Triosephosphate isomerase

Overview
NameTriosephosphate isomerase
Smed IDSMED30004273
Length (bp)851
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Triosephosphate isomerase (SMED30004273) t-SNE clustered cells

Violin plots show distribution of expression levels for Triosephosphate isomerase (SMED30004273) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004273

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30004273SMESG000069339.1 SmedASXL_000776SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30004273SMESG000069339.1 Contig32989newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004273SMESG000069339.1 Contig32989uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30004273SMESG000069339.1 PL06004B2E12ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30004273SMESG000069339.1 Contig3963_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30004273SMESG000069339.1 Contig3963_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30004273SMESG000069339.1 Contig3963_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testisSMED30004273SMESG000069339.1 PL06011A2G07_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30004273SMESG000069339.1 PL06011A2G07_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30004273SMESG000069339.1 PL06011A2G07_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Triosephosphate isomerase vs. Ensembl Human
Match: TPI1 (triosephosphate isomerase 1 [Source:HGNC Symbol;Acc:HGNC:12009])

HSP 1 Score: 111.309 bits (277), Expect = 2.864e-28
Identity = 75/249 (30.12%), Postives = 123/249 (49.40%), Query Frame = 1
Query:   79 AMENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            AM    KF + G      R+  +   I +LN   +   +T+VV AP   Y+   RQKL  KI +AA +C   T G    + S   +  DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ +S A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:   37 AMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVP-ADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIK-DCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 283          
BLAST of Triosephosphate isomerase vs. Ensembl Human
Match: TPI1 (triosephosphate isomerase 1 [Source:HGNC Symbol;Acc:HGNC:12009])

HSP 1 Score: 111.309 bits (277), Expect = 2.864e-28
Identity = 75/249 (30.12%), Postives = 123/249 (49.40%), Query Frame = 1
Query:   79 AMENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            AM    KF + G      R+  +   I +LN   +   +T+VV AP   Y+   RQKL  KI +AA +C   T G    + S   +  DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ +S A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:   37 AMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVP-ADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIK-DCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 283          
BLAST of Triosephosphate isomerase vs. Ensembl Human
Match: TPI1 (triosephosphate isomerase 1 [Source:HGNC Symbol;Acc:HGNC:12009])

HSP 1 Score: 109.383 bits (272), Expect = 5.155e-28
Identity = 74/248 (29.84%), Postives = 122/248 (49.19%), Query Frame = 1
Query:   82 MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            M    KF + G      R+  +   I +LN   +   +T+VV AP   Y+   RQKL  KI +AA +C   T G    + S   +  DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ +S A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:    1 MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVP-ADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIK-DCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 246          
BLAST of Triosephosphate isomerase vs. Ensembl Human
Match: TPI1 (triosephosphate isomerase 1 [Source:HGNC Symbol;Acc:HGNC:12009])

HSP 1 Score: 80.1073 bits (196), Expect = 8.588e-18
Identity = 48/161 (29.81%), Postives = 84/161 (52.17%), Query Frame = 1
Query:  343 DCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ +S A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:    4 DCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 164          
BLAST of Triosephosphate isomerase vs. Ensembl Human
Match: TPI1 (triosephosphate isomerase 1 [Source:HGNC Symbol;Acc:HGNC:12009])

HSP 1 Score: 80.1073 bits (196), Expect = 8.588e-18
Identity = 48/161 (29.81%), Postives = 84/161 (52.17%), Query Frame = 1
Query:  343 DCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ +S A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:    4 DCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 164          
BLAST of Triosephosphate isomerase vs. Ensembl Celegans
Match: tpi-1 (Triosephosphate isomerase [Source:UniProtKB/Swiss-Prot;Acc:Q10657])

HSP 1 Score: 90.5077 bits (223), Expect = 2.911e-21
Identity = 63/218 (28.90%), Postives = 100/218 (45.87%), Query Frame = 1
Query:  184 DYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFECSVKTIDVVNIGKIVKG---------IRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            D  + DVV+AP   YL   + KL   + +AA +C    +G    + S   +  D G  WVI+   E R    E++ +  ++ VHAL+  +K++FC+    +    G   +   + L++I      W  + IA+E     +  +  GK   G         IR FLK  +S A     RI+YGG++      E     DI+G+L+       DF+KIIN
Sbjct:   32 DNSSVDVVVAPPAPYLAYAKSKLKAGVLVAAQNCYKVPKGAFTGEISPAMIK-DLGLEWVILGHSERRHVFGESDALIAEKTVHALEAGIKVVFCIGEKLEEREAGHTKDVNFRQLQAIVDKGVSWENIVIAYE----PVWAIGTGKTASGEQAQEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAAELGKKPDIDGFLVGGASLKPDFVKIIN 244          
BLAST of Triosephosphate isomerase vs. Ensembl Fly
Match: Tpi (gene:FBgn0086355 transcript:FBtr0085584)

HSP 1 Score: 75.485 bits (184), Expect = 1.073e-15
Identity = 63/243 (25.93%), Postives = 107/243 (44.03%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF + G       Q  +     +L+   LD  NT+VV+     YL   R  LP ++ +A  +     +G    + S   L  D G  WVI+   E R    E++ +  ++  HAL + LK+I C+    +    G+  E   + + +    +KDW  V +A+E      + +T       ++   +R++L   ISK      RI YGG++      E +   DI+G+L+       +F+ IIN
Sbjct:    4 KFCVGGNWKMNGDQKSIAEIAKTLSSAALD-PNTEVVIGCPAIYLMYARNLLPCELGLAGQNAYKVAKGAFTGEISPAMLK-DIGADWVILGHSERRAIFGESDALIAEKAEHALAEGLKVIACIGETLEEREAGKTNEVVARQMCAYAQKIKDWKNVVVAYEPVWAIGTGQTATPDQAQEVHAFLRQWLSDNISKEVSASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIIN 244          
BLAST of Triosephosphate isomerase vs. Ensembl Fly
Match: Tpi (gene:FBgn0086355 transcript:FBtr0085583)

HSP 1 Score: 75.485 bits (184), Expect = 1.073e-15
Identity = 63/243 (25.93%), Postives = 107/243 (44.03%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF + G       Q  +     +L+   LD  NT+VV+     YL   R  LP ++ +A  +     +G    + S   L  D G  WVI+   E R    E++ +  ++  HAL + LK+I C+    +    G+  E   + + +    +KDW  V +A+E      + +T       ++   +R++L   ISK      RI YGG++      E +   DI+G+L+       +F+ IIN
Sbjct:    4 KFCVGGNWKMNGDQKSIAEIAKTLSSAALD-PNTEVVIGCPAIYLMYARNLLPCELGLAGQNAYKVAKGAFTGEISPAMLK-DIGADWVILGHSERRAIFGESDALIAEKAEHALAEGLKVIACIGETLEEREAGKTNEVVARQMCAYAQKIKDWKNVVVAYEPVWAIGTGQTATPDQAQEVHAFLRQWLSDNISKEVSASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIIN 244          
BLAST of Triosephosphate isomerase vs. Ensembl Fly
Match: Tpi (gene:FBgn0086355 transcript:FBtr0085582)

HSP 1 Score: 75.0998 bits (183), Expect = 4.103e-15
Identity = 63/243 (25.93%), Postives = 107/243 (44.03%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF + G       Q  +     +L+   LD  NT+VV+     YL   R  LP ++ +A  +     +G    + S   L  D G  WVI+   E R    E++ +  ++  HAL + LK+I C+    +    G+  E   + + +    +KDW  V +A+E      + +T       ++   +R++L   ISK      RI YGG++      E +   DI+G+L+       +F+ IIN
Sbjct:  105 KFCVGGNWKMNGDQKSIAEIAKTLSSAALD-PNTEVVIGCPAIYLMYARNLLPCELGLAGQNAYKVAKGAFTGEISPAMLK-DIGADWVILGHSERRAIFGESDALIAEKAEHALAEGLKVIACIGETLEEREAGKTNEVVARQMCAYAQKIKDWKNVVVAYEPVWAIGTGQTATPDQAQEVHAFLRQWLSDNISKEVSASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIIN 345          
BLAST of Triosephosphate isomerase vs. Ensembl Zebrafish
Match: tpi1b (triosephosphate isomerase 1b [Source:NCBI gene;Acc:560753])

HSP 1 Score: 100.908 bits (250), Expect = 5.413e-25
Identity = 74/244 (30.33%), Postives = 124/244 (50.82%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCL-QALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF + G       +  +E   ++LN   L+  +T+VV      YL   R KL   I++AA +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ HAL+  L +I C+ + L +      E   + +T K I  NVKDWSKV +A+E      + KT       ++   +R++LKT +S+A     RI+YGG++    C E ++ +D++G+L+       +FI IIN
Sbjct:    5 KFFVGGNWKMNGDKKSIEELANTLNSAKLN-PDTEVVCGAPTIYLDYARSKLNPNIDVAAQNCYKVAKGAFTGEISPAMIK-DCGVKWVILGHSERRHVFGESDELIGQKVAHALENGLGVIACIGEKLDEREAGITEKVVFAQT-KFIADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHDKLRQWLKTNVSEAVANSVRIIYGGSVTGGTCKELASQKDLDGFLVGGASLKPEFIDIIN 245          
BLAST of Triosephosphate isomerase vs. Ensembl Zebrafish
Match: tpi1b (triosephosphate isomerase 1b [Source:NCBI gene;Acc:560753])

HSP 1 Score: 100.908 bits (250), Expect = 5.413e-25
Identity = 74/244 (30.33%), Postives = 124/244 (50.82%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCL-QALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF + G       +  +E   ++LN   L+  +T+VV      YL   R KL   I++AA +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ HAL+  L +I C+ + L +      E   + +T K I  NVKDWSKV +A+E      + KT       ++   +R++LKT +S+A     RI+YGG++    C E ++ +D++G+L+       +FI IIN
Sbjct:    5 KFFVGGNWKMNGDKKSIEELANTLNSAKLN-PDTEVVCGAPTIYLDYARSKLNPNIDVAAQNCYKVAKGAFTGEISPAMIK-DCGVKWVILGHSERRHVFGESDELIGQKVAHALENGLGVIACIGEKLDEREAGITEKVVFAQT-KFIADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHDKLRQWLKTNVSEAVANSVRIIYGGSVTGGTCKELASQKDLDGFLVGGASLKPEFIDIIN 245          
BLAST of Triosephosphate isomerase vs. Ensembl Zebrafish
Match: tpi1b (triosephosphate isomerase 1b [Source:NCBI gene;Acc:560753])

HSP 1 Score: 100.138 bits (248), Expect = 1.041e-24
Identity = 73/244 (29.92%), Postives = 124/244 (50.82%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCL-QALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            +F + G       +  +E   ++LN   L+  +T+VV      YL   R KL   I++AA +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ HAL+  L +I C+ + L +      E   + +T K I  NVKDWSKV +A+E      + KT       ++   +R++LKT +S+A     RI+YGG++    C E ++ +D++G+L+       +FI IIN
Sbjct:    3 RFFVGGNWKMNGDKKSIEELANTLNSAKLN-PDTEVVCGAPTIYLDYARSKLNPNIDVAAQNCYKVAKGAFTGEISPAMIK-DCGVKWVILGHSERRHVFGESDELIGQKVAHALENGLGVIACIGEKLDEREAGITEKVVFAQT-KFIADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHDKLRQWLKTNVSEAVANSVRIIYGGSVTGGTCKELASQKDLDGFLVGGASLKPEFIDIIN 243          
BLAST of Triosephosphate isomerase vs. Ensembl Zebrafish
Match: tpi1a (triosephosphate isomerase 1a [Source:NCBI gene;Acc:192309])

HSP 1 Score: 100.138 bits (248), Expect = 1.107e-24
Identity = 69/243 (28.40%), Postives = 117/243 (48.15%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF + G       +  +   I +LN   L+   TDVV      YL   R KL ++I +AA +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ H L+ DL +I C+    +    G   +   +  K I  NVKDW++V +A+E      + KT       ++ + +R +L+  +S A     RI+YGG++    C E +A  D++G+L+       +F+ IIN
Sbjct:    5 KFFVGGNWKMNGDKESLGELIMTLNTASLN-DETDVVCGAPSIYLDYARSKLDQRIGVAAQNCYKVPKGAFTGEISPAMIK-DCGIDWVILGHSERRHVFGESDELIGQKVAHCLESDLGVIACIGEKLEEREAGTTEDVVFEQTKVIADNVKDWTRVVLAYEPVWAIGTGKTASPEQAQEVHEKLRGWLRANVSDAVADSVRIIYGGSVTGGNCKELAAQADVDGFLVGGASLKPEFVDIIN 245          
BLAST of Triosephosphate isomerase vs. Ensembl Zebrafish
Match: tpi1b (triosephosphate isomerase 1b [Source:NCBI gene;Acc:560753])

HSP 1 Score: 64.6994 bits (156), Expect = 4.859e-12
Identity = 51/164 (31.10%), Postives = 82/164 (50.00%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCL-QALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE 570
            KF + G       +  +E   ++LN   L+  +T+VV      YL   R KL   I++AA +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ HAL+  L +I C+ + L +      E   + +T K I  NVKDWSKV +A+E
Sbjct:   12 KFFVGGNWKMNGDKKSIEELANTLNSAKLN-PDTEVVCGAPTIYLDYARSKLNPNIDVAAQNCYKVAKGAFTGEISPAMIK-DCGVKWVILGHSERRHVFGESDELIGQKVAHALENGLGVIACIGEKLDEREAGITEKVVFAQT-KFIADNVKDWSKVVLAYE 172          
BLAST of Triosephosphate isomerase vs. Ensembl Xenopus
Match: tpi1 (triosephosphate isomerase 1 [Source:NCBI gene;Acc:100038162])

HSP 1 Score: 108.227 bits (269), Expect = 1.745e-27
Identity = 74/248 (29.84%), Postives = 122/248 (49.19%), Query Frame = 1
Query:   82 MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            M    KF + G       +  +   I++LN G +   +T+VV      YL   RQKL  K  ++A +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ HAL +++ +I C+         G   +   +  K+I  NVKDWSKV +A+E      + KT       ++ K +R++LKT +S+   +  RI+YGG++    C E  A  DI+G+L+       +FI IIN
Sbjct:    1 MATGGKFFVGGNWKMNGDKKSLTELINTLNSGKIS-ADTEVVCGAPTIYLDFARQKLDAKFAVSAQNCYKVAKGAFTGEISPAMIK-DCGATWVILGHSERRHVFGESDELIGQKVAHALSENVGVIGCIGEKLDQREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPEQAQEVHKKLREWLKTNVSEDVAKSVRIIYGGSVTGGTCKELGAQPDIDGFLVGGASLKPEFIDIIN 246          
BLAST of Triosephosphate isomerase vs. Ensembl Xenopus
Match: tpi1 (triosephosphate isomerase 1 [Source:NCBI gene;Acc:100038162])

HSP 1 Score: 105.531 bits (262), Expect = 1.517e-26
Identity = 73/243 (30.04%), Postives = 121/243 (49.79%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF + G       +  +   I++LN G +   +T+VV      YL   RQKL  K  ++A +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ HAL +++ +I C+         G   +   +  K+I  NVKDWSKV +A+E      + KT       ++ K +R++LKT +S+   +  RI+YGG++    C E  A  DI+G+L+       +FI IIN
Sbjct:   11 KFFVGGNWKMNGDKKSLTELINTLNSGKIS-ADTEVVCGAPTIYLDFARQKLDAKFAVSAQNCYKVAKGAFTGEISPAMIK-DCGATWVILGHSERRHVFGESDELIGQKVAHALSENVGVIGCIGEKLDQREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPEQAQEVHKKLREWLKTNVSEDVAKSVRIIYGGSVTGGTCKELGAQPDIDGFLVGGASLKPEFIDIIN 251          
BLAST of Triosephosphate isomerase vs. Ensembl Xenopus
Match: tpi1 (triosephosphate isomerase 1 [Source:NCBI gene;Acc:100038162])

HSP 1 Score: 105.531 bits (262), Expect = 2.248e-26
Identity = 73/243 (30.04%), Postives = 121/243 (49.79%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF + G       +  +   I++LN G +   +T+VV      YL   RQKL  K  ++A +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ HAL +++ +I C+         G   +   +  K+I  NVKDWSKV +A+E      + KT       ++ K +R++LKT +S+   +  RI+YGG++    C E  A  DI+G+L+       +FI IIN
Sbjct:   25 KFFVGGNWKMNGDKKSLTELINTLNSGKIS-ADTEVVCGAPTIYLDFARQKLDAKFAVSAQNCYKVAKGAFTGEISPAMIK-DCGATWVILGHSERRHVFGESDELIGQKVAHALSENVGVIGCIGEKLDQREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPEQAQEVHKKLREWLKTNVSEDVAKSVRIIYGGSVTGGTCKELGAQPDIDGFLVGGASLKPEFIDIIN 265          
BLAST of Triosephosphate isomerase vs. Ensembl Mouse
Match: Tpi1 (triosephosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:98797])

HSP 1 Score: 100.138 bits (248), Expect = 3.531e-24
Identity = 72/251 (28.69%), Postives = 120/251 (47.81%), Query Frame = 1
Query:   73 PPAMENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            P  M    KF + G      R+  +   I +LN   +    T+VV AP   Y+   RQKL  KI +AA +C   T G    + S   +  D G  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ ++    +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:   48 PGTMAPTRKFFVGGNWKMNGRKKCLGELICTLNAANVP-AGTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIK-DLGATWVVLGHSERRHVFGESDELIGQKVSHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVNDGVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 296          
BLAST of Triosephosphate isomerase vs. Ensembl Mouse
Match: Tpi1 (triosephosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:98797])

HSP 1 Score: 73.559 bits (179), Expect = 1.456e-15
Identity = 43/156 (27.56%), Postives = 80/156 (51.28%), Query Frame = 1
Query:  352 WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ ++    +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:    9 WVVLGHSERRHVFGESDELIGQKVSHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVNDGVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 164          
BLAST of Triosephosphate isomerase vs. UniProt/SwissProt
Match: sp|P00939|TPIS_RABIT (Triosephosphate isomerase OS=Oryctolagus cuniculus OX=9986 GN=TPI1 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.591e-28
Identity = 76/251 (30.28%), Postives = 125/251 (49.80%), Query Frame = 1
Query:   73 PPAMENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            P AM    KF + G      R+ ++   I +LN   +   +T+VV AP   Y+   RQKL  KI +AA +C   T G    + S   +  DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ +S A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:   37 PSAMAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVP-ADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIK-DCGATWVVLGHSERRHVFGESDELIGQKVAHALSEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 285          
BLAST of Triosephosphate isomerase vs. UniProt/SwissProt
Match: sp|P15426|TPIS_MACMU (Triosephosphate isomerase OS=Macaca mulatta OX=9544 GN=TPI1 PE=3 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 1.060e-27
Identity = 74/248 (29.84%), Postives = 124/248 (50.00%), Query Frame = 1
Query:   82 MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            M    KF + G      R+ ++   I +LN   +   +T+VV AP   Y+   RQKL  KI +AA +C   T G    + S   +  DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ +S+A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:    1 MAPSRKFFVGGNWKMNGRKQNLGELIGTLNAAKVP-ADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIK-DCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSEAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 246          
BLAST of Triosephosphate isomerase vs. UniProt/SwissProt
Match: sp|Q60HC9|TPIS_MACFA (Triosephosphate isomerase OS=Macaca fascicularis OX=9541 GN=TPI1 PE=2 SV=3)

HSP 1 Score: 110.538 bits (275), Expect = 1.060e-27
Identity = 74/248 (29.84%), Postives = 124/248 (50.00%), Query Frame = 1
Query:   82 MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            M    KF + G      R+ ++   I +LN   +   +T+VV AP   Y+   RQKL  KI +AA +C   T G    + S   +  DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ +S+A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:    1 MAPSRKFFVGGNWKMNGRKQNLGELIGTLNAAKVP-ADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIK-DCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSEAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 246          
BLAST of Triosephosphate isomerase vs. UniProt/SwissProt
Match: sp|P60174|TPIS_HUMAN (Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3)

HSP 1 Score: 111.309 bits (277), Expect = 1.375e-27
Identity = 75/249 (30.12%), Postives = 123/249 (49.40%), Query Frame = 1
Query:   79 AMENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            AM    KF + G      R+  +   I +LN   +   +T+VV AP   Y+   RQKL  KI +AA +C   T G    + S   +  DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ +S A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:   37 AMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVP-ADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIK-DCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 283          
BLAST of Triosephosphate isomerase vs. UniProt/SwissProt
Match: sp|P54714|TPIS_CANLF (Triosephosphate isomerase OS=Canis lupus familiaris OX=9615 GN=TPI1 PE=1 SV=3)

HSP 1 Score: 110.153 bits (274), Expect = 1.595e-27
Identity = 74/248 (29.84%), Postives = 123/248 (49.60%), Query Frame = 1
Query:   82 MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            M    KF + G      R+ ++   I +LN   +   +T+VV AP   Y+   RQKL  KI +AA +C   T G    + S   +  DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ +S A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:    1 MAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVP-ADTEVVCAPPTAYIDFARQKLDAKIAVAAQNCYKVTNGAFTGEISPGMIK-DCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 246          
BLAST of Triosephosphate isomerase vs. TrEMBL
Match: A0A369RU84 (Triosephosphate isomerase OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_010752 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.015e-30
Identity = 76/243 (31.28%), Postives = 129/243 (53.09%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWD--CGWVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF++ G       +  ++  I  L +GPL+ ++T+VV+ P   YL   ++ LP K+ IAA +C   ++G    + S + +A D  C WVI+   E R    E ++I  K++ HAL   LK+I C+  L     +G   +  ++ +K+I  N+ DWSKV IA+E      + KT       ++   +R +LK  IS +    CRI+YGG++N   C + +   D++G+L+       DF++I+N
Sbjct:    5 KFIVGGNWKMNGSRESIDGIIQFLKQGPLN-ESTEVVVGPPFVYLSYVKENLPDKVSIAAQNCYYASKGAFTGEISAE-MAVDIGCEWVILGHSERRNVFGETDEIIGKKVAHALTSGLKVIACIGELLSEREEGRTFDVLSRQIKAIADNISDWSKVVIAYEPVWAIGTGKTATPQQAQQVHLQLRNWLKEHISDSVAASCRIMYGGSVNAGNCKDLAVQPDVDGFLVGGASLKPDFVQIVN 245          
BLAST of Triosephosphate isomerase vs. TrEMBL
Match: B3SCI7 (Triosephosphate isomerase OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_38509 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.015e-30
Identity = 76/243 (31.28%), Postives = 129/243 (53.09%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWD--CGWVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF++ G       +  ++  I  L +GPL+ ++T+VV+ P   YL   ++ LP K+ IAA +C   ++G    + S + +A D  C WVI+   E R    E ++I  K++ HAL   LK+I C+  L     +G   +  ++ +K+I  N+ DWSKV IA+E      + KT       ++   +R +LK  IS +    CRI+YGG++N   C + +   D++G+L+       DF++I+N
Sbjct:    5 KFIVGGNWKMNGSRESIDGIIQFLKQGPLN-ESTEVVVGPPFVYLSYVKENLPDKVSIAAQNCYYASKGAFTGEISAE-MAVDIGCEWVILGHSERRNVFGETDEIIGKKVAHALTSGLKVIACIGELLSEREEGRTFDVLSRQIKAIADNISDWSKVVIAYEPVWAIGTGKTATPQQAQQVHLQLRNWLKEHISDSVAASCRIMYGGSVNAGNCKDLAVQPDVDGFLVGGASLKPDFVQIVN 245          
BLAST of Triosephosphate isomerase vs. TrEMBL
Match: D7F1Q0 (Triosephosphate isomerase OS=Crangon crangon OX=491138 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.036e-27
Identity = 73/248 (29.44%), Postives = 122/248 (49.19%), Query Frame = 1
Query:   82 MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            M    KF + G       +  ++  +D + +GPL+  NT+VV+   +CYL   R+KLP +I +AA +C    +G    + S   +  DCG  WVI+   E R    E + + ++++ HAL+  LK+I C+             E     +K++  N+ DWS+V IA+E      + KT        +   +R++L   +S      CRI+YGG+++   C E +   DI+G+L+       DF+ IIN
Sbjct:    1 MSGSRKFFVGGNWKMNGDKAAIDGIVDFMKKGPLN-PNTEVVVGCPQCYLSYTREKLPAEIGVAAQNCYKVAKGAFTGEIS-PAMVKDCGCEWVILGHSERRNVFNEPDQLISEKVGHALEAGLKVIPCIGEKLDERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTASPEQAQDVHAKLRQWLTENVSAEVAESCRIIYGGSVSPSNCAELAKMGDIDGFLVGGASLKPDFVTIIN 246          
BLAST of Triosephosphate isomerase vs. TrEMBL
Match: A0A3R7QX74 (Triosephosphate isomerase OS=Penaeus vannamei OX=6689 GN=C7M84_025338 PE=3 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 6.575e-27
Identity = 74/254 (29.13%), Postives = 124/254 (48.82%), Query Frame = 1
Query:   73 PPAMENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE---CSVKTIDVVN--IGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIINIIR 804
            P  M +  KF ++G     + +N +   +  +N+  LD  NT+ V+    CYL   R+ L   I +AA +C     GN   + S + +  DCG  WVI+   E R    E +    +++ HA +  +KII CL    +   +G   E   K LKS+   ++DWS+V +AFE    S   +   N  + + +  +R +L+  +S+      R+LY G++N   C E +A +D++G+L+       D + IIN  R
Sbjct:   73 PNTMSSPRKFFVIGNWKMNVDKNRINGIVKMMNKAALD-PNTEAVVGCPSCYLSHAREHLSPSIGVAAQNCYKVARGNFSGEISPEMIK-DCGCDWVILGHPERRTIFSEPDSFIAEKVAHAQEAGMKIIACLCETTEDRKEGRTKEVLFKQLKSLAGAIRDWSRVVLAFEALWASNTGVFATNQQVQEALALVRDWLRNNVSEKVADTTRLLYAGSVNSGNCREMAALKDLDGFLVGSAALKPDIVDIINARR 324          
BLAST of Triosephosphate isomerase vs. TrEMBL
Match: A0A1S3AM12 (Triosephosphate isomerase OS=Erinaceus europaeus OX=9365 GN=TPI1 PE=3 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 8.009e-27
Identity = 78/249 (31.33%), Postives = 126/249 (50.60%), Query Frame = 1
Query:   79 AMENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            AM    KF + G      R+N++   I++LN   L   +T+VV AP   Y+   RQKL  KI +AA +C   T G    + S   +  DCG  WV++   E R    E++++  +++ HAL + L +I C+         G   +   +  K I  NVKDWSKV +A+E      + KT       ++ + +R +LK+ IS A  +  RI+YGG++    C E ++  D++G+L+       +F+ IIN
Sbjct:   37 AMAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKLP-ADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIK-DCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNISDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIIN 283          
BLAST of Triosephosphate isomerase vs. Ensembl Cavefish
Match: tpi1b (triosephosphate isomerase 1 [Source:NCBI gene;Acc:103043519])

HSP 1 Score: 102.449 bits (254), Expect = 1.279e-25
Identity = 72/244 (29.51%), Postives = 122/244 (50.00%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCL-QALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF + G       +  +   I++LN   +   + DVV      YL   R KL  KI +AA +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ HAL+  L +I C+ + L +      E   + +T K+I  NVKDWSKV +A+E      + KT       ++   +R+++KT +S+A     RI+YGG++    C E  + +D++G+L+       +F+ IIN
Sbjct:    4 KFFVGGNWKMNGDKKSLGELINTLNSAKIS-GDVDVVCGAPTIYLDFARSKLDAKIGVAAQNCYKVAKGAFTGEISPAMIK-DCGVEWVILGHSERRHVFGESDELIGQKVAHALESGLGVIACIGEKLDEREAGITEKVVFAQT-KAIADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHDKLRQWMKTNVSEAVANSVRIIYGGSVTGGTCKELGSQKDVDGFLVGGASLKPEFVDIIN 244          
BLAST of Triosephosphate isomerase vs. Ensembl Cavefish
Match: tpi1a (triosephosphate isomerase A [Source:NCBI gene;Acc:103040446])

HSP 1 Score: 98.9821 bits (245), Expect = 2.310e-24
Identity = 69/243 (28.40%), Postives = 117/243 (48.15%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            +F + G       ++ +   I +LN   L+ + T+VV      YL   R  L  KI +AA +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ HAL+ DL +I C+    +    G   E   +  + I  NV DWSKV +A+E      + KT       ++ + +R +++  IS+      RI+YGG++    C E +A  D++G+L+       +FI IIN
Sbjct:    5 RFFVGGNWKMNGSKDTLGELITTLNTASLN-EETEVVCGAPSIYLDYARSNLDPKIGVAAQNCYKVAKGAFTGEISPAMIK-DCGVDWVILGHSERRHVFGEDDELIGQKVAHALESDLGVIACIGEKLEEREAGTTEEVVFEQTRVIADNVSDWSKVVLAYEPVWAIGTGKTATPEQAQEVHEKLRAWMRENISEDVADSVRIIYGGSVTGGNCKELAAQADVDGFLVGGASLKPEFIDIIN 245          
BLAST of Triosephosphate isomerase vs. Ensembl Cavefish
Match: tpi1a (triosephosphate isomerase A [Source:NCBI gene;Acc:103040446])

HSP 1 Score: 98.9821 bits (245), Expect = 5.955e-24
Identity = 70/249 (28.11%), Postives = 119/249 (47.79%), Query Frame = 1
Query:   79 AMENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            A+    +F + G       ++ +   I +LN   L+ + T+VV      YL   R  L  KI +AA +C    +G    + S   +  DCG  WVI+   E R    E++++  +++ HAL+ DL +I C+    +    G   E   +  + I  NV DWSKV +A+E      + KT       ++ + +R +++  IS+      RI+YGG++    C E +A  D++G+L+       +FI IIN
Sbjct:   36 AVMASRRFFVGGNWKMNGSKDTLGELITTLNTASLN-EETEVVCGAPSIYLDYARSNLDPKIGVAAQNCYKVAKGAFTGEISPAMIK-DCGVDWVILGHSERRHVFGEDDELIGQKVAHALESDLGVIACIGEKLEEREAGTTEEVVFEQTRVIADNVSDWSKVVLAYEPVWAIGTGKTATPEQAQEVHEKLRAWMRENISEDVADSVRIIYGGSVTGGNCKELAAQADVDGFLVGGASLKPEFIDIIN 282          
BLAST of Triosephosphate isomerase vs. Ensembl Sea Lamprey
Match: TPI1 (triosephosphate isomerase 1 [Source:HGNC Symbol;Acc:HGNC:12009])

HSP 1 Score: 106.686 bits (265), Expect = 8.096e-28
Identity = 73/248 (29.44%), Postives = 117/248 (47.18%), Query Frame = 1
Query:   82 MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            M    KF + G       +  +    +S+N+  LD  NT++V      Y+   RQKL  KI +AA +C    +G    + S   +  DCG  WVI+   E R    E +++  +++ HAL + L +I C+         G   +      K I  NVKDWSKV +A+E      + KT       ++ + +R +LK  +S+A     RI+YGG++    C E +   D++G+L+       +FI IIN
Sbjct:    1 MAPSRKFFVGGNWKLNGDKASLGALAESMNKASLD-PNTEIVCGAPAIYIDFARQKLDPKIGVAAQNCYKLAKGAFTGEISPAMIK-DCGAHWVILGHSERRHVFGETDELIGQKVAHALSEGLGVIACIGEKLDEREAGVTEKVVFDQTKHIADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHEKLRHWLKKHVSEAVANSTRIIYGGSVTASNCKELAGMADLDGFLVGGASLKPEFIDIIN 246          
BLAST of Triosephosphate isomerase vs. Ensembl Yeast
Match: TPI1 (Triose phosphate isomerase, abundant glycolytic enzyme; mRNA half-life is regulated by iron availability; transcription is controlled by activators Reb1p, Gcr1p, and Rap1p through binding sites in the 5' non-coding region; inhibition of Tpi1p activity by PEP (phosphoenolpyruvate) stimulates redox metabolism in respiring cells; E104D mutation in human homolog TPI1 causes a rare autosomal disease; human TPI1 can complement yeast null mutant [Source:SGD;Acc:S000002457])

HSP 1 Score: 75.0998 bits (183), Expect = 1.736e-16
Identity = 61/248 (24.60%), Postives = 108/248 (43.55%), Query Frame = 1
Query:  100 FLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNY--TEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFECSVKTIDVVNIG---------KIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            F + G       +  ++  ++ LN   +  +N +VV+ P   YL  +   L +K ++   + N Y    G    + S+D +  D G  WVI+   E R    E++     +   AL + + +I C+    +    G+ L+   + L ++   VKDW+ V +A+E     +  +  G          I   IRKFL + +   A  + RILYGG+ N           D++G+L+       +F+ IIN
Sbjct:    5 FFVGGNFKLNGSKQSIKEIVERLNTASIP-ENVEVVICPPATYLD-YSVSLVKKPQVTVGAQNAYLKASGAFTGENSVDQIK-DVGAKWVILGHSERRSYFHEDDKFIADKTKFALGQGVGVILCIGETLEEKKAGKTLDVVERQLNAVLEEVKDWTNVVVAYE----PVWAIGTGLAATPEDAQDIHASIRKFLASKLGDKAASELRILYGGSANGSNAVTFKDKADVDGFLVGGASLKPEFVDIIN 245          
BLAST of Triosephosphate isomerase vs. Ensembl Nematostella
Match: EDO41453 (Triosephosphate isomerase [Source:UniProtKB/TrEMBL;Acc:A7S4D2])

HSP 1 Score: 102.449 bits (254), Expect = 5.400e-26
Identity = 62/210 (29.52%), Postives = 106/210 (50.48%), Query Frame = 1
Query:  193 NTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLA-WDCGWVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            +T++V++P   YL   R+   + I +AA +C     G    + S   +    C WVII   E R    E +++  +++ HAL  ++K+I C+  L      G+  E   + +K+I   + DWSKV IA+E      + KT       ++   +R +LK  +S       RI+YGG++N K C E +A  DI+G+L+       +F++I+N
Sbjct:   35 DTEIVVSPPALYLSYVRKAAKQNIGVAAQNCYKVASGAFTGEISPAMIKDIGCEWVIIGHSERRNIFGEKDELIGEKVAHALSANVKVIACIGELLSEREAGKTQEVVFRQIKAIADKISDWSKVVIAYEPVWAIGTGKTATPQQAQEVHNQLRAWLKENVSVDVAESTRIIYGGSVNAKNCRELAAEGDIDGFLVGGASLKPEFVQIVN 244          
BLAST of Triosephosphate isomerase vs. Ensembl Medaka
Match: tpi1b (triosephosphate isomerase 1 [Source:NCBI gene;Acc:100049499])

HSP 1 Score: 102.449 bits (254), Expect = 1.311e-25
Identity = 76/252 (30.16%), Postives = 124/252 (49.21%), Query Frame = 1
Query:   97 KFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHR---IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTK--TLKSIFS-------NVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            KF + G       +  +   I +LN G +D  N +VV      YL   R KL  K  +AA +C    +G    + S   +  DCG  WVI+   E R    E++++  ++  HAL+  L +I C+         GE+L+      T K +FS       NVKDWSKV +A+E      + KT       ++ + +R++LK+ +S+A     RI+YGG++    C E ++ +D++G+L+       +FI+IIN
Sbjct:    4 KFFVGGNWKMNGDKKSLGELIQTLNAGKVD-PNVEVVCGAPSIYLDFVRSKLDPKFGVAAQNCYKVPKGAFTGEISPAMIK-DCGVNWVILGHSERRHVFGESDELIGQKTAHALESGLGVIACI---------GEKLDEREGGITEKVVFSQTKFIADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHEKLREWLKSNVSEAVANSVRIIYGGSVTGGTCKELASQKDVDGFLVGGASLKPEFIEIIN 244          
BLAST of Triosephosphate isomerase vs. Ensembl Medaka
Match: tpi1a (triosephosphate isomerase [Source:NCBI gene;Acc:101165489])

HSP 1 Score: 101.293 bits (251), Expect = 3.105e-25
Identity = 68/245 (27.76%), Postives = 117/245 (47.76%), Query Frame = 1
Query:   91 KSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            + +F + G       +  +E  + +LN   L +++T+VV A    YL   R  L  +I +AA +C    +G    + S   +  DCG  WVI+   E R    EN+++  +++ HAL+ DL +I C+    +    G   E      + I  NV DW KV +A+E      + KT       ++ + +R + +  IS+      RI+YGG++    C E ++  D++G+L+       +FI IIN
Sbjct:    3 QRRFFVGGNWKMNGNKESLEELMSTLNTASL-HEDTEVVCAAPSIYLDFARSGLDSRISVAAQNCYKVAKGAFTGEISPAMIK-DCGADWVILGHSERRHVFGENDELIGQKVAHALESDLGVIACIGEKLEEREAGTTEEVIFAQTQVIAENVMDWEKVVLAYEPVWAIGTGKTATPEQAQEVHEKLRAWFRANISEEVSDSLRIIYGGSVTAANCRELASQTDVDGFLVGGASLKPEFIDIIN 245          
BLAST of Triosephosphate isomerase vs. Ensembl Medaka
Match: tpi1a (triosephosphate isomerase [Source:NCBI gene;Acc:101165489])

HSP 1 Score: 90.5077 bits (223), Expect = 3.043e-21
Identity = 61/210 (29.05%), Postives = 100/210 (47.62%), Query Frame = 1
Query:  196 TDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCG--WVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
             +VV A    YL   R  L  +I +AA +C    +G    + S   +  DCG  WVI+   E R    EN+++  +++ HAL+ DL +I C+    +    G   E      + I  NV DW KV +A+E      + KT       ++ + +R + +  IS+      RI+YGG++    C E ++  D++G+L+       +FI IIN
Sbjct:   29 AEVVCAAPSIYLDFARSGLDSRISVAAQNCYKVAKGAFTGEISPAMIK-DCGADWVILGHSERRHVFGENDELIGQKVAHALESDLGVIACIGEKLEEREAGTTEEVIFAQTQVIAENVMDWEKVVLAYEPVWAIGTGKTATPEQAQEVHEKLRAWFRANISEEVSDSLRIIYGGSVTAANCRELASQTDVDGFLVGGASLKPEFIDIIN 237          
BLAST of Triosephosphate isomerase vs. Planmine SMEST
Match: SMESG000069339.1 (SMESG000069339.1)

HSP 1 Score: 498.049 bits (1281), Expect = 0.000e+0
Identity = 243/243 (100.00%), Postives = 243/243 (100.00%), Query Frame = 1
Query:   82 MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCGWVIINSKEHRIENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFECSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIINIIRDS 810
            MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCGWVIINSKEHRIENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFECSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIINIIRDS
Sbjct:    1 MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCGWVIINSKEHRIENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFECSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIINIIRDS 243          
BLAST of Triosephosphate isomerase vs. Planmine SMEST
Match: SMESG000027305.1 (SMESG000027305.1)

HSP 1 Score: 108.997 bits (271), Expect = 3.586e-28
Identity = 75/250 (30.00%), Postives = 125/250 (50.00%), Query Frame = 1
Query:   82 MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYLGIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSI----DTLAWDCGWVIINSKEHRI---ENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFSNVKDWSKVAIAFE-----CSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRILYGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIIN 795
            M    KF + G       ++++     SL    L ++ T+VV++P   YL   R KLP KI +AA +C    +G    + S     DT+   C WVI+   E R    E++ +  +++ HAL+  L +I C+    +     +  E   + LK I +N+K+WS V IA+E      + +T       ++ K IR +LKT +S+   +  RILYGG++    C E ++  D++G+L+       +FI+IIN
Sbjct:    1 MSESRKFFVGGNWKMNGDKSEITKICTSLMNAKL-HETTEVVVSPPTLYLDFVRSKLPAKIGVAAQNCYKTAKGAFTGEISPAMIKDTM---CDWVILGHSERRHIFGESDKLVGEKVKHALESGLSVIPCIGEKLEERENNKTNEVCFRQLKEIAANIKEWSHVVIAYEPVWAIGTGRTATPDQAQEVHKAIRDWLKTNVSEQVAKTTRILYGGSVTSGNCKELASQPDVDGFLVGGASLKPEFIEIIN 246          
The following BLAST results are available for this feature:
BLAST of Triosephosphate isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPI12.864e-2830.12triosephosphate isomerase 1 [Source:HGNC Symbol;Ac... [more]
TPI12.864e-2830.12triosephosphate isomerase 1 [Source:HGNC Symbol;Ac... [more]
TPI15.155e-2829.84triosephosphate isomerase 1 [Source:HGNC Symbol;Ac... [more]
TPI18.588e-1829.81triosephosphate isomerase 1 [Source:HGNC Symbol;Ac... [more]
TPI18.588e-1829.81triosephosphate isomerase 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Triosephosphate isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tpi-12.911e-2128.90Triosephosphate isomerase [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Triosephosphate isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tpi1.073e-1525.93gene:FBgn0086355 transcript:FBtr0085584[more]
Tpi1.073e-1525.93gene:FBgn0086355 transcript:FBtr0085583[more]
Tpi4.103e-1525.93gene:FBgn0086355 transcript:FBtr0085582[more]
back to top
BLAST of Triosephosphate isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpi1b5.413e-2530.33triosephosphate isomerase 1b [Source:NCBI gene;Acc... [more]
tpi1b5.413e-2530.33triosephosphate isomerase 1b [Source:NCBI gene;Acc... [more]
tpi1b1.041e-2429.92triosephosphate isomerase 1b [Source:NCBI gene;Acc... [more]
tpi1a1.107e-2428.40triosephosphate isomerase 1a [Source:NCBI gene;Acc... [more]
tpi1b4.859e-1231.10triosephosphate isomerase 1b [Source:NCBI gene;Acc... [more]
back to top
BLAST of Triosephosphate isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tpi11.745e-2729.84triosephosphate isomerase 1 [Source:NCBI gene;Acc:... [more]
tpi11.517e-2630.04triosephosphate isomerase 1 [Source:NCBI gene;Acc:... [more]
tpi12.248e-2630.04triosephosphate isomerase 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Triosephosphate isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tpi13.531e-2428.69triosephosphate isomerase 1 [Source:MGI Symbol;Acc... [more]
Tpi11.456e-1527.56triosephosphate isomerase 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Triosephosphate isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00939|TPIS_RABIT1.591e-2830.28Triosephosphate isomerase OS=Oryctolagus cuniculus... [more]
sp|P15426|TPIS_MACMU1.060e-2729.84Triosephosphate isomerase OS=Macaca mulatta OX=954... [more]
sp|Q60HC9|TPIS_MACFA1.060e-2729.84Triosephosphate isomerase OS=Macaca fascicularis O... [more]
sp|P60174|TPIS_HUMAN1.375e-2730.12Triosephosphate isomerase OS=Homo sapiens OX=9606 ... [more]
sp|P54714|TPIS_CANLF1.595e-2729.84Triosephosphate isomerase OS=Canis lupus familiari... [more]
back to top
BLAST of Triosephosphate isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A369RU841.015e-3031.28Triosephosphate isomerase OS=Trichoplax sp. H2 OX=... [more]
B3SCI71.015e-3031.28Triosephosphate isomerase OS=Trichoplax adhaerens ... [more]
D7F1Q03.036e-2729.44Triosephosphate isomerase OS=Crangon crangon OX=49... [more]
A0A3R7QX746.575e-2729.13Triosephosphate isomerase OS=Penaeus vannamei OX=6... [more]
A0A1S3AM128.009e-2731.33Triosephosphate isomerase OS=Erinaceus europaeus O... [more]
back to top
BLAST of Triosephosphate isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tpi1b1.279e-2529.51triosephosphate isomerase 1 [Source:NCBI gene;Acc:... [more]
tpi1a2.310e-2428.40triosephosphate isomerase A [Source:NCBI gene;Acc:... [more]
tpi1a5.955e-2428.11triosephosphate isomerase A [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Triosephosphate isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TPI18.096e-2829.44triosephosphate isomerase 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Triosephosphate isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TPI11.736e-1624.60Triose phosphate isomerase, abundant glycolytic en... [more]
back to top
BLAST of Triosephosphate isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO414535.400e-2629.52Triosephosphate isomerase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Triosephosphate isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tpi1b1.311e-2530.16triosephosphate isomerase 1 [Source:NCBI gene;Acc:... [more]
tpi1a3.105e-2527.76triosephosphate isomerase [Source:NCBI gene;Acc:10... [more]
tpi1a3.043e-2129.05triosephosphate isomerase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Triosephosphate isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000069339.10.000e+0100.00SMESG000069339.1[more]
SMESG000027305.13.586e-2830.00SMESG000027305.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004273 ID=SMED30004273|Name=Triosephosphate isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=851bp
AAATACTAATGTCATAAATTTTATTTTACTGGATTCAAATTATTTACACA
AATTCAAATGCGCCACTAGTTACCACCAGCAATGGAAAACAAGTCAAAGT
TTCTTATAGTCGGTCGTCTGCCACAATTAATTAGACAAAATGATATGGAA
ATTTTTATAGATTCATTAAACAGGGGCCCTCTTGATTATAAAAACACTGA
CGTGGTTCTGGCACCAGGCAAATGTTATTTGGGAATATTTAGACAAAAGC
TGCCAAGGAAAATTGAAATAGCAGCCCCATCATGTAATAATTATACAGAA
GGGAACCCAGATGAGGATTTCAGCATAGATACTCTCGCCTGGGACTGCGG
CTGGGTAATAATTAATTCAAAAGAACATCGAATAGAAAACGAGGATATCA
CAACTAAGCGGCTTGTTCACGCTTTGAAAAAAGATTTGAAAATAATATTT
TGTTTGCAAGCCTTACCCAAAAGTCCTTTAAAAGGAGAAGAATTAGAGCC
CTATACAAAAACATTGAAATCTATTTTCAGTAATGTTAAAGATTGGTCTA
AGGTAGCGATTGCATTTGAATGTTCAGTGAAAACAATTGACGTTGTCAAT
ATTGGAAAAATAGTAAAAGGTATCAGAAAATTTTTGAAGACTTGTATTTC
CAAAGCAGCTGTTAGGCAATGCAGGATTCTTTATGGAGGCAACATCAATC
ACAAACAATGCTTTGAAGCGTCAGCATTCCAAGATATAAATGGATATTTG
ATCCCAGATTGTCTACACAATGAAGACTTTATCAAAATCATAAATATTAT
TAGAGATTCATAAGATACATTCAAATATATCAACTGACTTTTAAAAAAAA
A
back to top

protein sequence of SMED30004273-orf-1

>SMED30004273-orf-1 ID=SMED30004273-orf-1|Name=SMED30004273-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=244bp
MENKSKFLIVGRLPQLIRQNDMEIFIDSLNRGPLDYKNTDVVLAPGKCYL
GIFRQKLPRKIEIAAPSCNNYTEGNPDEDFSIDTLAWDCGWVIINSKEHR
IENEDITTKRLVHALKKDLKIIFCLQALPKSPLKGEELEPYTKTLKSIFS
NVKDWSKVAIAFECSVKTIDVVNIGKIVKGIRKFLKTCISKAAVRQCRIL
YGGNINHKQCFEASAFQDINGYLIPDCLHNEDFIKIINIIRDS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0006006glucose metabolic process
GO:0007275multicellular organism development
GO:0019242methylglyoxal biosynthetic process
GO:0019682glyceraldehyde-3-phosphate metabolic process
GO:0008152metabolic process
GO:0006094gluconeogenesis
GO:0006096glycolytic process
GO:0006098pentose-phosphate shunt
GO:0019563glycerol catabolic process
GO:0046166glyceraldehyde-3-phosphate biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0008929methylglyoxal synthase activity
GO:0016829lyase activity
GO:0031625ubiquitin protein ligase binding
GO:0042803protein homodimerization activity
GO:0004807triose-phosphate isomerase activity
GO:0003824catalytic activity
GO:0016853isomerase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000419prepharyngeal region
PLANA:0002030early male germ cell
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR035990TIM_sf
IPR000652Triosephosphate_isomerase
IPR013785Aldolase_TIM
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000652Triosephosphate isomerasePFAMPF00121TIMcoord: 20..237
e-value: 7.2E-22
score: 77.9
IPR000652Triosephosphate isomerasePANTHERPTHR21139TRIOSEPHOSPHATE ISOMERASEcoord: 5..238
IPR000652Triosephosphate isomerasePROSITEPS51440TIM_2coord: 6..239
score: 16.527
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 1..240
e-value: 2.2E-28
score: 101.2
NoneNo IPR availablePANTHERPTHR21139:SF2TRIOSEPHOSPHATE ISOMERASEcoord: 5..238
IPR035990Triosephosphate isomerase superfamilySUPERFAMILYSSF51351Triosephosphate isomerase (TIM)coord: 17..239