 3
Query:  969 RKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPS-LIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
            +K++    W+PF+Q   + +YPW+Q+AGHQG FKPGE G ILKK   RE   L  +  D+L  +VP++K E++  GE+YI MQDLL  F+ P  ++D KMG RTYLE+E+ KAK   KPR+D+Y+KM+++D NEPTE E +  AI KPRYMQWRE LSS+ +LGFRIEG+KK   K +K       D+K+TK  ++V  +  D+I++   +   +++RL  ++  L  S FF  HE IGSSLLFVHD +G+A+ WMIDFGKT+P+     +DH + W EGNHEDGYL+GL+ +++I+
Sbjct:    2 KKIRNMIHWSPFVQSFKK-KYPWVQLAGHQGCFKPGENGAILKKSCDRERESLIKLMRDILRPYVPEYKREVEKNGEKYIEMQDLLQDFDTPCCVMDCKMGIRTYLEDEIAKAKS--KPRKDLYQKMVDVDPNEPTEEERNEGAITKPRYMQWRERLSSSASLGFRIEGIKKGNEKPNK-------DFKKTKTTDDVYSVFTDYIENDDQLRSKYLRRLKAIRATLEASAFFSSHEVIGSSLLFVHDSSGHASVWMIDFGKTVPVADGRVLDHRTPWQEGNHEDGYLWGLDKMIDIW 288          
BLAST of Kinase vs. Ensembl Medaka
Match: itpkcb (inositol-trisphosphate 3-kinase A [Source:NCBI gene;Acc:101160679])

HSP 1 Score: 336.65 bits (862), Expect = 2.077e-105
Identity = 160/307 (52.12%), Postives = 214/307 (69.71%), Query Frame = 3
Query:  951 TESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHS 1871
            T + SW+KLK     +PF+    + RYPW+Q+AGH GNF+ GE G +LK+Y   E +CLQ + +D L  +VP +   I  + + Y  M DLLA F+ PS++D KMG+RTYLEEEL KA+  P+ R+DMYEKM+ +D   PTE E + + +LKPRYMQWRETLSST TLGFRIEG+K       K  GT + ++K+TK +E+V Q L DF+D    IL+ +++RL +L+ AL QS FF  HE +GSSLLFVHD +G A  WMIDFGKT+PLP +  +DH + W EGN EDGYL+GL+NL++IF  + S
Sbjct:  356 TGAKSWQKLKTMVHCSPFVVS-FKKRYPWVQLAGHAGNFQAGEYGRLLKRYCECEQLCLQKLMKDTLRPYVPGYYGVIQKDEQDYNLMDDLLADFDSPSIMDCKMGSRTYLEEELTKARERPRLRKDMYEKMVAVDPEAPTEEERAQQGVLKPRYMQWRETLSSTATLGFRIEGIK-------KADGTCNTNFKKTKHKEQVMQALEDFVDGNVQILKLYLQRLEELRSALEQSQFFKAHEVVGSSLLFVHDASGKAKVWMIDFGKTVPLPDSQTLDHRTPWSEGNREDGYLWGLDNLISIFSTVLS 654          
BLAST of Kinase vs. Ensembl Medaka
Match: itpkcb (inositol-trisphosphate 3-kinase A [Source:NCBI gene;Acc:101160679])

HSP 1 Score: 337.035 bits (863), Expect = 2.500e-105
Identity = 160/307 (52.12%), Postives = 214/307 (69.71%), Query Frame = 3
Query:  951 TESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHS 1871
            T + SW+KLK     +PF+    + RYPW+Q+AGH GNF+ GE G +LK+Y   E +CLQ + +D L  +VP +   I  + + Y  M DLLA F+ PS++D KMG+RTYLEEEL KA+  P+ R+DMYEKM+ +D   PTE E + + +LKPRYMQWRETLSST TLGFRIEG+K       K  GT + ++K+TK +E+V Q L DF+D    IL+ +++RL +L+ AL QS FF  HE +GSSLLFVHD +G A  WMIDFGKT+PLP +  +DH + W EGN EDGYL+GL+NL++IF  + S
Sbjct:  382 TGAKSWQKLKTMVHCSPFVVS-FKKRYPWVQLAGHAGNFQAGEYGRLLKRYCECEQLCLQKLMKDTLRPYVPGYYGVIQKDEQDYNLMDDLLADFDSPSIMDCKMGSRTYLEEELTKARERPRLRKDMYEKMVAVDPEAPTEEERAQQGVLKPRYMQWRETLSSTATLGFRIEGIK-------KADGTCNTNFKKTKHKEQVMQALEDFVDGNVQILKLYLQRLEELRSALEQSQFFKAHEVVGSSLLFVHDASGKAKVWMIDFGKTVPLPDSQTLDHRTPWSEGNREDGYLWGLDNLISIFSTVLS 680          
BLAST of Kinase vs. Ensembl Medaka
Match: itpka (inositol-trisphosphate 3-kinase A [Source:NCBI gene;Acc:101157020])

HSP 1 Score: 304.679 bits (779), Expect = 5.743e-96
Identity = 149/333 (44.74%), Postives = 223/333 (66.97%), Query Frame = 3
Query:  867 VQGDDVSLSNNKIPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEI 1865
            V+ +D  LS+N+  S   V   + ++   E+ SW KLKA   W PF     R +  W+Q+AGH+G+FK  ++G+ILKK++  E  C + + +D L+ FVP +   ++ +GE ++ M DLLA F+ P+++D KMG RTYLEEELV+A+  PKPR+D+Y+KM+E+D + PT  EHS + + KPRYMQWRE++SST TLGFRIEG+K    K+D   G+   D+K+T+ +++V Q+  DF+     ++++++ +L +++ AL  S FF  HE IGSSLLF+H+  GNA  W+IDFGKT  LP    + H   W EGN EDGYL+GL+NL++    +
Sbjct:  105 VESEDDLLSDNESKSKGIV--TLEQLDGGENKSWWKLKAFVRW-PF-NATQRKKLNWVQLAGHKGHFKAADEGSILKKFSENEMECFEKLRDDALLPFVPGYHGVVEKDGESFLHMTDLLATFDLPNVMDCKMGVRTYLEEELVRARERPKPREDLYKKMVEVDRDGPTPQEHSQRGVTKPRYMQWRESMSSTNTLGFRIEGIK----KDD---GSCRTDFKKTRSKQDVIQVFKDFVGGDLGLIKSYLTKLEEIRQALNTSEFFKRHEVIGSSLLFIHNNTGNAQIWIIDFGKTTALPEGQTLQHDVPWQEGNREDGYLWGLDNLMHTLKSV 426          
BLAST of Kinase vs. Ensembl Medaka
Match: itpka (inositol-trisphosphate 3-kinase A [Source:NCBI gene;Acc:101157020])

HSP 1 Score: 293.123 bits (749), Expect = 1.686e-91
Identity = 148/330 (44.85%), Postives = 217/330 (65.76%), Query Frame = 3
Query:  867 VQGDDVSLSNNKIPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIF 1856
            V+ +D  LS+N+  S   V   + ++   E+ SW KLKA   W PF     R +  W+Q+AGH+G+FK  ++G+ILKK++  E  C + + +D L+ FVP +   ++ +GE ++ M DLLA F+ P+++D KMG RTYLEEELV+A+  PKPR+D+Y+KM+E+D + PT  EHS + + KPRYMQWRE++SST TLGFRIEG+K    K+D   G+   D+K+T+ +++V Q+  DF+     +    I RL D++I +  S  F+  + IGSSLLF+H+  GNA  W+IDFGKT  LP    + H   W EGN EDGYL+GL+NL++  
Sbjct:  105 VESEDDLLSDNESKSKGIV--TLEQLDGGENKSWWKLKAFVRW-PF-NATQRKKLNWVQLAGHKGHFKAADEGSILKKFSENEMECFEKLRDDALLPFVPGYHGVVEKDGESFLHMTDLLATFDLPNVMDCKMGVRTYLEEELVRARERPKPREDLYKKMVEVDRDGPTPQEHSQRGVTKPRYMQWRESMSSTNTLGFRIEGIK----KDD---GSCRTDFKKTRSKQDVIQVFKDFVGGDLGL----IVRLSDMRIRVKPSSLFFFLQVIGSSLLFIHNNTGNAQIWIIDFGKTTALPEGQTLQHDVPWQEGNREDGYLWGLDNLMHTL 419          
BLAST of Kinase vs. Ensembl Medaka
Match: ENSORLT00000021447.2 (inositol-trisphosphate 3-kinase B [Source:NCBI gene;Acc:101171378])

HSP 1 Score: 243.432 bits (620), Expect = 6.123e-70
Identity = 116/237 (48.95%), Postives = 161/237 (67.93%), Query Frame = 3
Query:  963 SWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHE 1673
            SW+K+K    W+PF+    + +YPWIQ+AGH G+FK G  G ILKK+   E  CL ++ +DVL  +VP +  +++ +G++Y  M+DLLA+F+ P ++D KMG RTYLEEEL KA+  P PR DMY+KM+E+D   PT  E+  KA+ KPRYMQWRETLSST TLGFRIEGVKK         GT +RD+K+TK RE+V     +F+   +DI++ ++ RL +++  L  S FF  HE
Sbjct:  465 SWKKIKNMVHWSPFVMSF-KKKYPWIQLAGHAGSFKAGANGRILKKHCECEQRCLSLLMKDVLRPYVPGYHGDVEKDGQKYNQMEDLLAEFDFPCVMDCKMGIRTYLEEELTKARKKPSPRPDMYQKMVEVDPEAPTPEENERKAVTKPRYMQWRETLSSTATLGFRIEGVKKED-------GTVNRDFKKTKTREQVTAAFREFVKGNKDIVKLYLSRLKEIRAILEVSPFFKSHE 693          
BLAST of Kinase vs. Planmine SMEST
Match: SMESG000019079.1 (SMESG000019079.1)

HSP 1 Score: 1159.82 bits (2999), Expect = 0.000e+0
Identity = 586/588 (99.66%), Postives = 586/588 (99.66%), Query Frame = 3
Query:  129 MHETNSHHFPIGRNSDKMIPNSTELSERLSDIXXXXXXXXXXXXXXXXXXXXXXXXXPVDILKRIFSHKSNSSKLKPQKDFSTAKAIAQSTIDIFAQNPPIHNELYINPTTSISTGHLNTDEYSQVSQSNENKFHIIDNHISKVDCVPICYANLISTETSSVTSYQFPDIPKIVKETPSNRSSPLLTEYHIKSENNLHLSLPQNDRSRKSSENDSAVDLKFNDDSSDQDRTNISETGSSRCPSSTLVQGDDVSLSNNKIPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDITPIET 1892
            MHETNSHHFPIGRNSDKMIPNSTELSERLSDISTTESKTKKHKSMDSKKHKDKVHSKPVDILKRIFSHKSNSSKLKPQKDFSTAKAIAQSTIDIFAQNPPIHNELYINPTTSISTGHLNTDEYSQVSQSNENKFHIIDNHISKVDCVPICYANLISTETSSVTSYQFPDIPKIVKETPSNRSSPLLTEYHIKSENNLHLSLPQNDRSRKSSENDSAVDLKFNDDSSDQDRTNISETGSSRCPSSTLVQGDDVSLSNNK PSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDITPIE 
Sbjct:    1 MHETNSHHFPIGRNSDKMIPNSTELSERLSDISTTESKTKKHKSMDSKKHKDKVHSKPVDILKRIFSHKSNSSKLKPQKDFSTAKAIAQSTIDIFAQNPPIHNELYINPTTSISTGHLNTDEYSQVSQSNENKFHIIDNHISKVDCVPICYANLISTETSSVTSYQFPDIPKIVKETPSNRSSPLLTEYHIKSENNLHLSLPQNDRSRKSSENDSAVDLKFNDDSSDQDRTNISETGSSRCPSSTLVQGDDVSLSNNKNPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDITPIEA 588          
BLAST of Kinase vs. Planmine SMEST
Match: SMESG000019079.1 (SMESG000019079.1)

HSP 1 Score: 1138.64 bits (2944), Expect = 0.000e+0
Identity = 579/588 (98.47%), Postives = 579/588 (98.47%), Query Frame = 3
Query:  129 MHETNSHHFPIGRNSDKMIPNSTELSERLSDIXXXXXXXXXXXXXXXXXXXXXXXXXPVDILKRIFSHKSNSSKLKPQKDFSTAKAIAQSTIDIFAQNPPIHNELYINPTTSISTGHLNTDEYSQVSQSNENKFHIIDNHISKVDCVPICYANLISTETSSVTSYQFPDIPKIVKETPSNRSSPLLTEYHIKSENNLHLSLPQNDRSRKSSENDSAVDLKFNDDSSDQDRTNISETGSSRCPSSTLVQGDDVSLSNNKIPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVKKFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDITPIET 1892
            MHETNSHHFPIGRNSDKMIPNSTELSERLSDISTTESKTKKHKSMDSKKHKDKVHSKPVDILKRIFSHKSNSSKLKPQKDFSTAKAIAQSTIDIFAQNPPIHNELYINPTTSISTGHLNTDEYSQVSQSNENKFHIIDNHISKVDCVPICYANLISTETSSVTSYQFPDIPKIVKETPSNRSSPLLTEYHIKSENNLHLSLPQNDRSRKSSENDSAVDLKFNDDSSDQDRTNISETGSSRCPSSTLVQGDDVSLSNNK PSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVK       KVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDITPIE 
Sbjct:    1 MHETNSHHFPIGRNSDKMIPNSTELSERLSDISTTESKTKKHKSMDSKKHKDKVHSKPVDILKRIFSHKSNSSKLKPQKDFSTAKAIAQSTIDIFAQNPPIHNELYINPTTSISTGHLNTDEYSQVSQSNENKFHIIDNHISKVDCVPICYANLISTETSSVTSYQFPDIPKIVKETPSNRSSPLLTEYHIKSENNLHLSLPQNDRSRKSSENDSAVDLKFNDDSSDQDRTNISETGSSRCPSSTLVQGDDVSLSNNKNPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHRYPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKSEIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQDMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVK-------KVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCDLKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKIDHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDITPIEA 581          
The following BLAST results are available for this feature:
BLAST of Kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITPKB1.072e-9451.31inositol-trisphosphate 3-kinase B [Source:HGNC Sym... [more]
ITPKB1.072e-9451.31inositol-trisphosphate 3-kinase B [Source:HGNC Sym... [more]
ITPKC6.865e-9448.06inositol-trisphosphate 3-kinase C [Source:HGNC Sym... [more]
ITPKA2.330e-8846.38inositol-trisphosphate 3-kinase A [Source:HGNC Sym... [more]
ITPKA2.938e-5545.45inositol-trisphosphate 3-kinase A [Source:HGNC Sym... [more]
back to top
BLAST of Kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lfe-21.006e-5739.08Inositol-trisphosphate 3-kinase homolog [Source:U... [more]
lfe-21.499e-5739.08Inositol-trisphosphate 3-kinase homolog [Source:U... [more]
lfe-21.705e-5739.08Inositol-trisphosphate 3-kinase homolog [Source:U... [more]
lfe-24.624e-5739.08Inositol-trisphosphate 3-kinase homolog [Source:U... [more]
lfe-26.212e-5739.08Inositol-trisphosphate 3-kinase homolog [Source:U... [more]
back to top
BLAST of Kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IP3K23.812e-11150.00gene:FBgn0283680 transcript:FBtr0344168[more]
IP3K23.812e-11150.00gene:FBgn0283680 transcript:FBtr0346134[more]
IP3K23.812e-11150.00gene:FBgn0283680 transcript:FBtr0344169[more]
IP3K21.365e-10852.58gene:FBgn0283680 transcript:FBtr0344171[more]
IP3K21.365e-10852.58gene:FBgn0283680 transcript:FBtr0344170[more]
back to top
BLAST of Kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itpkb2.830e-10549.54inositol-trisphosphate 3-kinase B [Source:ZFIN;Acc... [more]
itpkb2.830e-10549.54inositol-trisphosphate 3-kinase B [Source:ZFIN;Acc... [more]
itpkcb2.382e-9849.54inositol-trisphosphate 3-kinase Cb [Source:ZFIN;Ac... [more]
itpkca2.179e-9650.17inositol-trisphosphate 3-kinase Ca [Source:ZFIN;Ac... [more]
itpka7.038e-9645.78inositol-trisphosphate 3-kinase A [Source:ZFIN;Acc... [more]
back to top
BLAST of Kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itpkc8.230e-11054.46inositol-trisphosphate 3-kinase C [Source:NCBI gen... [more]
ITPKB8.938e-9847.45inositol-trisphosphate 3-kinase B [Source:NCBI gen... [more]
ITPKB1.480e-9747.16inositol-trisphosphate 3-kinase B [Source:NCBI gen... [more]
ITPKB3.971e-9746.75inositol-trisphosphate 3-kinase B [Source:NCBI gen... [more]
ENSXETT00000050857.11.192e-9047.52inositol-trisphosphate 3-kinase A [Source:NCBI gen... [more]
back to top
BLAST of Kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Itpkc1.200e-9850.17inositol 1,4,5-trisphosphate 3-kinase C [Source:MG... [more]
Itpkb8.259e-9551.16inositol 1,4,5-trisphosphate 3-kinase B [Source:MG... [more]
Itpka1.949e-8946.75inositol 1,4,5-trisphosphate 3-kinase A [Source:MG... [more]
back to top
BLAST of Kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TS72|IP3KC_MOUSE8.394e-9850.17Inositol-trisphosphate 3-kinase C OS=Mus musculus ... [more]
sp|Q80ZG2|IP3KC_RAT4.059e-9749.83Inositol-trisphosphate 3-kinase C OS=Rattus norveg... [more]
sp|P27987|IP3KB_HUMAN5.148e-9451.31Inositol-trisphosphate 3-kinase B OS=Homo sapiens ... [more]
sp|P42335|IP3KB_RAT2.655e-9351.16Inositol-trisphosphate 3-kinase B OS=Rattus norveg... [more]
sp|Q96DU7|IP3KC_HUMAN3.297e-9348.06Inositol-trisphosphate 3-kinase C OS=Homo sapiens ... [more]
back to top
BLAST of Kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BAA21.164e-11452.92Kinase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_... [more]
A0A1S3JIA22.397e-11151.43Kinase OS=Lingula unguis OX=7574 GN=LOC106173514 P... [more]
A0A2T7PG183.953e-11150.61Kinase OS=Pomacea canaliculata OX=400727 GN=C0Q70_... [more]
A0A034VJ731.938e-11048.46Kinase (Fragment) OS=Bactrocera dorsalis OX=27457 ... [more]
A0A1S3JJ044.791e-11052.12Kinase OS=Lingula unguis OX=7574 GN=LOC106173514 P... [more]
back to top
BLAST of Kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itpkcb1.020e-10849.26inositol-trisphosphate 3-kinase C [Source:NCBI gen... [more]
itpkca4.259e-10445.30inositol-trisphosphate 3-kinase C-like [Source:NCB... [more]
itpkca5.345e-10450.49inositol-trisphosphate 3-kinase C-like [Source:NCB... [more]
itpka8.594e-10148.06inositol-trisphosphate 3-kinase A [Source:NCBI gen... [more]
itpkb5.488e-9647.71inositol-trisphosphate 3-kinase B [Source:ZFIN;Acc... [more]
back to top
BLAST of Kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003389.11.283e-5045.45pep scaffold:Pmarinus_7.0:GL479042:591:3502:-1 gen... [more]
back to top
BLAST of Kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO468532.651e-9849.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itpkcb2.077e-10552.12inositol-trisphosphate 3-kinase A [Source:NCBI gen... [more]
itpkcb2.500e-10552.12inositol-trisphosphate 3-kinase A [Source:NCBI gen... [more]
itpka5.743e-9644.74inositol-trisphosphate 3-kinase A [Source:NCBI gen... [more]
itpka1.686e-9144.85inositol-trisphosphate 3-kinase A [Source:NCBI gen... [more]
ENSORLT00000021447.26.123e-7048.95inositol-trisphosphate 3-kinase B [Source:NCBI gen... [more]
back to top
BLAST of Kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000019079.10.000e+099.66SMESG000019079.1[more]
SMESG000019079.10.000e+098.47SMESG000019079.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004278 ID=SMED30004278|Name=Kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2160bp
AAGTATTTAAATTGGAATAATTTTGTCTATCTGGTTTTGAATAATGATTT
TAAATTAGTTATCGGAACATTTTAAGCTAAATCACATTGATACTTTTTCG
CCCTAATTCTGTGATCCGATTTCACGAAATGCATGAAACTAATTCTCATC
ATTTCCCGATTGGTAGAAATTCAGATAAAATGATACCAAACTCCACGGAA
TTATCCGAAAGATTGTCTGATATTTCAACAACTGAATCTAAAACCAAAAA
ACACAAATCGATGGATTCCAAGAAGCACAAAGATAAAGTCCATTCGAAAC
CAGTAGATATTTTGAAGCGAATTTTTTCTCACAAGTCAAATTCAAGCAAA
TTAAAACCACAGAAAGATTTTTCAACTGCCAAAGCTATTGCTCAGTCGAC
TATAGATATTTTTGCTCAAAATCCACCGATTCACAATGAATTGTATATAA
ATCCAACTACTTCTATATCAACTGGTCATCTGAATACAGATGAATATTCT
CAGGTATCTCAGTCAAATGAAAATAAATTCCACATTATTGATAATCATAT
CTCGAAAGTCGACTGTGTTCCGATATGTTATGCTAACTTAATAAGCACCG
AAACTTCATCAGTAACATCTTATCAGTTTCCTGATATACCAAAAATCGTA
AAAGAAACTCCATCAAATCGAAGTAGTCCTTTGCTTACAGAATATCATAT
CAAATCTGAAAATAATTTGCATTTATCATTACCGCAAAATGATCGAAGTC
GAAAATCCAGTGAAAACGATTCGGCTGTAGATTTGAAGTTCAATGATGAT
TCCAGTGATCAAGATCGCACAAATATCAGCGAGACTGGAAGCAGTCGGTG
TCCCTCGTCTACTTTGGTTCAAGGAGATGATGTATCTTTGTCAAATAACA
AAATCCCGTCGATTTTGCAAGTACCAAATGCAGTAAATAAAATAAAAAGA
ACAGAATCATCATCCTGGAGAAAATTAAAAGCTGCTTTTATTTGGACGCC
ATTTATTCAACAATGTGCTCGCCACCGATATCCATGGATTCAAATAGCTG
GGCATCAAGGAAATTTCAAGCCGGGAGAGCAAGGAACTATATTGAAAAAG
TATACTGGTCGAGAAAGTATTTGCTTGCAAATGATGAATGAGGATGTTTT
AGTAGAGTTTGTACCTCAATTCAAAAGTGAAATTGACTATGAAGGAGAAA
GATATATCTGTATGCAAGATCTACTTGCTAAATTCAATCAACCGTCATTA
ATTGATATCAAAATGGGTACTCGTACTTATTTGGAGGAAGAATTGGTTAA
AGCAAAACATTGTCCAAAACCTCGGCAAGATATGTATGAAAAAATGATGG
AGATTGATGAAAATGAACCGACAGAACATGAACATAGTATCAAAGCCATT
TTAAAACCAAGGTATATGCAGTGGCGTGAAACTCTGAGTTCTACTATTAC
TCTAGGGTTTAGAATCGAGGGAGTTAAGAAATTTGGTATTAAAAATGACA
AAGTAGTTGGAACTCAAAGTCGGGATTATAAACGAACAAAAGATCGTGAA
GAAGTGAAGCAGATTCTTGTAGATTTCATCGACGATAAACGTGATATTTT
AGAAACTTTCATTAAAAGGCTATGCGATTTGAAGATAGCACTTACACAAT
CAATGTTCTTTTGGGACCATGAATTTATCGGTAGTTCACTGCTATTCGTA
CATGACAAAAACGGAAATGCCAACGCATGGATGATTGATTTTGGTAAAAC
AATCCCATTGCCTCCCAATTGTAAGATAGATCACTATTCTACATGGATTG
AAGGAAATCATGAAGACGGCTATTTGTTTGGATTGGAAAATTTGCTCAAC
ATTTTTCTAGAAATACATTCCGACATCACACCGATCGAAACCAACTAGTC
TTTTACAATTACTTTGCTCACACAATGCGAATTTCGTCACTAAAATATAC
AAATCGGATGATTTCAGATCGACCTTGAATAATTCCATAGAGTTTGCTCA
ATTTTTCAATTTATTACAACTATTTGTTCATGTGCGCACCCGAATCATTT
GTAGAGAATTGTTGATAAATGAATTAAATTTCTTGTTTTTAGAATTTGGG
AAATTTGTTTATACAGATAAATTAATTGATTTTAATTTTTTTATCAAATT
TTCTACAGTG
back to top

protein sequence of SMED30004278-orf-1

>SMED30004278-orf-1 ID=SMED30004278-orf-1|Name=SMED30004278-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=590bp
MHETNSHHFPIGRNSDKMIPNSTELSERLSDISTTESKTKKHKSMDSKKH
KDKVHSKPVDILKRIFSHKSNSSKLKPQKDFSTAKAIAQSTIDIFAQNPP
IHNELYINPTTSISTGHLNTDEYSQVSQSNENKFHIIDNHISKVDCVPIC
YANLISTETSSVTSYQFPDIPKIVKETPSNRSSPLLTEYHIKSENNLHLS
LPQNDRSRKSSENDSAVDLKFNDDSSDQDRTNISETGSSRCPSSTLVQGD
DVSLSNNKIPSILQVPNAVNKIKRTESSSWRKLKAAFIWTPFIQQCARHR
YPWIQIAGHQGNFKPGEQGTILKKYTGRESICLQMMNEDVLVEFVPQFKS
EIDYEGERYICMQDLLAKFNQPSLIDIKMGTRTYLEEELVKAKHCPKPRQ
DMYEKMMEIDENEPTEHEHSIKAILKPRYMQWRETLSSTITLGFRIEGVK
KFGIKNDKVVGTQSRDYKRTKDREEVKQILVDFIDDKRDILETFIKRLCD
LKIALTQSMFFWDHEFIGSSLLFVHDKNGNANAWMIDFGKTIPLPPNCKI
DHYSTWIEGNHEDGYLFGLENLLNIFLEIHSDITPIETN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0032958inositol phosphate biosynthetic process
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038286IPK_sf
IPR005522IPK
Vocabulary: molecular function
TermDefinition
GO:0008440inositol-1,4,5-trisphosphate 3-kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005522Inositol polyphosphate kinasePFAMPF03770IPKcoord: 359..576
e-value: 6.2E-38
score: 130.6
IPR005522Inositol polyphosphate kinasePANTHERPTHR12400INOSITOL POLYPHOSPHATE KINASEcoord: 198..579
IPR038286Inositol polyphosphate kinase superfamilyGENE3DG3DSA:1.10.510.50coord: 311..582
e-value: 3.2E-105
score: 353.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..55
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 16..30
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 205..230
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 231..253
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 196..253
NoneNo IPR availablePANTHERPTHR12400:SF44KINASEcoord: 198..579
NoneNo IPR availableSUPERFAMILYSSF56104SAICAR synthase-likecoord: 301..581