Actin, cytoplasmic

Overview
NameActin, cytoplasmic
Smed IDSMED30004267
Length (bp)970
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin, cytoplasmic (SMED30004267) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin, cytoplasmic (SMED30004267) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin, cytoplasmic (SMED30004267) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin, cytoplasmic (SMED30004267) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004267

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30004267SMESG000035518.1 dd_Smed_v4_232_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004267SMESG000035518.1 dd_Smed_v6_232_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30004267SMESG000035518.1 dd_Smed_v6_232_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004267SMESG000035518.1 dd_Smed_v6_232_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30004267SMESG000035518.1 dd_Smed_v6_232_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004267SMESG000035518.1 dd_Smed_v4_232_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004267SMESG000035518.1 dd_Smed_v4_232_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 265/294 (90.14%), Postives = 282/294 (95.92%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVIT+GNERFRCPE LFQPSF+G+E AGIHET+YNSIMKCD+DIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   39 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 332          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 265/294 (90.14%), Postives = 282/294 (95.92%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVIT+GNERFRCPE LFQPSF+G+E AGIHET+YNSIMKCD+DIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   39 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 332          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 265/294 (90.14%), Postives = 282/294 (95.92%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVIT+GNERFRCPE LFQPSF+G+E AGIHET+YNSIMKCD+DIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   39 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 332          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 265/294 (90.14%), Postives = 282/294 (95.92%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVIT+GNERFRCPE LFQPSF+G+E AGIHET+YNSIMKCD+DIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   39 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 332          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 265/294 (90.14%), Postives = 282/294 (95.92%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVIT+GNERFRCPE LFQPSF+G+E AGIHET+YNSIMKCD+DIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   39 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 332          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act42A (gene:FBgn0000043 transcript:FBtr0086029)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 282/294 (95.92%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE+LFQPSF+G+E  GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070822)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100662)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0345894)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070823)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEITSLAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEITSLAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEITSLAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEITSLAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEITSLAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: actb (actin, beta [Source:NCBI gene;Acc:407952])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: act3 (actin alpha 4 [Source:NCBI gene;Acc:394673])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 279/294 (94.90%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSF TTAEREIVRDIKEKLAYVAL F+ EM TA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AGIHETTYNSIMKCD+DIRKDLYAN VLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:   97 MEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIQRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLAYVALDFENEMATAATSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 390          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: act3 (actin alpha 4 [Source:NCBI gene;Acc:394673])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 279/294 (94.90%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSF TTAEREIVRDIKEKLAYVAL F+ EM TA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AGIHETTYNSIMKCD+DIRKDLYAN VLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:   84 MEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIQRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLAYVALDFENEMATAATSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: actg1 (actin gamma 1 [Source:NCBI gene;Acc:394957])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: rspry1 (ring finger and SPRY domain containing 1 [Source:Xenbase;Acc:XB-GENE-1002344])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 265/294 (90.14%), Postives = 278/294 (94.56%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSF TTAEREIVRDIKEKL YVAL F+ EM TA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AGIHETTYNSIMKCD+DIRKDLYAN VLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:   84 MEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actc1 (actin, alpha, cardiac muscle 1 [Source:MGI Symbol;Acc:MGI:87905])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 265/294 (90.14%), Postives = 278/294 (94.56%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSF TTAEREIVRDIKEKL YVAL F+ EM TA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AGIHETTYNSIMKCD+DIRKDLYAN VLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:   84 MEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Acta2 (actin, alpha 2, smooth muscle, aorta [Source:MGI Symbol;Acc:MGI:87909])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 264/294 (89.80%), Postives = 278/294 (94.56%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HH+F NEL +APEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSF TTAEREIVRDIKEKL YVAL F+ EM TA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AGIHETTYNSIMKCD+DIRKDLYAN VLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:   84 MEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|P17126|ACT_HYDVU (Actin, non-muscle 6.2 OS=Hydra vulgaris OX=6087 PE=3 SV=1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 272/294 (92.52%), Postives = 286/294 (97.28%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL+YVAL F++EMQTA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMFPGI+DRMQKEI++LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLSYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|P41113|ACT3_PODCA (Actin-3 OS=Podocoryna carnea OX=6096 GN=ACT3 PE=3 SV=1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 272/294 (92.52%), Postives = 285/294 (96.94%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDY+MK+LTERGYSFTTTAEREIVRDIKEKLAYVAL F++EMQTA  SS+LEKSYELPDGQVITIGNERFRCPETLFQP+FIG+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMFPGI+DRMQKEI+SLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIIRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMQTAVTSSSLEKSYELPDGQVITIGNERFRCPETLFQPAFIGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEISSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q964E0|ACTC_BIOTE (Actin, cytoplasmic OS=Biomphalaria tenagophila OX=112528 PE=3 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 273/294 (92.86%), Postives = 284/294 (96.60%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EMQTAS SS+LEKSYELPDGQVITIGNERFRCPE +FQPSF+G+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGI+DRMQKEIT+LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTASTSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMEAAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q964E1|ACTC_BIOOB (Actin, cytoplasmic OS=Biomphalaria obstructa OX=153466 PE=3 SV=1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 273/294 (92.86%), Postives = 284/294 (96.60%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EMQTA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGI+DRMQKEIT+LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTATSSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEAAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q964E3|ACTC_BIOAL (Actin, cytoplasmic OS=Biomphalaria alexandrina OX=50959 PE=3 SV=1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 272/294 (92.52%), Postives = 284/294 (96.60%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EMQTAS SS+LEKSYELPDGQVITIGNERFRCPE +FQPSF+G+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGI+DRMQKEIT+LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTASTSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMEAAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: Q9PTU4 (B-actin OS=Pagrus major OX=143350 PE=2 SV=1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 273/294 (92.86%), Postives = 286/294 (97.28%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL+YVAL F++EMQTA+ SS LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLSYVALDFEQEMQTAAQSSNLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: E5F7D0 (Non-muscle actin II OS=Hydractinia echinata OX=35630 PE=3 SV=1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 273/294 (92.86%), Postives = 286/294 (97.28%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKLAYVAL F++EMQTA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMFPGI+DRMQKEI++LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: B1B560 (Beta actin isoform 1 (Fragment) OS=Solea senegalensis OX=28829 GN=ACTB PE=2 SV=1)

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 270/294 (91.84%), Postives = 287/294 (97.62%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDY+MK+LTERGYSFTTTAEREIVRDIKEKL+YVAL F++EMQTA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AG+HETTYNSIMKCDVDIRKDLYANTVLSGG+TMFPGI+DRMQKEI++LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   56 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAIIRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLSYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGVHETTYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 349          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: A0A3B4X540 (Uncharacterized protein OS=Seriola lalandi dorsalis OX=1841481 PE=3 SV=1)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 271/294 (92.18%), Postives = 286/294 (97.28%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EMQTA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AG+HETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGVHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: A0A3B4TLD9 (Uncharacterized protein OS=Seriola dumerili OX=41447 PE=3 SV=1)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 271/294 (92.18%), Postives = 286/294 (97.28%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EMQTA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AG+HETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGVHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEITSLAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEITSLAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   84 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: actb2 (actin beta [Source:NCBI gene;Acc:103030443])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEITSLAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: zgc:86709 (actin, alpha cardiac muscle 1 [Source:NCBI gene;Acc:103031734])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 265/294 (90.14%), Postives = 278/294 (94.56%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSF TTAEREIVRDIKEKL YVAL F+ EM TA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AGIHETTYNSIMKCD+DIRKDLYAN VLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:   84 MEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: ENSAMXT00000003590.2 (actin, alpha cardiac-like [Source:NCBI gene;Acc:103024089])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 264/294 (89.80%), Postives = 277/294 (94.22%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSF TTAEREIVRDIKEKL YVAL F+ EM TA+ SS+LEKSYELPDGQVITIGNERFRCPETLFQPSFIG+E AGIHET YNSIMKCD+DIRKDLYAN VLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:   84 MEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETAYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004586.1 (pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 gene:ENSPMAG00000004161.1 transcript:ENSPMAT00000004586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 265/294 (90.14%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 265/294 (90.14%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011230.1 (pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1 gene:ENSPMAG00000010203.1 transcript:ENSPMAT00000011230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 362.459 bits (929), Expect = 3.353e-125
Identity = 161/294 (54.76%), Postives = 223/294 (75.85%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            ME+++ H +  EL   P++ PVLLTEAPLNP  NRE+  Q++FE F  PA+++A+QAVLSLYASG  TG+ +  GDGVTH VP++EGY LP A+ R D+AGRD+TD L ++L ERG++F ++AE EIV DIKE++ YVA  +++E++      A++  Y+LPDGQVIT+ ++RFR PE LF P+ +GL+  GIH+  + S+ + D+D+RK LY+N +LSGGS++FPG+ +R+ +E+  LAP    ++I APPERKYSVWIGGSILASLSTFQQMWI+  EY E GP +VHR+C 
Sbjct:   93 MERVWAHAYEAELHARPQDQPVLLTEAPLNPLENREQAAQLLFERFGAPAVHIAVQAVLSLYASGMVTGLAVGVGDGVTHAVPVFEGYGLPRAVLRSDVAGRDVTDNLGRILAERGHAFVSSAEWEIVADIKEQVCYVAGDYEKELRRKPEELAVD--YKLPDGQVITLHSQRFRAPELLFSPTIVGLDAPGIHQLVWKSVTRSDIDLRKSLYSNILLSGGSSLFPGLDERLWQELAKLAPRGAPVRIFAPPERKYSVWIGGSILASLSTFQQMWITAPEYKEFGPSVVHRRCL 384          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ACTG2 (actin gamma 2, smooth muscle [Source:HGNC Symbol;Acc:HGNC:145])

HSP 1 Score: 211.46 bits (537), Expect = 1.085e-69
Identity = 97/116 (83.62%), Postives = 105/116 (90.52%), Query Frame = 2
Query:  536 TLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            T      +G+E AGIHETTYNSIMKCD+DIRKDLYAN VLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:    1 TFVDVCIVGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 116          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003686.1 (pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 gene:ENSPMAG00000003346.1 transcript:ENSPMAT00000003686.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 4.637e-54
Identity = 114/325 (35.08%), Postives = 167/325 (51.38%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEM------------QTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLE-CAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEIT----------------SLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGI 865
            ME+         L   PE+H  LLTE PLN   NRE   +IMFE+FN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ EGY +   I  + +AGRD+T ++ ++L ER          E  + IKE+ +Y+     +E             Q   +++  +K +       I +G ERF  PE  F P F   +    I E   N I  C +D+R+ LY N VLSGGSTMF     R+Q+++                  + P  + +++I    ++Y+VW GGS+LAS   F Q+  +K++Y+E GP I
Sbjct:   86 MERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNIPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKVIKERFSYICPDIVKEFSKFDADPSKWMKQYTGINAITKKEF------TIDVGYERFLGPEIFFHPEFCNPDFTQPISEVVDNVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDSRLKFSEELSGGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSI 404          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 244/294 (82.99%), Postives = 273/294 (92.86%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAP+NPK+NREKMTQIMFETFN PA YV+IQAVLSLY+SGRTTGIVLDSGDGVTH VPIY G++LPHAI R+DLAGRDLTDYLMK+L+ERGYSF+TTAEREIVRDIKEKL YVAL F++EMQTA+ SS++EKSYELPDGQVITIGNERFR PE LF PS +GLE AGI +TTYNSIMKCDVD+RK+LY N V+SGG+TMFPGI++RMQKEIT+LAP +MK+KIIAPPERKYSVWIGGSILASL+TFQQMWISKQEYDESGP IVH KCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ARP2 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity; required for efficient Golgi-to-ER trafficking in COPI mutants [Source:SGD;Acc:S000002187])

HSP 1 Score: 288.5 bits (737), Expect = 3.070e-96
Identity = 143/299 (47.83%), Postives = 201/299 (67.22%), Query Frame = 2
Query:    2 MEKIFHHTF*NELIL-APEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSL-------APPT----MKIKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKQEYDESGP 859
            ME ++ + F  ++ L +     +LLTE P+NP  NREKM ++MFE ++   +YVAIQAVL+LYA G ++G+V+DSGDGVTH VP+YE   L H   RLD+AGRD+T +L+ +L+ RGY+F  TA+ E VR IKEKL YV+   D + + A  ++AL +SYELPDG+ I +G ERF  PE LFQP  + +E  G+ E  +N++   DVDIR  LY   VLSGGS+M+PG+  R++KE+  L         P+     K++I  PP RK+ V+IGG++LAS ++    MW+SKQE+ ESGP
Sbjct:   84 MELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGP 382          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ARP1 (Actin-related protein of the dynactin complex; required for spindle orientation and nuclear migration; forms actin-like short filament composed of 9 or 10 Arp1p monomers; putative ortholog of mammalian centractin [Source:SGD;Acc:S000001171])

HSP 1 Score: 274.633 bits (701), Expect = 6.251e-91
Identity = 138/287 (48.08%), Postives = 195/287 (67.94%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPE--EHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYL-MKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFD-EEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 850
            ME I+ +   NE++      EHP+L+TEAP+NP  NRE+M Q++FETF+  A+YV+  AVLSLYASGRTTG V+D G+G   TVPIY+G+ALP ++ R+D+ G D+T+ L  ++    G S  +++EREIVR +KEK+ Y+A +   EE +    +  L  +++LPDG+ I +GN+R+R PE LF P  IGL   G+ +    SI K D+D+RK L ++ +LSGG+T   G  DRM  ++ +L   T KIKIIAP ERKY+ WIGGSIL  LSTFQ++W  K ++ E
Sbjct:   89 MELIWSYVL-NEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALTKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ARP3 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity [Source:SGD;Acc:S000003826])

HSP 1 Score: 180.644 bits (457), Expect = 8.494e-54
Identity = 117/328 (35.67%), Postives = 182/328 (55.49%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTT--TAEREIVRDIKEKLAYVALSFDEEMQT-----ASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYN-SIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLA--------------PPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF*MFH 895
            ME+ + ++    L   PE+H  LLTE PLNP  NRE++ +I FE+FNC  +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ EGY +  AI  + +AGRD+T ++  +L ERG + T+  TAE+     IK++  YV     +E        +  +  + ++ E    +V+ IG ERF  PE  F P     +      T  + +I  C +D+RK LY N VLSGGSTMF     R+Q+++ S+                  + + +I+  +++ +VW GGS+LA  + F+    +K++Y+E GP IV  + F +F+
Sbjct:  127 MERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAEK-----IKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYGPEIV--RNFSLFN 447          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ARP4 (Nuclear actin-related protein involved in chromatin remodeling; component of chromatin-remodeling enzyme complexes [Source:SGD;Acc:S000003617])

HSP 1 Score: 96.6709 bits (239), Expect = 6.946e-23
Identity = 49/118 (41.53%), Postives = 72/118 (61.02%), Query Frame = 2
Query:  512 NERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 856
            NE  + P    +P     E  G+ +  Y+SIM  DVD+R  L  N VL+GG++  PG+SDR+  E+  +  P++K +I+      ER+Y  W+GGSIL SL TF Q+W+ K+EY+E G
Sbjct:  363 NETGKRPLEEEKPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKIL-PSLKFRILTTGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVG 479          

HSP 2 Score: 56.6102 bits (135), Expect = 1.707e-9
Identity = 53/200 (26.50%), Postives = 79/200 (39.50%), Query Frame = 2
Query:   32 NELILAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVL-----------TERGYSFTTTA--------------EREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNE-RFRCPETLFQP 550
            NEL L      P LLTE   N   NR+K  +++ E     A Y+A  +    +A+GR   +V+D G       PI +G  L  +  R  +AG+ +   + K L            +R   F                   R   ++ KE L ++  +   E     LSS  ++S E P  + I   NE R+   E LF P
Sbjct:   96 NELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQECKETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLP 295          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO38006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEB1])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 270/294 (91.84%), Postives = 284/294 (96.60%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKLAYVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE +FQPSF+G+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGI+DRMQKEI++LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO45013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU31])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 271/294 (92.18%), Postives = 284/294 (96.60%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EMQTA+ SS+LEKSYELPDGQVITIGNERFRCPE +FQPSF+G+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGI+DRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 270/294 (91.84%), Postives = 284/294 (96.60%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM+TA+ SS+LEKSYELPDGQVITIGNERFRCPE +FQPSF+G+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGI+DRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 268/294 (91.16%), Postives = 283/294 (96.26%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE +FQPSF+G+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGI+DRMQKEI++LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO37976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA7])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 262/294 (89.12%), Postives = 282/294 (95.92%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EMQTA+ SS++EKSYELPDGQVITIGNERFRCPE L QPSF+G+E +GIHETTYNSIMKCDVDIRKDLYANTV+SGG+TM+PG++DRMQKEI++LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000021726.2 (actin, cytoplasmic [Source:NCBI gene;Acc:101155523])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 269/294 (91.50%), Postives = 284/294 (96.60%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EMQTA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E AGIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 267/294 (90.82%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   84 MEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000011677.2 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:  117 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 410          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000029375.1 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 266/294 (90.48%), Postives = 281/294 (95.58%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E  GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGI+DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000051672.1 (SMESG000051672.1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 272/294 (92.52%), Postives = 283/294 (96.26%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL Y+AL FD EM+TAS SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+GLE  GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGI+DRMQKEI+SLAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000051670.1 (SMESG000051670.1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 272/294 (92.52%), Postives = 283/294 (96.26%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL Y+AL FD EM+TAS SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+GLE  GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGI+DRMQKEI+SLAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000012317.1 (SMESG000012317.1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 269/294 (91.50%), Postives = 286/294 (97.28%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAICR+DLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL Y+AL F++EMQTA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E AGIHETTYNSIMKCDVDIRKDLY+NTVLSGGSTM+PGI+DRMQKEI++LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYSNTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000012332.1 (SMESG000012332.1)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 268/294 (91.16%), Postives = 284/294 (96.60%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAICR+DLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL Y+AL F++EMQTA+ SS+LEKSYELPDGQVITIGNERFRCPE LFQPSF+G+E AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTM+PGI+DRMQKEI++LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:   82 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000058003.1 (SMESG000058003.1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 270/294 (91.84%), Postives = 284/294 (96.60%), Query Frame = 2
Query:    2 MEKIFHHTF*NELILAPEEHPVLLTEAPLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAYVALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIGLECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 883
            MEKI+HHTF NEL +APEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAI RLDLAGRDLTDYLMK+LTERGYSFTTTAEREIVRDIKEKL YVAL F++EM TA+ SS+LEKSYELPDGQVITIGNERFRCPE+LFQP+F+G+E AGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTMFPGI+DRMQKEITSLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:   83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of Actin, cytoplasmic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTB0.000e+090.48actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTB0.000e+090.48actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTG10.000e+090.48actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+090.48actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+090.48actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
act-40.000e+090.14Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-40.000e+090.14Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-40.000e+090.14Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-40.000e+090.14Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-40.000e+090.14Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Act42A0.000e+090.48gene:FBgn0000043 transcript:FBtr0086029[more]
Act5C0.000e+090.82gene:FBgn0000042 transcript:FBtr0070822[more]
Act5C0.000e+090.82gene:FBgn0000042 transcript:FBtr0100662[more]
Act5C0.000e+090.82gene:FBgn0000042 transcript:FBtr0345894[more]
Act5C0.000e+090.82gene:FBgn0000042 transcript:FBtr0070823[more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb10.000e+090.82actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb10.000e+090.82actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb20.000e+090.82actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb20.000e+090.82actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb20.000e+090.82actin, beta 2 [Source:NCBI gene;Acc:57935][more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb0.000e+090.82actin, beta [Source:NCBI gene;Acc:407952][more]
act30.000e+090.48actin alpha 4 [Source:NCBI gene;Acc:394673][more]
act30.000e+090.48actin alpha 4 [Source:NCBI gene;Acc:394673][more]
actg10.000e+090.48actin gamma 1 [Source:NCBI gene;Acc:394957][more]
rspry10.000e+090.14ring finger and SPRY domain containing 1 [Source:X... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actb0.000e+090.48actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actg10.000e+090.48actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actg10.000e+090.48actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actc10.000e+090.14actin, alpha, cardiac muscle 1 [Source:MGI Symbol;... [more]
Acta20.000e+089.80actin, alpha 2, smooth muscle, aorta [Source:MGI S... [more]
back to top
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17126|ACT_HYDVU0.000e+092.52Actin, non-muscle 6.2 OS=Hydra vulgaris OX=6087 PE... [more]
sp|P41113|ACT3_PODCA0.000e+092.52Actin-3 OS=Podocoryna carnea OX=6096 GN=ACT3 PE=3 ... [more]
sp|Q964E0|ACTC_BIOTE0.000e+092.86Actin, cytoplasmic OS=Biomphalaria tenagophila OX=... [more]
sp|Q964E1|ACTC_BIOOB0.000e+092.86Actin, cytoplasmic OS=Biomphalaria obstructa OX=15... [more]
sp|Q964E3|ACTC_BIOAL0.000e+092.52Actin, cytoplasmic OS=Biomphalaria alexandrina OX=... [more]
back to top
BLAST of Actin, cytoplasmic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9PTU40.000e+092.86B-actin OS=Pagrus major OX=143350 PE=2 SV=1[more]
E5F7D00.000e+092.86Non-muscle actin II OS=Hydractinia echinata OX=356... [more]
B1B5600.000e+091.84Beta actin isoform 1 (Fragment) OS=Solea senegalen... [more]
A0A3B4X5400.000e+092.18Uncharacterized protein OS=Seriola lalandi dorsali... [more]
A0A3B4TLD90.000e+092.18Uncharacterized protein OS=Seriola dumerili OX=414... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb10.000e+090.82actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb10.000e+090.82actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb20.000e+090.82actin beta [Source:NCBI gene;Acc:103030443][more]
zgc:867090.000e+090.14actin, alpha cardiac muscle 1 [Source:NCBI gene;Ac... [more]
ENSAMXT00000003590.20.000e+089.80actin, alpha cardiac-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004586.10.000e+090.14pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 ... [more]
ENSPMAT00000011113.10.000e+090.14pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
ENSPMAT00000011230.13.353e-12554.76pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1... [more]
ACTG21.085e-6983.62actin gamma 2, smooth muscle [Source:HGNC Symbol;A... [more]
ENSPMAT00000003686.14.637e-5435.08pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 ... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ACT10.000e+082.99Actin; structural protein involved in cell polariz... [more]
ARP23.070e-9647.83Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP16.251e-9148.08Actin-related protein of the dynactin complex; req... [more]
ARP38.494e-5435.67Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP46.946e-2341.53Nuclear actin-related protein involved in chromati... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380060.000e+091.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450130.000e+092.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426460.000e+091.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385200.000e+091.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379760.000e+089.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021726.20.000e+091.50actin, cytoplasmic [Source:NCBI gene;Acc:101155523... [more]
actb0.000e+090.82cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actb0.000e+090.82cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000011677.20.000e+090.48actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
ENSORLT00000029375.10.000e+090.48actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
back to top
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051672.10.000e+092.52SMESG000051672.1[more]
SMESG000051670.10.000e+092.52SMESG000051670.1[more]
SMESG000012317.10.000e+091.50SMESG000012317.1[more]
SMESG000012332.10.000e+091.16SMESG000012332.1[more]
SMESG000058003.10.000e+091.84SMESG000058003.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004267 ID=SMED30004267|Name=Actin, cytoplasmic|organism=Schmidtea mediterranea sexual|type=transcript|length=970bp
CATGGAGAAAATCTTTCATCATACCTTTTAGAATGAATTAATATTAGCCC
CTGAAGAACATCCAGTTCTTTTAACTGAAGCGCCTTTAAATCCAAAAGCA
AATAGAGAAAAAATGACTCAAATTATGTTTGAAACTTTCAACTGTCCAGC
TATGTATGTAGCAATACAGGCAGTGTTGTCCTTGTATGCATCTGGTAGAA
CGACAGGTATTGTACTAGATTCTGGGGATGGAGTAACCCATACAGTTCCA
ATTTATGAAGGCTATGCTCTGCCACATGCCATCTGTAGATTAGATCTCGC
TGGAAGAGATCTAACAGATTATTTGATGAAAGTCCTTACTGAAAGAGGTT
ATTCTTTTACAACCACTGCTGAAAGAGAAATTGTTCGAGACATTAAAGAA
AAACTTGCTTATGTCGCACTTTCATTTGATGAAGAAATGCAAACTGCCTC
ATTATCTTCAGCTTTAGAAAAAAGTTACGAATTACCAGATGGTCAAGTCA
TTACCATAGGTAATGAACGATTTAGATGCCCAGAAACATTGTTTCAACCA
TCATTTATCGGTTTGGAATGTGCTGGAATCCATGAAACAACATACAATAG
TATTATGAAATGTGATGTTGATATCAGAAAAGACCTTTATGCTAACACCG
TTTTATCTGGCGGCTCTACAATGTTTCCTGGTATTTCAGATCGAATGCAA
AAGGAAATTACTTCATTAGCTCCACCAACTATGAAAATAAAAATTATCGC
TCCGCCAGAGAGAAAATACTCGGTTTGGATTGGAGGATCCATTTTAGCTT
CTCTTTCAACCTTTCAACAAATGTGGATTTCTAAGCAAGAATACGATGAA
TCTGGTCCTGGTATCGTTCATAGAAAATGTTTTTAAATGTTTCATTGGAA
TGATTTTAGTGAAATAACAAGTTAATCTTTTTATTTTTGGCTATCAATAA
ATCTTGTAAAATTAAAAAAA
back to top

protein sequence of SMED30004267-orf-1

>SMED30004267-orf-1 ID=SMED30004267-orf-1|Name=SMED30004267-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=258bp
MTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEG
YALPHAICRLDLAGRDLTDYLMKVLTERGYSFTTTAEREIVRDIKEKLAY
VALSFDEEMQTASLSSALEKSYELPDGQVITIGNERFRCPETLFQPSFIG
LECAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGISDRMQKEIT
SLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPG
IVHRKCF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004000Actin
IPR020902Actin/actin-like_CS
IPR004001Actin_CS
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton