60 kDa heat shock protein, mitochondrial

Overview
Name60 kDa heat shock protein, mitochondrial
Smed IDSMED30004256
Length (bp)2205
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60 kDa heat shock protein, mitochondrial (SMED30004256) t-SNE clustered cells

Violin plots show distribution of expression levels for 60 kDa heat shock protein, mitochondrial (SMED30004256) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60 kDa heat shock protein, mitochondrial (SMED30004256) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60 kDa heat shock protein, mitochondrial (SMED30004256) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004256

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004256SMESG000005331.1 SmedASXL_011941SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004256SMESG000005331.1 SmedASXL_011941SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30004256SMESG000005331.1 SMED_07079_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004256SMESG000005331.1 SMED_07079_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Match: HSPD1 (heat shock protein family D (Hsp60) member 1 [Source:HGNC Symbol;Acc:HGNC:5261])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 288/547 (52.65%), Postives = 420/547 (76.78%), Query Frame = 2
Query:   74 MFRQICVQNYKLG---FRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLD-LLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVKXXXXXXXXXXXXXXXXEVVVVD 1702
            +FRQ+   +  L     R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+ EL   +K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T+++G TLND LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  + SIVP LE+ N+   PL+IIAEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIATGG +FG++G  + +E V+   LG+  E+ ++++D +++ G+G++ +I  RI+ + ++L +  + YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD L     DQ IGI ++K  LK P  TIA+NAGV G L+VE++++     +++GYDA+  ++V+M ++GIIDP KVV+TAL  AAG ASLL T+EVVV +
Sbjct:    7 VFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEK-LNERLAKLSDGVAVLKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQS---SSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTE 548          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Match: HSPD1 (heat shock protein family D (Hsp60) member 1 [Source:HGNC Symbol;Acc:HGNC:5261])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 288/547 (52.65%), Postives = 420/547 (76.78%), Query Frame = 2
Query:   74 MFRQICVQNYKLG---FRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLD-LLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVKXXXXXXXXXXXXXXXXEVVVVD 1702
            +FRQ+   +  L     R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+ EL   +K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T+++G TLND LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  + SIVP LE+ N+   PL+IIAEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIATGG +FG++G  + +E V+   LG+  E+ ++++D +++ G+G++ +I  RI+ + ++L +  + YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD L     DQ IGI ++K  LK P  TIA+NAGV G L+VE++++     +++GYDA+  ++V+M ++GIIDP KVV+TAL  AAG ASLL T+EVVV +
Sbjct:    7 VFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEK-LNERLAKLSDGVAVLKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQS---SSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTE 548          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Match: HSPD1 (heat shock protein family D (Hsp60) member 1 [Source:HGNC Symbol;Acc:HGNC:5261])

HSP 1 Score: 267.7 bits (683), Expect = 4.053e-84
Identity = 123/211 (58.29%), Postives = 173/211 (81.99%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKG 748
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+ EL   +K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T  +G TLND LE+I G+KFDRGYISPYFIN+ KG
Sbjct:   24 RAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVIT--DGKTLNDELEIIEGMKFDRGYISPYFINTSKG 232          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Match: HSPD1 (heat shock protein family D (Hsp60) member 1 [Source:HGNC Symbol;Acc:HGNC:5261])

HSP 1 Score: 248.054 bits (632), Expect = 7.894e-77
Identity = 116/215 (53.95%), Postives = 170/215 (79.07%), Query Frame = 2
Query:   74 MFRQICVQNYKLG---FRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDR 709
            +FRQ+   +  L     R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+ EL   +K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T+++G TLND LE+I G+KFDR
Sbjct:    7 VFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDR 221          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Match: HSPD1 (heat shock protein family D (Hsp60) member 1 [Source:HGNC Symbol;Acc:HGNC:5261])

HSP 1 Score: 144.05 bits (362), Expect = 3.970e-39
Identity = 66/110 (60.00%), Postives = 94/110 (85.45%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINK 445
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+K
Sbjct:   66 RAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISK 175          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Match: hsp-60 (Chaperonin homolog Hsp-60, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P50140])

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 268/511 (52.45%), Postives = 374/511 (73.19%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGN---DIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            R++AK++KFG+E R  M+ GV LL   VS T+GPKGRNVIIE S GSP ITKDGVTVA++I L+++ QNLGAK+++D+A   N+++GDGT+ ATVLA +IAKE F  I +G N +E+R G++  V++VV EL  ++K++T+PEE++QVA+ISAN D  VGN+IS+A++KVG TG +T+++G TLND LELI G+KFDRGYISPYFI S KG+K E++ A +LLS++KI  V  IVP LEL N    PL+IIAEDVD EAL+ L++N+LK+ LQ+ A+K+P FG+NR   L D+ IATG  +FG   + I IE +    LG   E+ I+++DTL++ G+G++ +I  RIE + DE++   ++YE+E+ L ERL+KLS G+AV++IGG  SE+E+ EKK R  DAL AT+AA++EGIV GGG+ALLR +  L        DQ IG+ +VK+AL  P  TI +NAG+    +++ +      GN     GYDALN ++VDMF+ GIIDP KVV+
Sbjct:   15 RSYAKDVKFGAEGRQAMLVGVNLLADAVSVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIDLKDKYQNLGAKLIQDVANKANEEAGDGTTCATVLARAIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVTTPEEIAQVATISANGDTVVGNLISDAMKKVGTTGVITVKDGKTLNDELELIEGMKFDRGYISPYFITSAKGAKVEYEKALVLLSEKKISQVQDIVPALELANKLRRPLVIIAEDVDGEALTTLVLNRLKVGLQVVAIKAPGFGDNRKNTLKDMGIATGATIFGDDSNLIKIEDITANDLGEVDEVTITKDDTLLLRGRGDQTEIEKRIEHITDEIEQSTSDYEKEK-LNERLAKLSKGVAVLKIGG-GSEVEVGEKKDRVTDALCATRAAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSSIIDEV-----TGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVR 518          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Match: hsp-60 (Chaperonin homolog Hsp-60, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P50140])

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 268/511 (52.45%), Postives = 374/511 (73.19%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGN---DIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            R++AK++KFG+E R  M+ GV LL   VS T+GPKGRNVIIE S GSP ITKDGVTVA++I L+++ QNLGAK+++D+A   N+++GDGT+ ATVLA +IAKE F  I +G N +E+R G++  V++VV EL  ++K++T+PEE++QVA+ISAN D  VGN+IS+A++KVG TG +T+++G TLND LELI G+KFDRGYISPYFI S KG+K E++ A +LLS++KI  V  IVP LEL N    PL+IIAEDVD EAL+ L++N+LK+ LQ+ A+K+P FG+NR   L D+ IATG  +FG   + I IE +    LG   E+ I+++DTL++ G+G++ +I  RIE + DE++   ++YE+E+ L ERL+KLS G+AV++IGG  SE+E+ EKK R  DAL AT+AA++EGIV GGG+ALLR +  L        DQ IG+ +VK+AL  P  TI +NAG+    +++ +      GN     GYDALN ++VDMF+ GIIDP KVV+
Sbjct:   15 RSYAKDVKFGAEGRQAMLVGVNLLADAVSVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIDLKDKYQNLGAKLIQDVANKANEEAGDGTTCATVLARAIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVTTPEEIAQVATISANGDTVVGNLISDAMKKVGTTGVITVKDGKTLNDELELIEGMKFDRGYISPYFITSAKGAKVEYEKALVLLSEKKISQVQDIVPALELANKLRRPLVIIAEDVDGEALTTLVLNRLKVGLQVVAIKAPGFGDNRKNTLKDMGIATGATIFGDDSNLIKIEDITANDLGEVDEVTITKDDTLLLRGRGDQTEIEKRIEHITDEIEQSTSDYEKEK-LNERLAKLSKGVAVLKIGG-GSEVEVGEKKDRVTDALCATRAAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSSIIDEV-----TGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVR 518          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Match: hsp-60 (Chaperonin homolog Hsp-60, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P50140])

HSP 1 Score: 177.178 bits (448), Expect = 2.146e-50
Identity = 100/219 (45.66%), Postives = 145/219 (66.21%), Query Frame = 2
Query:  992 IAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGN---DIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            + IATG  +FG   + I IE +    LG   E+ I+++DTL++ G+G++ +I  RIE + DE++   ++YE+E+ L ERL+KLS G+AV++IGG  SE+E+ EKK R  DAL AT+AA++EGIV GGG+ALLR +  L        DQ IG+ +VK+AL  P  TI +NAG+    +++ +      GN     GYDALN ++VDMF+ GIIDP KVV+
Sbjct:    1 MGIATGATIFGDDSNLIKIEDITANDLGEVDEVTITKDDTLLLRGRGDQTEIEKRIEHITDEIEQSTSDYEKEK-LNERLAKLSKGVAVLKIGG-GSEVEVGEKKDRVTDALCATRAAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSSIIDEV-----TGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVR 212          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Match: hsp-60 (Chaperonin homolog Hsp-60, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P50140])

HSP 1 Score: 161.384 bits (407), Expect = 2.199e-43
Identity = 77/140 (55.00%), Postives = 109/140 (77.86%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQIT 535
            R++AK++KFG+E R  M+ GV LL   VS T+GPKGRNVIIE S GSP ITKDGVTVA++I L+++ QNLGAK+++D+A   N+++GDGT+ ATVLA +IAKE F  I +G N +E+R G++  V++VV EL  ++K++T
Sbjct:   15 RSYAKDVKFGAEGRQAMLVGVNLLADAVSVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIDLKDKYQNLGAKLIQDVANKANEEAGDGTTCATVLARAIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVT 154          

HSP 2 Score: 160.229 bits (404), Expect = 7.484e-43
Identity = 99/227 (43.61%), Postives = 144/227 (63.44%), Query Frame = 2
Query:  995 AIATGGFLFGQQGDRI---------PIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGN---DIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            AIA  GF   +QG             +E V  E    +K++ I+++DTL++ G+G++ +I  RIE + DE++   ++YE+E+ L ERL+KLS G+AV++IGG  SE+E+ EKK R  DAL AT+AA++EGIV GGG+ALLR +  L        DQ IG+ +VK+AL  P  TI +NAG+    +++ +      GN     GYDALN ++VDMF+ GIIDP KVV+
Sbjct:  113 AIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVTITKDDTLLLRGRGDQTEIEKRIEHITDEIEQSTSDYEKEK-LNERLAKLSKGVAVLKIGG-GSEVEVGEKKDRVTDALCATRAAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSSIIDEV-----TGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVR 332          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Match: hsp-60 (Chaperonin homolog Hsp-60, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P50140])

HSP 1 Score: 161.384 bits (407), Expect = 2.199e-43
Identity = 77/140 (55.00%), Postives = 109/140 (77.86%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQIT 535
            R++AK++KFG+E R  M+ GV LL   VS T+GPKGRNVIIE S GSP ITKDGVTVA++I L+++ QNLGAK+++D+A   N+++GDGT+ ATVLA +IAKE F  I +G N +E+R G++  V++VV EL  ++K++T
Sbjct:   15 RSYAKDVKFGAEGRQAMLVGVNLLADAVSVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIDLKDKYQNLGAKLIQDVANKANEEAGDGTTCATVLARAIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVT 154          

HSP 2 Score: 160.229 bits (404), Expect = 7.484e-43
Identity = 99/227 (43.61%), Postives = 144/227 (63.44%), Query Frame = 2
Query:  995 AIATGGFLFGQQGDRI---------PIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGN---DIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            AIA  GF   +QG             +E V  E    +K++ I+++DTL++ G+G++ +I  RIE + DE++   ++YE+E+ L ERL+KLS G+AV++IGG  SE+E+ EKK R  DAL AT+AA++EGIV GGG+ALLR +  L        DQ IG+ +VK+AL  P  TI +NAG+    +++ +      GN     GYDALN ++VDMF+ GIIDP KVV+
Sbjct:  113 AIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVTITKDDTLLLRGRGDQTEIEKRIEHITDEIEQSTSDYEKEK-LNERLAKLSKGVAVLKIGG-GSEVEVGEKKDRVTDALCATRAAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSSIIDEV-----TGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVR 332          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Match: Hsp60A (gene:FBgn0015245 transcript:FBtr0073434)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 269/512 (52.54%), Postives = 395/512 (77.15%), Query Frame = 2
Query:  104 KLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            +L  R +AK+++FG E RA M++GV++L   V+ T+GPKGRNVIIE S GSP ITKDGVTVA++I L+++ QN+GAK+++D+A NTN+++GDGT+TATVLA +IAKE F +I+KG N +E+R G++  V+ V   L  M++ +++PEE++QVA+ISAN D ++GN+ISEA++KVG+ G +T+++G TL D LE+I G+KFDRGYISPYFINS KG+K EFQ+A +LLS++KI  V SI+P LEL N+Q  PL+IIAED+D EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIA+GG +FG   D + +E VK+  LG+  E+ I+++DTL++ G+G +  +  R  +++D+++   + YE+E+ L+ERL++L++G+A++R+GG SSE+E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  L+ ++ T  DQ +G+ +V+ AL+ PC TIA+NAGV+G +VV ++  Q     D GYDAL  EY ++ ++GIIDP KVV+
Sbjct:   16 QLAMRGYAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVETVKDNLKTMSRPVSTPEEIAQVATISANGDQAIGNLISEAMKKVGRDGVITVKDGKTLTDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDALLLLSEKKISSVQSIIPALELANAQRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAPGFGDNRKSTLTDMAIASGGIVFGDDADLVKLEDVKVSDLGQVGEVVITKDDTLLLKGKGKKDDVLRRANQIKDQIEDTTSEYEKEK-LQERLARLASGVALLRVGG-SSEVEVNEKKDRVHDALNATRAAVEEGIVPGGGTALLRCIEKLEGVETTNEDQKLGVEIVRRALRMPCMTIAKNAGVDGAMVVAKVENQ---AGDYGYDALKGEYGNLIEKGIIDPTKVVR 522          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Match: Hsp60A (gene:FBgn0015245 transcript:FBtr0073435)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 269/512 (52.54%), Postives = 395/512 (77.15%), Query Frame = 2
Query:  104 KLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            +L  R +AK+++FG E RA M++GV++L   V+ T+GPKGRNVIIE S GSP ITKDGVTVA++I L+++ QN+GAK+++D+A NTN+++GDGT+TATVLA +IAKE F +I+KG N +E+R G++  V+ V   L  M++ +++PEE++QVA+ISAN D ++GN+ISEA++KVG+ G +T+++G TL D LE+I G+KFDRGYISPYFINS KG+K EFQ+A +LLS++KI  V SI+P LEL N+Q  PL+IIAED+D EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIA+GG +FG   D + +E VK+  LG+  E+ I+++DTL++ G+G +  +  R  +++D+++   + YE+E+ L+ERL++L++G+A++R+GG SSE+E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  L+ ++ T  DQ +G+ +V+ AL+ PC TIA+NAGV+G +VV ++  Q     D GYDAL  EY ++ ++GIIDP KVV+
Sbjct:   16 QLAMRGYAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVETVKDNLKTMSRPVSTPEEIAQVATISANGDQAIGNLISEAMKKVGRDGVITVKDGKTLTDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDALLLLSEKKISSVQSIIPALELANAQRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAPGFGDNRKSTLTDMAIASGGIVFGDDADLVKLEDVKVSDLGQVGEVVITKDDTLLLKGKGKKDDVLRRANQIKDQIEDTTSEYEKEK-LQERLARLASGVALLRVGG-SSEVEVNEKKDRVHDALNATRAAVEEGIVPGGGTALLRCIEKLEGVETTNEDQKLGVEIVRRALRMPCMTIAKNAGVDGAMVVAKVENQ---AGDYGYDALKGEYGNLIEKGIIDPTKVVR 522          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Match: Hsp60C (gene:FBgn0031728 transcript:FBtr0079112)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 269/515 (52.23%), Postives = 396/515 (76.89%), Query Frame = 2
Query:   98 NYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDL-DLLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEI-GNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            ++ L  R +AK+++FG E RA M++GV++L   V+ T+GPKGRNVIIE S GSP ITKDGVTVA++I L+++ QN+GAK+++D+A NTN+++GDGT+TATVLA +IAKE F +I++G + +E+R G++  ++ V   L  +++ + +PEE+ QVA+ISAN D SVGN+ISEAI+KVG+ G +T+++G TL D LE+I G+KFDRGYISPYFIN+ KG+K EFQ+A +L  ++KI    SIVP LEL N+Q  PL+IIAED+++EALS L++N+LK+ LQ+CAVK+P FG+NR E L D+A+ATGG +FG + + + +E +K+   GR  E+ +S++DT+++ G+G + ++  R+E L + ++   ++YE+E+ ++ERL++LS+G+A++R+GG SS++E+ EKK R IDAL AT+AA++EGIV GGG ALLRCI  L DL     DQN+GI +++ AL+ PC TIA+NAGV+G +VV +    +EI   D GYDAL  EY +M +RGIIDP KVV+
Sbjct:   18 SHVLWARNYAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIALKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVMLAIETVKDNLRRLSRPVNTPEEICQVATISANGDKSVGNLISEAIKKVGRDGVITVKDGKTLCDELEVIEGMKFDRGYISPYFINTSKGAKVEFQDALLLFCEKKIKSAPSIVPALELANAQRKPLVIIAEDLEAEALSTLVVNRLKVGLQVCAVKAPGFGDNRKENLMDMAVATGGIVFGDEANMVRLEDIKMSDFGRVGEVVVSKDDTMLLKGKGQKAEVEKRVEGLREAIKESTSSYEKEK-MQERLARLSSGVALLRVGG-SSDVEVSEKKDRVIDALNATRAAVEEGIVPGGGTALLRCIQKLNDLKGANEDQNMGIEIIRRALRMPCLTIAKNAGVDGAMVVAK----VEILDGDYGYDALKGEYGNMIERGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Match: Hsp60C (gene:FBgn0031728 transcript:FBtr0079111)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 269/515 (52.23%), Postives = 396/515 (76.89%), Query Frame = 2
Query:   98 NYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDL-DLLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEI-GNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            ++ L  R +AK+++FG E RA M++GV++L   V+ T+GPKGRNVIIE S GSP ITKDGVTVA++I L+++ QN+GAK+++D+A NTN+++GDGT+TATVLA +IAKE F +I++G + +E+R G++  ++ V   L  +++ + +PEE+ QVA+ISAN D SVGN+ISEAI+KVG+ G +T+++G TL D LE+I G+KFDRGYISPYFIN+ KG+K EFQ+A +L  ++KI    SIVP LEL N+Q  PL+IIAED+++EALS L++N+LK+ LQ+CAVK+P FG+NR E L D+A+ATGG +FG + + + +E +K+   GR  E+ +S++DT+++ G+G + ++  R+E L + ++   ++YE+E+ ++ERL++LS+G+A++R+GG SS++E+ EKK R IDAL AT+AA++EGIV GGG ALLRCI  L DL     DQN+GI +++ AL+ PC TIA+NAGV+G +VV +    +EI   D GYDAL  EY +M +RGIIDP KVV+
Sbjct:   18 SHVLWARNYAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIALKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVMLAIETVKDNLRRLSRPVNTPEEICQVATISANGDKSVGNLISEAIKKVGRDGVITVKDGKTLCDELEVIEGMKFDRGYISPYFINTSKGAKVEFQDALLLFCEKKIKSAPSIVPALELANAQRKPLVIIAEDLEAEALSTLVVNRLKVGLQVCAVKAPGFGDNRKENLMDMAVATGGIVFGDEANMVRLEDIKMSDFGRVGEVVVSKDDTMLLKGKGQKAEVEKRVEGLREAIKESTSSYEKEK-MQERLARLSSGVALLRVGG-SSDVEVSEKKDRVIDALNATRAAVEEGIVPGGGTALLRCIQKLNDLKGANEDQNMGIEIIRRALRMPCLTIAKNAGVDGAMVVAK----VEILDGDYGYDALKGEYGNMIERGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Match: Hsp60C (gene:FBgn0031728 transcript:FBtr0079110)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 269/515 (52.23%), Postives = 396/515 (76.89%), Query Frame = 2
Query:   98 NYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDL-DLLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEI-GNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            ++ L  R +AK+++FG E RA M++GV++L   V+ T+GPKGRNVIIE S GSP ITKDGVTVA++I L+++ QN+GAK+++D+A NTN+++GDGT+TATVLA +IAKE F +I++G + +E+R G++  ++ V   L  +++ + +PEE+ QVA+ISAN D SVGN+ISEAI+KVG+ G +T+++G TL D LE+I G+KFDRGYISPYFIN+ KG+K EFQ+A +L  ++KI    SIVP LEL N+Q  PL+IIAED+++EALS L++N+LK+ LQ+CAVK+P FG+NR E L D+A+ATGG +FG + + + +E +K+   GR  E+ +S++DT+++ G+G + ++  R+E L + ++   ++YE+E+ ++ERL++LS+G+A++R+GG SS++E+ EKK R IDAL AT+AA++EGIV GGG ALLRCI  L DL     DQN+GI +++ AL+ PC TIA+NAGV+G +VV +    +EI   D GYDAL  EY +M +RGIIDP KVV+
Sbjct:   18 SHVLWARNYAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIALKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVMLAIETVKDNLRRLSRPVNTPEEICQVATISANGDKSVGNLISEAIKKVGRDGVITVKDGKTLCDELEVIEGMKFDRGYISPYFINTSKGAKVEFQDALLLFCEKKIKSAPSIVPALELANAQRKPLVIIAEDLEAEALSTLVVNRLKVGLQVCAVKAPGFGDNRKENLMDMAVATGGIVFGDEANMVRLEDIKMSDFGRVGEVVVSKDDTMLLKGKGQKAEVEKRVEGLREAIKESTSSYEKEK-MQERLARLSSGVALLRVGG-SSDVEVSEKKDRVIDALNATRAAVEEGIVPGGGTALLRCIQKLNDLKGANEDQNMGIEIIRRALRMPCLTIAKNAGVDGAMVVAK----VEILDGDYGYDALKGEYGNMIERGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Match: hspd1 (heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-021206-1])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 268/521 (51.44%), Postives = 394/521 (75.62%), Query Frame = 2
Query:   77 FRQICVQNYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLD-LLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
             R +C        R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L++R +N+GAK+++D+A NTN+++GDGT+TATVLA ++AKE F+ I+KG N +E+R G++  V+ V+ EL   +K +T+PEE++QVA+ISAN D  VGN+IS A++KVG+ G +T+++G TL+D LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  V SIVP LE+ N    PL+I+AEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+A++TGG +FG +   + +E ++    G+  E+ ++++DT+++ G+G+   I  R+  + ++L+   ++YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD +     DQ IGI +++ +L+ P  TIA+NAGV G LVVE++L+      +IGYDA+N EYV+M +RGIIDP KVV+
Sbjct:   11 MRPVCRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDRYKNIGAKLVQDVANNTNEEAGDGTTTATVLARAVAKEGFDTISKGANPVEIRRGVMMAVEEVISELKKNSKPVTTPEEIAQVATISANGDTEVGNIISNAMKKVGRKGVITVKDGKTLHDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANQHRKPLVIVAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLQDMAVSTGGTVFGDEAMGLALEDIQAHDFGKVGEVIVTKDDTMLLKGRGDASAIEKRVNEIAEQLESTNSDYEKEK-LNERLAKLSDGVAVIKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPALDNIKPANADQKIGIDIIRRSLRIPAMTIAKNAGVEGSLVVEKILQS---STEIGYDAMNGEYVNMVERGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Match: hspd1 (heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-021206-1])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 268/521 (51.44%), Postives = 394/521 (75.62%), Query Frame = 2
Query:   77 FRQICVQNYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLD-LLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
             R +C        R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L++R +N+GAK+++D+A NTN+++GDGT+TATVLA ++AKE F+ I+KG N +E+R G++  V+ V+ EL   +K +T+PEE++QVA+ISAN D  VGN+IS A++KVG+ G +T+++G TL+D LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  V SIVP LE+ N    PL+I+AEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+A++TGG +FG +   + +E ++    G+  E+ ++++DT+++ G+G+   I  R+  + ++L+   ++YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD +     DQ IGI +++ +L+ P  TIA+NAGV G LVVE++L+      +IGYDA+N EYV+M +RGIIDP KVV+
Sbjct:   11 MRPVCRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDRYKNIGAKLVQDVANNTNEEAGDGTTTATVLARAVAKEGFDTISKGANPVEIRRGVMMAVEEVISELKKNSKPVTTPEEIAQVATISANGDTEVGNIISNAMKKVGRKGVITVKDGKTLHDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANQHRKPLVIVAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLQDMAVSTGGTVFGDEAMGLALEDIQAHDFGKVGEVIVTKDDTMLLKGRGDASAIEKRVNEIAEQLESTNSDYEKEK-LNERLAKLSDGVAVIKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPALDNIKPANADQKIGIDIIRRSLRIPAMTIAKNAGVEGSLVVEKILQS---STEIGYDAMNGEYVNMVERGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 55.0694 bits (131), Expect = 2.424e-7
Identity = 49/234 (20.94%), Postives = 108/234 (46.15%), Query Frame = 2
Query:  143 GSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQIT----SPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQN-----------------GNTLNDTLELINGLKFDRGYISPYFINSDKGSK-----CEFQ 766
            G EA    +   + +   +  +LGP G + ++ + +G   +T DG T+   + ++++I    AK++ +++K+ +D+ GDGT+   VLA ++ ++A   +++G++ I + +G  +   + +++L+ +         + E L Q A  +  +   V N     + ++     +T+ +                 G  L DT +LI G+  D+ +  P      K +K     C F+
Sbjct:   30 GLEALKSHILAAKAVANTLRTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQI----AKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAAKIAIEQLDKIGDSFPVDPNNTESLVQTAMTTLGS--KVINRCHRQMAEIAVNAILTVADMERKDVDFELIKVEGKVGGKLEDT-QLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFE 256          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 53.1434 bits (126), Expect = 9.548e-7
Identity = 94/422 (22.27%), Postives = 184/422 (43.60%), Query Frame = 2
Query:  206 TLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQ--ITSPEELSQVASIS------ANNDHSVGNMISEAIRKVGKTGTVTIQN----------GNTLNDTLELINGLKFDRGYISPYFINSDKG-----------SKCEFQNAFILLSQRKIFDVLS-----IVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETV---KLEHLGRA---KEIHISRNDTLI-IGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIA--VVRIGGCSSEIELREKKARYIDALQATQA 1342
            +LGPKG + +I++  G   IT DG T+ + +    ++ +  AK++ +++K  + ++GDGT++  V+A ++       + KG++   +     K VD  V+ L +++    ++  E L   AS S      + N   +  M  +A+ KV    T T  +          G T++D  EL++G+   +   S      +K             K +  N  ++    ++  VL      I+ +++ +      +L+I + +  +ALS L ++ L               + ++ ++ DI      F+    G + PI  +     E LG A   +E+ +  +  L+ I G  + GK  S + R  ++L I     E ER++ + L  +   +    +  GG + EIEL  + A Y  +L   +A
Sbjct:   45 SLGPKGMDKMIQDGKGDVTITNDGATILKQM----QVLHPAAKMMVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTIISESFQKAVDKGVEVLTSISTPLLLSDRESLLNSASTSLCSKVVSQNSSLLAPMSVDAVMKVIDPATATSVDLRDINVVKKLGGTIDDC-ELVDGMVLTQRVASTGVSRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQVKKAGCTVLLIQKSILRDALSDLALHFL--------------NKMKIMVIKDIEREEIEFICKTIGTK-PIAHIDQFTPEMLGSAELVEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVI----EEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEYARSLGGMEA 442          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 51.6026 bits (122), Expect = 2.705e-6
Identity = 33/128 (25.78%), Postives = 68/128 (53.12%), Query Frame = 2
Query:  173 GVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQ 556
              +++ + V  TLGP+G + ++ ++ G   I+ DG T+ +  +L+  + +  AK L DIA++ + + GDGT++ T+LA    K+    + +G++   +         L VK++  +A  I   ++  Q
Sbjct:   28 ACQVVAEAVRTTLGPRGMDKLVVDNRGKATISNDGATILK--LLD--VVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIKEIAVTIKKDDKQEQ 151          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Match: hspd1 (heat shock protein family D (Hsp60) member 1 [Source:NCBI gene;Acc:100124945])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 266/508 (52.36%), Postives = 397/508 (78.15%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA+ I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+KEL N +K +T+PEE++QVA+ISAN D  +G +IS+A+++VG+ G +T+++G TL+D LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  V SIVP LE+ N+   PL+IIAEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AI++GG +FG++G  + IE ++    G+  E+ ++++DT+++ G+G++ +I  RI+ + ++L+   + YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  L+ L+    DQ +GI +++  LK P  TIA+NAGV G LVVE++++      +IGYDA++ E+V++ ++GIIDP KVV+
Sbjct:   24 RQYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMMAVDAVIKELKNQSKPVTTPEEIAQVATISANGDQEIGKIISDAMKRVGRRGVITVKDGKTLHDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYLLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAISSGGVVFGEEGLTLNIEDIQPHDFGKVGEVIVTKDDTMLLKGKGDKAQIEKRIQEIHEQLESTNSEYEKEK-LNERLAKLSDGVAVIKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALEALNPANEDQRVGIEIIRRTLKIPAMTIAKNAGVEGSLVVEKIIQS---PVEIGYDAMHAEFVNLVEKGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Match: hspd1 (heat shock protein family D (Hsp60) member 1 [Source:NCBI gene;Acc:100124945])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 266/508 (52.36%), Postives = 397/508 (78.15%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA+ I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+KEL N +K +T+PEE++QVA+ISAN D  +G +IS+A+++VG+ G +T+++G TL+D LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  V SIVP LE+ N+   PL+IIAEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AI++GG +FG++G  + IE ++    G+  E+ ++++DT+++ G+G++ +I  RI+ + ++L+   + YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  L+ L+    DQ +GI +++  LK P  TIA+NAGV G LVVE++++      +IGYDA++ E+V++ ++GIIDP KVV+
Sbjct:   47 RQYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMMAVDAVIKELKNQSKPVTTPEEIAQVATISANGDQEIGKIISDAMKRVGRRGVITVKDGKTLHDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYLLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAISSGGVVFGEEGLTLNIEDIQPHDFGKVGEVIVTKDDTMLLKGKGDKAQIEKRIQEIHEQLESTNSEYEKEK-LNERLAKLSDGVAVIKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALEALNPANEDQRVGIEIIRRTLKIPAMTIAKNAGVEGSLVVEKIIQS---PVEIGYDAMHAEFVNLVEKGIIDPTKVVR 549          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:394966])

HSP 1 Score: 63.1586 bits (152), Expect = 1.160e-9
Identity = 95/390 (24.36%), Postives = 165/390 (42.31%), Query Frame = 2
Query:  206 TLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQI-TSPEELS--------------------QVASISANNDHSVGNMIS-----EAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSK-----CEFQNAFILLSQRKIFDVLSI--------------VPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHI---------------SRNDTLIIGGQGNEGKIRSRIERLEDELQIVGN 1195
            +LGP G + ++ + +G   +T DG T+   + ++++I    AK++ +++K+ +D+ GDGT+   VLA ++ ++A   +++G++ I + +G  +   + V+ L+ ++      PE L                     Q+A I+ N+  +V +M       E I+  GK        G  L DT +LI G+  D+ +  P      K +K     C F+        +   DV S+              + +++ I      L I     D EA   L+ N+L       AV+    G   +E+   IAIATGG +  +  +  P    KL + G  KEI                 SR  T+ I G GN+  I      L D L ++ N
Sbjct:   51 SLGPNGLDKMMVDKDGQVTVTNDGATILSMMDVDHQI----AKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYEQAARIAVEHLDKISDSFPVDPENLEPLIRTAMTTLGSKVINRCHRQMAEIAVNSILTVADMDRKDVDFELIKVEGKV-------GGKLEDT-QLIKGVIVDKDFSHPQMPKVVKDAKIAILTCPFEPPKPKTKHK--LDVTSVEDYKALQKYEKEKFLEMVKQIKDTGANLAICQWGFDDEANHLLLQNELP------AVR--WVGGPEIEL---IAIATGGRIVPRFCELTP---EKLGYAGIVKEISFGTTKDRMLVIEQCKNSRAVTIFIRG-GNKMIIEEAKRSLHDALCVIRN 411          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:394966])

HSP 1 Score: 62.7734 bits (151), Expect = 1.389e-9
Identity = 95/390 (24.36%), Postives = 165/390 (42.31%), Query Frame = 2
Query:  206 TLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQIT-SPEELS--------------------QVASISANNDHSVGNMIS-----EAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSK-----CEFQNAFILLSQRKIFDVLSI--------------VPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHI---------------SRNDTLIIGGQGNEGKIRSRIERLEDELQIVGN 1195
            +LGP G + ++ + +G   +T DG T+   + ++++I    AK++ +++K+ +D+ GDGT+   VLA ++ ++A   +++G++ I + +G  +   + V+ L+ ++      PE L                     Q+A I+ N+  +V +M       E I+  GK        G  L DT +LI G+  D+ +  P      K +K     C F+        +   DV S+              + +++ I      L I     D EA   L+ N+L       AV+    G   +E+   IAIATGG +  +  +  P    KL + G  KEI                 SR  T+ I G GN+  I      L D L ++ N
Sbjct:   29 SLGPNGLDKMMVDKDGQVTVTNDGATILSMMDVDHQI----AKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYEQAARIAVEHLDKISDSFPVDPENLEPLIRTAMTTLGSKVINRCHRQMAEIAVNSILTVADMDRKDVDFELIKVEGKV-------GGKLEDT-QLIKGVIVDKDFSHPQMPKVVKDAKIAILTCPFEPPKPKTKHK--LDVTSVEDYKALQKYEKEKFLEMVKQIKDTGANLAICQWGFDDEANHLLLQNELP------AVR--WVGGPEIEL---IAIATGGRIVPRFCELTP---EKLGYAGIVKEISFGTTKDRMLVIEQCKNSRAVTIFIRG-GNKMIIEEAKRSLHDALCVIRN 389          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Match: dennd1b (DENN/MADD domain containing 1B [Source:Xenbase;Acc:XB-GENE-981228])

HSP 1 Score: 53.5286 bits (127), Expect = 1.023e-6
Identity = 29/95 (30.53%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  161 QMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINK 445
            ++++  E L  +V R  GP+G +V+   S G  +IT+DG  + E+++L++ +    A+I+   A N    +GDG  +  +L C + +E    INK
Sbjct:   22 KVLQVAESLENIVCRCFGPEGGHVLFIKSTGDLLITRDGRKILESLLLDHPV----ARIVVHSACNHASVTGDGVKSFVLLLCGVLRELQAAINK 112          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Match: Hspd1 (heat shock protein 1 (chaperonin) [Source:MGI Symbol;Acc:MGI:96242])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 273/508 (53.74%), Postives = 396/508 (77.95%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+ EL   +K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T+++G TLND LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  V SIVP LE+ N+   PL+IIAEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIATGG +FG++G  + +E V+   LG+  E+ ++++D +++ G+G++  I  RI+ + ++L I  + YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD L     DQ IGI ++K ALK P  TIA+NAGV G L+VE++L+     +++GYDA+  ++V+M ++GIIDP KVV+
Sbjct:   24 RAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAHDLGKVGEVIVTKDDAMLLKGKGDKAHIEKRIQEITEQLDITTSEYEKEK-LNERLAKLSDGVAVLKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPANEDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQS---SSEVGYDAMLGDFVNMVEKGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Match: Hspd1 (heat shock protein 1 (chaperonin) [Source:MGI Symbol;Acc:MGI:96242])

HSP 1 Score: 219.55 bits (558), Expect = 1.552e-66
Identity = 99/179 (55.31%), Postives = 147/179 (82.12%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQ 652
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+ EL   +K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T++
Sbjct:   24 RAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVK 202          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Match: Hspd1 (heat shock protein 1 (chaperonin) [Source:MGI Symbol;Acc:MGI:96242])

HSP 1 Score: 153.68 bits (387), Expect = 3.678e-43
Identity = 70/119 (58.82%), Postives = 100/119 (84.03%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRN 472
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R 
Sbjct:   24 RAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRR 142          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Match: Cct5 (chaperonin containing Tcp1, subunit 5 (epsilon) [Source:MGI Symbol;Acc:MGI:107185])

HSP 1 Score: 60.8474 bits (146), Expect = 5.346e-10
Identity = 46/194 (23.71%), Postives = 98/194 (50.52%), Query Frame = 2
Query:  206 TLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQ----ITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQN-----------------GNTLNDTLELINGLKFDRGYISP 724
            +LGP G + ++ + +G   IT DG T+   + ++++I    AK++ +++K+ +D+ GDGT+   VLA ++ +EA   +++G++ I + +G  +   + ++ L+ ++ +    I +PE L Q A  +  +   V N     + ++     +T+ +                 G  L DT +LI G+  D+ +  P
Sbjct:   13 SLGPNGLDKMMVDKDGDVTITNDGATILSMMDVDHQI----AKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARIAIQHLDKISDKVLVDINNPEPLIQTAKTTLGS--KVINSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDT-KLIKGVIVDKDFSHP 199          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Match: Cct5 (chaperonin containing Tcp1, subunit 5 (epsilon) [Source:MGI Symbol;Acc:MGI:107185])

HSP 1 Score: 62.3882 bits (150), Expect = 1.569e-9
Identity = 49/216 (22.69%), Postives = 105/216 (48.61%), Query Frame = 2
Query:  140 FGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQ----ITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQN-----------------GNTLNDTLELINGLKFDRGYISP 724
             G EA    +   + +   +  +LGP G + ++ + +G   IT DG T+   + ++++I    AK++ +++K+ +D+ GDGT+   VLA ++ +EA   +++G++ I + +G  +   + ++ L+ ++ +    I +PE L Q A  +  +   V N     + ++     +T+ +                 G  L DT +LI G+  D+ +  P
Sbjct:   29 MGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTITNDGATILSMMDVDHQI----AKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARIAIQHLDKISDKVLVDINNPEPLIQTAKTTLGS--KVINSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDT-KLIKGVIVDKDFSHP 237          
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Match: sp|P18687|CH60_CRIGR (60 kDa heat shock protein, mitochondrial OS=Cricetulus griseus OX=10029 GN=HSPD1 PE=2 SV=1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 274/508 (53.94%), Postives = 397/508 (78.15%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA+ I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+ EL   +K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T+++G TLND LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  V SIVP LE+ N+   PL+IIAEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIATGG +FG++G  + +E V+   LG+  E+ ++++D +++ G+G + +I  RI+ + ++L+I  + YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD L  +  DQ IGI ++K ALK P  TIA+NAGV G L+VE++L+     ++IGYDA+  ++V+M ++GIIDP KVV+
Sbjct:   24 RAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAHDLGKVGEVIVTKDDAMLLKGKGEKAQIEKRIQEITEQLEITTSEYEKEK-LNERLAKLSDGVAVLKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPSNEDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQS---SSEIGYDAMLGDFVNMVEKGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Match: sp|P63039|CH60_RAT (60 kDa heat shock protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hspd1 PE=1 SV=1)

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 273/508 (53.74%), Postives = 396/508 (77.95%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+ EL   +K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T+++G TLND LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  V SIVP LE+ N+   PL+IIAEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIATGG +FG++G  + +E V+   LG+  E+ ++++D +++ G+G++  I  RI+ + ++L I  + YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD L     DQ IGI ++K ALK P  TIA+NAGV G L+VE++L+     +++GYDA+  ++V+M ++GIIDP KVV+
Sbjct:   24 RAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAHDLGKVGEVIVTKDDAMLLKGKGDKAHIEKRIQEITEQLDITTSEYEKEK-LNERLAKLSDGVAVLKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPANEDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQS---SSEVGYDAMLGDFVNMVEKGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Match: sp|P63038|CH60_MOUSE (60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1)

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 273/508 (53.74%), Postives = 396/508 (77.95%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+ EL   +K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T+++G TLND LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  V SIVP LE+ N+   PL+IIAEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIATGG +FG++G  + +E V+   LG+  E+ ++++D +++ G+G++  I  RI+ + ++L I  + YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD L     DQ IGI ++K ALK P  TIA+NAGV G L+VE++L+     +++GYDA+  ++V+M ++GIIDP KVV+
Sbjct:   24 RAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAHDLGKVGEVIVTKDDAMLLKGKGDKAHIEKRIQEITEQLDITTSEYEKEK-LNERLAKLSDGVAVLKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPANEDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQS---SSEVGYDAMLGDFVNMVEKGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Match: sp|Q5ZL72|CH60_CHICK (60 kDa heat shock protein, mitochondrial OS=Gallus gallus OX=9031 GN=HSPD1 PE=1 SV=1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 269/508 (52.95%), Postives = 395/508 (77.76%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA+ I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA +IAKE F +I+KG N +E+R G++  VD +  EL  ++K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T+++G TLND LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++L+S++KI  V SIVP LE+ NS   PL+IIAEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIATGG +FG++G  + +E ++    G+  E+ ++++DT+++ G+G + +I  RI+ + ++L++  + YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD L     DQ IGI ++K  LK P  TIA+NAGV G L+VE++L+     +++GYDA+  E+V+M ++GIIDP KVV+
Sbjct:   24 RAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVDAITAELKKLSKPVTTPEEIAQVATISANGDQEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYVLISEKKISSVQSIVPALEIANSHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLSLNVEDIQPHDFGKVGEVIVTKDDTMLLKGKGEKAQIEKRIQEIIEQLEVTTSEYEKEK-LNERLAKLSDGVAVLKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPALDALKPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKILQS---SSEVGYDAMLGEFVNMVEKGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Match: sp|P10809|CH60_HUMAN (60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 288/547 (52.65%), Postives = 420/547 (76.78%), Query Frame = 2
Query:   74 MFRQICVQNYKLG---FRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLD-LLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVKXXXXXXXXXXXXXXXXEVVVVD 1702
            +FRQ+   +  L     R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA SIAKE F +I+KG N +E+R G++  VD V+ EL   +K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T+++G TLND LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  + SIVP LE+ N+   PL+IIAEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIATGG +FG++G  + +E V+   LG+  E+ ++++D +++ G+G++ +I  RI+ + ++L +  + YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD L     DQ IGI ++K  LK P  TIA+NAGV G L+VE++++     +++GYDA+  ++V+M ++GIIDP KVV+TAL  AAG ASLL T+EVVV +
Sbjct:    7 VFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEK-LNERLAKLSDGVAVLKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQS---SSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTE 548          
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Match: A0A481NV52 (Heat shock protein 60 OS=Dugesia japonica OX=6161 GN=hsp60 PE=2 SV=1)

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 287/507 (56.61%), Postives = 406/507 (80.08%), Query Frame = 2
Query:  119 TFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLD-LLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            T+AK++KFG++AR+ M+ GV++L   V+ T+GPKGRNVI+E S GSP ITKDGVTVA++I L+++ QN+GAK+++D+A NTN+++GDGT+ ATVLA +IAKE F +I+KG N I+ R G++  VD +V  L  M+K +T+PEE++QVA+ISAN D S+G++ISEA++KVGK GT+T+++G TL+D LE+I G+KFDRGYISPYFIN+DKG+KCEFQ+AFIL S++KI  + S++PVLE+ + Q  PLLI+AEDVD EAL+AL++N+LKL LQ+CAVK+P FG+NR   L D+A +TGG +FG + D   IE V+L  LGRA+E+ I+++DTL++ G+G +  I+ RI+ + DE+ +  + YE+E+ ++ERL+KLSNG+AV+++GG SSE+E+ EKK RY DAL AT+AA++EGIV GGG AL+RCI  L+ L   T DQ IGI +V+ AL +PCYTIA NAGVN  +VVE++   L + + +GYDA+NDEYV+M ++GIIDP KVV+
Sbjct:   23 TYAKDVKFGADARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGAKLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNIVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEIIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLRDMATSTGGIVFGDEADTYKIENVQLHDLGRAQEVLITKDDTLVMKGKGLQKDIQKRIDEIRDEIALSTSEYEKEK-MQERLAKLSNGVAVIKVGG-SSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPGLENLKPKTEDQKIGIEIVRRALTTPCYTIAHNAGVNASVVVEKV---LSMESAMGYDAMNDEYVNMIEKGIIDPTKVVR 524          
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Match: F8J497 (Heat shock protein 60 OS=Neobenedenia melleni OX=280695 GN=hsp60 PE=2 SV=1)

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 295/527 (55.98%), Postives = 412/527 (78.18%), Query Frame = 2
Query:   74 MFRQI-CVQNY----KLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            MFR I  ++N     ++    FAK++KFG++ARA M+ GV++L   V+ T+GPKGRNVI+E+S  SP ITKDGVTVA+ I L+++ QN+GAK+++D+A NTN+++GDGT+TATVLA +IAKE F +I+KG N IE R G++  VD VV EL +M+K +T+PEE++QVA+ISAN D S+G +IS A++KVG  GT+T+++G TL+D +E I G+KFDRGYISPYFIN+DKG+KCEFQ+AF+LLS++KI ++ S++PVLEL + Q  PLLIIAEDV+SEAL+AL++N+LKL LQ+CAVK+P FG+NR   L D+A+ATGG +FG   D   +E  + ++LGR  E  I+++D L++ G+GN+  I  RI ++ DE+++  + YE+E+ ++ERL+KLSNG+AV+++GG SSE+E+ EKK RY DAL AT+AA++EGIV GGG ALLRCI  L  L++   DQ IG+ +VK+AL +P YTIA NAGVNG +VVE++L   E   ++GYDALN EYVDM +RGIIDP KVV+
Sbjct:    1 MFRYIGALRNTQKICRVPVNHFAKDVKFGADARAAMLVGVDVLADAVAVTMGPKGRNVILESSWRSPKITKDGVTVAKGIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGTNPIEFRRGVMMAVDKVVAELKSMSKTVTTPEEIAQVATISANGDSSIGELISSAMKKVGNDGTITVKDGKTLHDEIEYIEGMKFDRGYISPYFINTDKGAKCEFQDAFVLLSEKKINNIQSLIPVLELTHQQKKPLLIIAEDVESEALTALVLNRLKLGLQVCAVKAPGFGDNRKSSLKDMAVATGGIVFGDDADMYKLEDFQAQNLGRVGEAVITKDDCLLMNGKGNKSDIHDRIGQIRDEMELSTSEYEKEK-MQERLAKLSNGVAVIKVGG-SSEVEVGEKKDRYTDALNATRAAVEEGIVPGGGTALLRCIEKLQDLEIKNDDQKIGVEIVKKALTTPAYTIASNAGVNGSVVVEKVLGSEE---NVGYDALNGEYVDMIERGIIDPTKVVR 522          
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Match: A0A183WHZ6 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS11751 PE=3 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 299/541 (55.27%), Postives = 418/541 (77.26%), Query Frame = 2
Query:  104 KLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVKXXXXXXXXXXXXXXXXEVVVVD---EEAG 1714
            +L  R +AKE+KFG++AR+ M+ GV++L   V+ T+GPKGRNVIIE+S  SP ITKDGVTVA+ I L+++ QN+GA++++D+A NTN+++GDGT+TATVLA +IAKE F +I+KG N IE R G++  VD VVKEL +++K+I++PEE++QVA+ISAN D ++G++I+ A++KVG  GT+T+++G TLND LE I G+KFDRGYISPYFIN++KG++CEFQ+AF+L S++KI  + +++P LEL + Q  PLLIIAEDV+ EAL+AL++N+LKL LQ+CAVK+P FG+NR   L D+AIATGG +FG + D   +E V+L+ LGR  E  IS+ D L++ G+G++  +  RI +++DE++   + YE+E+ + ER++KLSNG+AV+++GG SSE+E+ EKK RY DAL AT+AA++EGIV GGG ALLRCI  L  L+    DQ IG+ +V  AL +PCYTIA NAGVN  +VVE++   + +  + GYDA ND YVDM + GIIDP KVV+TAL  AAG ASLL T+E VV D   EE G
Sbjct:   17 RLAQRYYAKEVKFGADARSAMLVGVDILADAVAVTMGPKGRNVIIESSWKSPKITKDGVTVAKGIELKDKFQNIGARLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGTNPIEFRRGVMSAVDAVVKELKSLSKEISTPEEIAQVATISANGDKAIGDLIASAMKKVGNDGTITVKDGKTLNDELEFIEGMKFDRGYISPYFINTEKGARCEFQDAFVLFSEKKINSIQTLLPALELCHQQKRPLLIIAEDVEGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMAIATGGIVFGDEADMFKLEDVQLQDLGRVSEAIISKEDCLLMRGRGDKASVDKRIAQIKDEMEASNSEYEKEK-MHERMAKLSNGVAVIKVGG-SSEVEVSEKKDRYTDALNATRAAIEEGIVPGGGTALLRCIPTLQKLETKNEDQRIGVQIVLRALSTPCYTIAHNAGVNASVVVEKV---MSMSGNKGYDAQNDAYVDMIEAGIIDPTKVVRTALVDAAGVASLLTTAETVVTDLPKEETG 552          
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Match: A0A183K6N7 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS10662 PE=3 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 302/566 (53.36%), Postives = 432/566 (76.33%), Query Frame = 2
Query:   41 LHVICLRY*FDMFR-QICVQNYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVKXXXXXXXXXXXXXXXXEVVVVD---EEAGETV 1723
            L V  LR  F  FR  +    +++  R++AKE+KFG++AR+ M+ GV++L   V+ T+GPKGRNVIIE+S  SP ITKDGVTVA+ I L+++ QN+GAK+++D+A NTN+++GDGT+TATVLA +IAKE F +I+KG N IE R G++  VD VVKEL +++K I++PEE++QVA+ISAN D ++G++I+ A++KVG  GT+T+++G TL+D LE I G+KFDRGYISPYF+N++KG++CEFQ+AF+L S++KI  + +++P LEL + Q  PLLIIAEDV+ EAL+AL++N+LKL LQ+CAVK+P FG+NR   L D+A+ATGG +FG + D   +E V+L+ LGR  E+ ++++D L++ G+G++  +  RI ++++E++   + YE+E+ + ERL+KLSNG+AV+++GG SSE+E+ EKK RY DAL AT+AA++EGIV GGG ALLRCI  L  L+    DQ  G+ +V  AL +PCYTIA NAGVN  +VVE+++    +G ++GYDA ND YVDM + GIIDP KVV+TAL  AAG ASLL T+E VV D   EE+G  V
Sbjct:   29 LPVTMLRA-FATFRGTLAPARHRIIRRSYAKEVKFGADARSAMLVGVDILADAVAVTMGPKGRNVIIESSWKSPKITKDGVTVAKGIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPIEFRRGVMSAVDAVVKELKSLSKPISTPEEIAQVATISANGDKAIGDLIATAMKKVGNDGTITVKDGKTLHDELEFIEGMKFDRGYISPYFLNTEKGARCEFQDAFVLFSEKKINSIQTLLPALELCHQQKRPLLIIAEDVEGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMAVATGGLVFGDEADMFKLEDVQLQDLGRVAEVVVTKDDCLLMRGRGSKTDVDKRIAQIKEEMEASNSEYEKEK-MHERLAKLSNGVAVIKVGG-SSEVEVSEKKDRYTDALNATRAAIEEGIVPGGGTALLRCIPVLKCLETKNEDQRTGVQIVLRALSTPCYTIAHNAGVNASVVVEKVMG---MGPNMGYDAQNDVYVDMINAGIIDPTKVVRTALVDAAGVASLLTTAETVVTDLPKEESGANV 588          
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Match: A0A094ZZQ1 (60 kDa heat shock protein, mitochondrial OS=Schistosoma haematobium OX=6185 GN=MS3_08926 PE=3 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 298/557 (53.50%), Postives = 428/557 (76.84%), Query Frame = 2
Query:   68 FDMFR-QICVQNYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVKXXXXXXXXXXXXXXXXEVVVVD---EEAGETV 1723
            F  FR  +    +++  R++AKE+KFG++AR+ M+ GV++L   V+ T+GPKGRNVIIE+S  SP ITKDGVTVA+ I L+++ QN+GAK+++D+A NTN+++GDGT+TATVLA +IAKE F +I+KG N IE R G++  VD VVKEL +++K I++PEE++QVA+ISAN D ++G++I+ A++KVG  GT+T+++G TL+D LE I G+KFDRGYISPYF+N++KG++CEFQ+AF+L S++KI  + +++P LEL + Q  PLLIIAEDV+ EAL+AL++N+LKL LQ+CAVK+P FG+NR   L D+A+ATGG +FG + D   +E V+L+ LGR  E+ ++++D L++ G+G++  +  RI ++++E++   + YE+E+ + ERL+KLSNG+AV+++GG SSE+E+ EKK RY DAL AT+AA++EGIV GGG ALLRCI  L  L+    DQ  G+ +V  AL +PCYTIA NAGVN  +VVE+++    +G ++GYDA ND YVDM + GIIDP KVV+TAL  AAG ASLL T+E VV D   EE+G  V
Sbjct:    5 FATFRGTLAPARHRIIQRSYAKEVKFGADARSAMLVGVDILADAVAVTMGPKGRNVIIESSWKSPKITKDGVTVAKGIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPIEFRRGVMSAVDAVVKELKSLSKPISTPEEIAQVATISANGDKAIGDLIATAMKKVGNDGTITVKDGKTLHDELEFIEGMKFDRGYISPYFLNTEKGARCEFQDAFVLFSEKKINSIQTLLPALELCHQQKRPLLIIAEDVEGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMAVATGGLVFGDEADMFKLEDVQLQDLGRVAEVVVTKDDCLLMRGRGSKTDVDKRIAQIKEEMEASNSEYEKEK-MHERLAKLSNGVAVIKVGG-SSEVEVSEKKDRYTDALNATRAAIEEGIVPGGGTALLRCIPVLKSLETKNEDQRTGVQIVLRALSTPCYTIAHNAGVNASVVVEKVMG---MGPNMGYDAQNDVYVDMINAGIIDPTKVVRTALVDAAGVASLLTTAETVVTDLPKEESGANV 556          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Match: hspd1 (heat shock protein family D (Hsp60) member 1 [Source:NCBI gene;Acc:103043207])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 273/521 (52.40%), Postives = 397/521 (76.20%), Query Frame = 2
Query:   77 FRQICVQNYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLL-DVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
             R +C        R++AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GAK+++D+A NTN+++GDGT+TATVLA +IAKE F+ I+KG N +E+R G++  V+ +++EL  ++K +T+PEE++QVA+ISAN D  VG +IS A++KVG+ G +T+++G TL+D LE+I GLKFDRGYISPYFIN+ KG KCEFQ+A+ILLS++KI  V SIVP LE+ N    PL+I+AEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+AIA GG +FG +   + +E ++    GR  E+ ++++DT+++ G+G+   I  R+  + ++L+   ++YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGGLALLRCI  LD +  +  DQ IGI +++ AL+ P  TIA+NAGV G LVVE++L+      +IGYDALN EYV+M +RGIIDP KVV+
Sbjct:   11 MRPVCRALAPHLTRSYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFDTISKGANPVEIRRGVMLAVETIIEELKKLSKPVTTPEEIAQVATISANGDTEVGTIISNAMKKVGRKGVITVKDGKTLHDELEIIEGLKFDRGYISPYFINTTKGQKCEFQDAYILLSEKKISSVQSIVPALEIANQHRKPLVIVAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLQDMAIAAGGAVFGDEATGLALEDIQAHDFGRVGEVVVTKDDTMLLKGRGDPAAIEKRVAEIAEQLESTTSDYEKEK-LNERLAKLSDGVAVLKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGLALLRCIPALDTIKPINDDQKIGIDIIRRALRIPAMTIAKNAGVEGSLVVEKILQS---NAEIGYDALNGEYVNMVERGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 56.6102 bits (135), Expect = 7.978e-8
Identity = 97/423 (22.93%), Postives = 185/423 (43.74%), Query Frame = 2
Query:  197 VSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQ------------VASISANNDHSVGNMISEAIRKVGKTGTVTIQN----------GNTLNDTLELINGLKFDRGYISPYFINSDKG-----------SKCEFQNAFILLSQRKIFDVLS-----IVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLI-IGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIA--VVRIGGCSSEIELREKKARYIDALQATQA 1342
            +  +LGPKG + +I++  G   IT DG T+ + +    ++ +  AK+L +++K  + ++GDGT++  V+A ++       + KG++   +     K VD  V+ L +    I+ P ELS              + + +     +  M  +A+ +V    T T  +          G T++D  EL++GL   +  ++      +K             K +  N  ++    ++  VL      I+ +++ I      +L+I + +  +ALS L ++ L   ++I  VK       R EI   + I T G       D+   E + L  L  A+E+ +  +  L+ I G  + GK  S + R  ++L I     E ER++ + L  +   +    +  GG + EIEL  + A +  +L   +A
Sbjct:   42 IRTSLGPKGMDKMIQDGKGDVTITNDGATILKQM----QVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQKAVDKGVEVLTS----ISQPVELSDRETLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATSVDLRDIHIVKKLGGTIDDC-ELVDGLVLTQRVVNTGVSRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLIKQIKKAGCNVLLIQKSILRDALSDLAVHFLN-KMKIMVVKD----IEREEIEEQLNICTIGTKPIAHIDQFTPEMLGLAEL--AEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVI----EEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEFARSLGGMEA 444          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:103036471])

HSP 1 Score: 54.6842 bits (130), Expect = 2.101e-7
Identity = 41/116 (35.34%), Postives = 61/116 (52.59%), Query Frame = 2
Query:  113 FRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVII--ENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVN 454
            F+  A E K    AR     G   +  +V  TLGPKG + I+      GS  +T DG T+ + I     + N  AK+L D++K  +D+ GDGT++ TVLA  + +EA   I K ++
Sbjct:    9 FKHGADEEK-AETARLSSFIGAIAIGDLVKSTLGPKGMDKILLGGGREGSVTVTNDGATILKAI----GVDNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIH 119          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 54.299 bits (129), Expect = 3.957e-7
Identity = 53/239 (22.18%), Postives = 110/239 (46.03%), Query Frame = 2
Query:  143 GSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQI----TSPEEL-----------------SQVASISANNDHSVGNMIS-----EAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSK-----CEFQ 766
            G +A    +   + +   +  +LGP G + ++ + +G   +T DG T+   + ++++I    AK++ +++K+ +D+ GDGT+   VLA ++ ++A   +++G++ I + +G  +   + ++ L+ +        ++ E L                  Q+A I+ N   +V +M       E I+  GK        G  L DT +LI G+  D+ +  P      K +K     C F+
Sbjct:   30 GLDALKSHIMAAKAVANTLKTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQI----AKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKMEGKV-------GGKLEDT-QLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFE 256          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:103036471])

HSP 1 Score: 53.9138 bits (128), Expect = 5.407e-7
Identity = 41/116 (35.34%), Postives = 61/116 (52.59%), Query Frame = 2
Query:  113 FRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVII--ENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVN 454
            F+  A E K    AR     G   +  +V  TLGPKG + I+      GS  +T DG T+ + I     + N  AK+L D++K  +D+ GDGT++ TVLA  + +EA   I K ++
Sbjct:   12 FKHGADEEK-AETARLSSFIGAIAIGDLVKSTLGPKGMDKILLGGGREGSVTVTNDGATILKAI----GVDNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIH 122          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Match: hspd1 (heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-021206-1])

HSP 1 Score: 448.358 bits (1152), Expect = 1.652e-152
Identity = 210/389 (53.98%), Postives = 305/389 (78.41%), Query Frame = 2
Query:  110 GFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNG-ILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGG 1273
            G R +AK+++FGSEARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA+ I L++R +N+GAK+++D+A NTN+++GDGT+TATVLA +IAK+ F +I+KG N +E+R    +  V+ VV EL  ++K +T+PEE++QVA+ISAN D  +GN+IS+A++KVG+ G +T+++G TL++ L++I GLKFDRGYISPYFINS KG KCEFQ+AF+L+S++KI  V SIVP LEL N+Q  PL+IIAEDVD EALS L++N+LK+ LQ+CAVK+P FG+NR   L D+A+ATGG +FG +   + +E V+L   GR  E+ I+++DT+++ G+G    I  RIE + ++L+   ++YE+E+ L ERL+KLS+G+AV+++ G
Sbjct:   23 GTRAYAKDVRFGSEARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIELKDRFKNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKDGFEKISKGANPVEIRREESMLAVEAVVAELKKLSKPVTTPEEIAQVATISANGDKEIGNLISDAMKKVGRKGVITVKDGKTLHNELQIIEGLKFDRGYISPYFINSAKGQKCEFQDAFLLISEKKISSVQSIVPALELANAQRKPLVIIAEDVDGEALSTLVLNRLKVGLQVCAVKAPGFGDNRKNTLKDLAVATGGTVFGDEALSVNVEDVQLHDFGRVGEVTITKDDTMVLKGKGERAAIEKRIEEIVEQLEATTSDYEKEK-LNERLAKLSDGVAVLKVSG 410          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002094.1 (pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gene:ENSPMAG00000001904.1 transcript:ENSPMAT00000002094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 5.668e-9
Identity = 39/105 (37.14%), Postives = 60/105 (57.14%), Query Frame = 2
Query:  152 ARAQMMEGVELLTKVVSRTLGPKGRNVII--ENSNGSPIIT--KDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVN 454
            AR     G   +  +V  TLGPKG + I+   +S+G  I+T   DG T+ ++I     + N  AKIL D++K  +D+ GDGT++ TVLA  + +EA   I K ++
Sbjct:   22 ARLSSFIGAIYIGDLVKSTLGPKGMDKILLGSSSSGEAIVTVTNDGATILKSI----GVDNPAAKILVDMSKVQDDEVGDGTTSVTVLAAELLREAEILIAKKIH 122          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 56.225 bits (134), Expect = 1.730e-8
Identity = 27/107 (25.23%), Postives = 68/107 (63.55%), Query Frame = 2
Query:  206 TLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAK 526
            +LGPKG + ++ + +G   +T DG T+   + +E+++    AK++ +++++ +D+ GDGT+   VLA ++ ++A   +++G++ I + +G  +   + +  L+++A+
Sbjct:   51 SLGPKGLDKMMVSQDGDITVTNDGATILGMMDVEHQV----AKLMVELSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRISDGYEQAARVAIAHLDSIAE 153          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 52.373 bits (124), Expect = 3.176e-7
Identity = 107/482 (22.20%), Postives = 199/482 (41.29%), Query Frame = 2
Query:  206 TLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASI-----SANNDHSVGNMIS-------EAIRKVGKTGTVTIQN----------GNTLNDTLELINGLKFDRGYISPYFINSDKG-----------SKCEFQNAFILLSQRKIFDVLS-----IVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEIL--NDIAIATGGFLFGQQGDRIPIETV---KLEHLGRA---KEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIA--VVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTGDQNIGIAVVKEALKSPCYTIARNAGVN 1507
            +LGPKG + +I++  G   IT DG T+ + +    ++ +  AK+L +++K  + ++GDGT++  V+A ++   +   + KG++   +     K ++   + L +M    + P ELS   S+     +A N   V    S       +A+ KV    T T  +          G T++D  EL+ GL   +   +   I  +K             K + +N  +L    ++  VL       + +++ +      +L+I + +  +ALS L ++ L                N+++I+   DI      F+    G + PI +V     E L  A   +E+ +  +  + + G  N GK  S + R  ++L +     E ER+L + L  +   +    +  GG + EIEL  +   Y   L + +A              +R  G                   EA++   YT+A NAG+N
Sbjct:   58 SLGPKGMDKMIQDGKGDVTITNDGATILKQM----QVTHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDASAKLLQKGIHPTIISESFQKALEKAQEILESM----SLPLELSDRQSLLNSATTALNSKVVSQYASLLAPMSVDAVMKVIDPATATSVDLNDIKLIRKLGGTIDDC-ELVEGLVLTQRISNTGIIRVEKAKIGLIQFCLSPPKTDMENQIVLSDYTQMDRVLREERTYTLNLVKQVKKAGCNVLLIQKSILRDALSDLALHFL----------------NKMKIMVVKDIEREDIEFICKTIGTK-PIASVDHFTAEMLASAELVEEVSVGSSKVVKVTGCANPGKTMSILVRGSNKLVL----EEAERSLHDALCVIRCLVKKRALIAGGGAPEIELSLRLTEYARTLSSMEA------------YCVRAYG-------------------EAMEVIPYTLAENAGLN 478          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 50.8322 bits (120), Expect = 7.752e-7
Identity = 33/120 (27.50%), Postives = 65/120 (54.17%), Query Frame = 2
Query:  182 LLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSP 541
            ++   V  TLGP+G + +I +  G   I+ DG T+ +  +LE  + +   K L DIA++ + + GDGT++ T+LA  + K+    + +G++   +     K   L ++++    K+I+ P
Sbjct:   30 VVADAVRTTLGPRGMDKLIIDDRGKSTISNDGATILK--LLE--VVHPAGKTLVDIARSQDAEVGDGTTSVTLLAAELLKQVRQYVEEGMHPQIITRAFRKATGLAIEKI----KEISVP 141          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Match: HSP60 (Tetradecameric mitochondrial chaperonin; required for ATP-dependent folding of precursor polypeptides and complex assembly; prevents aggregation and mediates protein refolding after heat shock; role in mtDNA transmission; phosphorylated [Source:SGD;Acc:S000004249])

HSP 1 Score: 465.692 bits (1197), Expect = 4.053e-157
Identity = 254/529 (48.02%), Postives = 370/529 (69.94%), Query Frame = 2
Query:  128 KEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQI-VGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTG-DQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDI--GYDALNDEYVDMFDRGIIDPVKVVKXXXXXXXXXXXXXXXXEVVVVD 1702
            KE+KFG E RA +++GVE L + V+ TLGPKGRNV+IE   G P ITKDGVTVA++I+L+++ +N+GAK+L+++A  TN+ +GDGT++ATVL  +I  E+   +  G N ++LR G    V+ V++ L+   K+IT+ EE++QVA+ISAN D  VG +++ A+ KVGK G +TI+ G TL D LE+  G++FDRG+ISPYFI   K SK EF+   +LLS++KI  +  I+P LE+ N    PLLIIAEDVD EAL+A I+NKL+  +++CAVK+P FG+NR   + DIA+ TGG +F ++ D  P E   +E+LG    I +++ DT+I+ G G +  I+ RIE+++  + I   N+YE+E+ L+ERL+KLS G+AV+R+GG +SE+E+ EKK RY DAL AT+AA++EGI+ GGG AL++    LD + V   DQ +G+ ++++A+  P   I  NAG  G +++ +L+   E G+D   GYDA   EY DM   GIIDP KVV++ L  A+G ASLL T+EV +VD
Sbjct:   25 KELKFGVEGRASLLKGVETLAEAVAATLGPKGRNVLIEQPFGPPKITKDGVTVAKSIVLKDKFENMGAKLLQEVASKTNEAAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGSQVAVEKVIEFLSANKKEITTSEEIAQVATISANGDSHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGMRFDRGFISPYFITDPKSSKVEFEKPLLLLSEKKISSIQDILPALEISNQSRRPLLIIAEDVDGEALAACILNKLRGQVKVCAVKAPGFGDNRKNTIGDIAVLTGGTVFTEELDLKP-EQCTIENLGSCDSITVTKEDTVILNGSGPKEAIQERIEQIKGSIDITTTNSYEKEK-LQERLAKLSGGVAVIRVGG-ASEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALVKASRVLDEVVVDNFDQKLGVDIIRKAITRPAKQIIENAGEEGSVIIGKLID--EYGDDFAKGYDASKSEYTDMLATGIIDPFKVVRSGLVDASGVASLLATTEVAIVD 548          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Match: CCT5 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003825])

HSP 1 Score: 73.9442 bits (180), Expect = 3.876e-14
Identity = 60/220 (27.27%), Postives = 109/220 (49.55%), Query Frame = 2
Query:  128 KEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQIT-SPEEL----------SQVASISANNDHS-VGNMISEAI-------RKVGKTGTVTIQN--GNTLNDTLELINGLKFDRGYISP 724
            K+ + G EA+   +     +  ++  +LGP+G + I+ + +G   IT DG T+   + L+N I    AK+L  ++K+ +D+ GDGT+   VLA ++  +A   I KG++ I++ NG  +   L + +L      I+ S +EL          + + S   + DH     M  EA+       RK      + +Q   G +++D+ +LING+  D+ +  P
Sbjct:   38 KKRQHGLEAKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI----AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDS-KLINGVILDKDFSHP 252          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Match: CCT7 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000003647])

HSP 1 Score: 62.003 bits (149), Expect = 1.762e-10
Identity = 44/140 (31.43%), Postives = 77/140 (55.00%), Query Frame = 2
Query:  128 KEIKFGSEARAQMMEGVELLTKV---VSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITS 538
            KE    S+ + Q++  +     V   +  TLGP G +++I  SN    I+ DG T+ +  +L+  + +  AK L DI++  + + GDGT++ T+LA  + KEA   + +G++   +  G  K V L V+++N +A  ITS
Sbjct:   14 KEGTDASQGKGQIISNINACVAVQEALKPTLGPLGSDILIVTSNQKTTISNDGATILK--LLD--VVHPAAKTLVDISRAQDAEVGDGTTSVTILAGELMKEAKPFLEEGISSHLIMKGYRKAVSLAVEKINELAVDITS 149          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Match: CCT2 (Subunit beta of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000001404])

HSP 1 Score: 55.8398 bits (133), Expect = 1.696e-8
Identity = 34/99 (34.34%), Postives = 61/99 (61.62%), Query Frame = 2
Query:  152 ARAQMMEGVELLTKVVSRTLGPKGRNVIIEN-SNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINK 445
            AR     G   +  +V  TLGPKG + ++++ S+ + ++T DG T+ ++I L+N      AK+L +I+K  +D+ GDGT++ TVL+  + +EA   I++
Sbjct:   18 ARLSAFVGAIAVGDLVKSTLGPKGMDKLLQSASSNTCMVTNDGATILKSIPLDNP----AAKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQ 112          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Match: CCT4 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000002302])

HSP 1 Score: 46.9802 bits (110), Expect = 8.160e-6
Identity = 31/126 (24.60%), Postives = 72/126 (57.14%), Query Frame = 2
Query:  206 TLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVI----ELRNGILKGVDLVVKELNNMAKQITSPEELSQVASIS 571
            +LGPKG + +I+ S G  II+ DG T+ + + + + +    A++L +++   + ++GDGT++  +L  ++   A   +NKG++        ++   + VD++++  + ++  ++  E+L + AS S
Sbjct:   38 SLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPV----ARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDILLEMCHKVS--LSDREQLVRAASTS 157          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Match: EDO49030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHS7])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 287/531 (54.05%), Postives = 398/531 (74.95%), Query Frame = 2
Query:  113 FRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDL-DLLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVKXXXXXXXXXXXXXXXXEVVVVD 1702
            F+   KE+KFG+EARA M++GV+ L   V+ TLGPKG+NVIIE S G P ITKDGVTVA+ I L+++ QN+GA++++D+A NTN+++GDGT+TATVLA SIA E F  ++KG N  E+R G++  VD VV+ L  M+K +T+PEE++QVA+ISAN D ++G +IS A+++VGK G +T+++G TL D LE+I G+KFDRGYISPYFINS KG K EFQ+  +LL Q+KI  V  IVP LEL NS   PL+IIAEDVD EAL+ L++N+LK+ LQI AVK+P FG+NR  +L D+A++TGG +FG       +E + ++  G   EI I+++DT+++ G+GN  +I  R E++ DEL+   ++YE+E+   ERL+KLS+G+A++++GG SSE+E+ EKK R  DAL AT+AA++EGIV GGG+ALLRC+  L D+   + DQ +G+ +VK+AL+ PC TIA NAGV   LVVE+ +  LE  N +GYDA N+ YVDM   GIIDP KVV+TA+T AAG ASLL T+E V+V+
Sbjct:   33 FQNSPKELKFGAEARAAMLQGVDTLADAVAVTLGPKGKNVIIEQSFGGPKITKDGVTVAKAIELKDKYQNIGARLVQDVANNTNEEAGDGTTTATVLARSIATEGFLHVSKGANPQEVRRGVMCAVDSVVESLKKMSKPVTTPEEIAQVATISANGDKNIGELISSAMKRVGKNGVITVKDGKTLRDELEVIEGMKFDRGYISPYFINSSKGQKVEFQDCLLLLCQKKISSVQQIVPALELANSHRKPLVIIAEDVDGEALTTLVLNRLKVGLQIAAVKAPGFGDNRKNMLQDMAVSTGGMVFGDDAIETKLEDITIQDFGEVGEISITKDDTILLRGKGNADEIAKRCEQIRDELESTNSDYEKEK-FNERLAKLSDGVAILKVGG-SSEVEVNEKKDRVTDALNATRAAVEEGIVPGGGVALLRCVPALNDIKMPSKDQQLGVDLVKKALRKPCQTIAENAGVEAALVVEK-VSSLE--NAMGYDAANNTYVDMIQAGIIDPTKVVRTAITDAAGVASLLTTAETVIVE 558          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Match: EDO27990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7R0])

HSP 1 Score: 271.937 bits (694), Expect = 4.007e-85
Identity = 134/326 (41.10%), Postives = 226/326 (69.33%), Query Frame = 2
Query:  419 KEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQI-TSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRC 1393
            KE    +  G N ++L+ GI K V  +V++L+  +K++  S E++ QVA+ISANND ++G++I++A  KVGK G +T++    +   ++++ G++FDRGY+SPYF+        + +N +ILL  +KI ++  I+P+LE +   + PLLIIAEDVD +AL+ L++NKL+  L+I AVK+P FG+ R  +L DIAI TGG +  ++     +E   L+ LG A+ + I +++T I+ G G+   I++R+ +++ +++   ++Y++E+ L+ERL+KL+ G+AV+ + G +SE+E++EKK R  DAL AT+AA++EGIVAGGG+AL+R 
Sbjct:    2 KEGLKNVAAGANPMDLKRGIDKAVTSIVEDLDKQSKKVGNSSEKIKQVAAISANNDDTIGDLIAQAFSKVGKEGVITVEEAKGMETYVDVVEGMQFDRGYLSPYFVTDADKMVADLENPYILLFDKKISNLQEILPILEPVAQSSRPLLIIAEDVDGQALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEE-RGFSLENATLDLLGTAETVTIDKDNTTIVNGSGDAEAIKARVNQIKAQIETTTSDYDKEK-LQERLAKLAGGVAVLYV-GAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRA 324          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Match: EDO27411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9B6])

HSP 1 Score: 59.6918 bits (143), Expect = 3.049e-9
Identity = 107/470 (22.77%), Postives = 196/470 (41.70%), Query Frame = 2
Query:  143 GSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELS------QVASISANNDHSVGNMIS-----EAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSK-----CEFQNAFILLSQRKIFDVLSI--------------VPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRA------------------KEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLK-ERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDL 1405
            G EA+   +     +  ++  +LGPKG + ++ + +G   +T DG T+   + ++++I    AK++ +++K+ +++ GDGT+   VLA ++ + A   ++ G++ I + +G      + ++ ++++A     P   S       +A I+ +   SV ++       E I+  GK        G  L+DT+ L+ G+  D+    P      K +K     C F+        +   DV ++                +++ +      L I     D EA   L+ N L       AV+    G   +E+   IAIATGG +  +         +  E LG+A                  +E H SR  T+ I G GN+  +      + D L +V N     R +     ++LS  IA+ +     + IE    +A Y DAL     AL E      GL  ++ + D+
Sbjct:   24 GLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQI----AKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIADNFPLPLGYSVSRCHRPLAEIAVDAVLSVADLERKDVDFELIKVEGK-------EGGKLDDTV-LVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHK--LDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWGFDDEANHLLLQNHLP------AVR--WVGGPEIEL---IAIATGGRIVPR------FSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHNSRAVTIFIRG-GNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKIATIEQYAMRA-YADALDNIPLALAE----NSGLNPIQTVADI 456          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Match: EDO34981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT1])

HSP 1 Score: 55.4546 bits (132), Expect = 6.081e-8
Identity = 128/543 (23.57%), Postives = 212/543 (39.04%), Query Frame = 2
Query:  152 ARAQMMEGVELLTKVVSRTLGPKGRNVIIEN--SNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVV------------------KELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQ----NGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQR-------KIF------DVLSIVPVLELINSQNVP---LLIIAEDVDSEALSALIMN---KLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQG-NEGK---IRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRI--GGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTGDQNIGIAVVKEALKSPCYTIARNAGVN-GDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKV 1630
            AR     G   +  +V  TLGPKG + I+++   NG+  +T DG T+ ++I     I N  AKIL +++K  +D+ GDGT++ TVL   + KEA   ++  ++   +  G  K V                      ++L N+A+   S + L Q      + DH     +   +R  G      IQ     G  + D+         D G++    I  ++  K E  NA IL++         K+F      D  + +  LE+   Q +     +II  D++      LI N   +L  +  + A++   F     E +  +A+ TGG +    G     + VKL    + +E+ I  +  +   G   NE     IR   +++ D         E ER+L + L  L+  +   R   GG +SE+ +    A  +  L A                              G +   +     AL+     IA NAG +  DLV +      +  N  G + +N    DM D GI +  +V
Sbjct:   22 ARLSSFVGAIAIGDLVKSTLGPKGMDKILQSFGQNGNIQVTNDGATILKSI----GIDNPAAKILVELSKVQDDEVGDGTTSVTVLTSELLKEAEKLVSCKIHPQTIVAGWRKSVKAAEKALEAAAVDHSSDPEKFREDLMNIARTTLSSKILVQ------HRDHFAKLAVDAVLRLKGSGDLNAIQIIKKLGGGMVDSF-------LDEGFLLDKKIGVNQPKKIE--NAKILIANTPMDADKIKVFGSRVRVDSTAKIADLEMAEKQKMKEKVEMIIKHDINCFINRQLIYNYPEQLFADAGVMAIEHADF-----EGVERLALVTGGEIVSTFGRP---DLVKLGTCKKIEEVMIGEDKLIHFSGCALNEACTVVIRGATQQILD---------EAERSLHDALCVLTQTVKETRTVNGGGASEVLM----AHAVSQLAAK---------------------------TPGKEAAAMESFATALRQLPTIIADNAGYDSADLVAKLRAAHTQGKNTYGLNMVNGTVGDMRDLGITESYQV 497          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Match: EDO49571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP0])

HSP 1 Score: 55.4546 bits (132), Expect = 6.186e-8
Identity = 106/478 (22.18%), Postives = 195/478 (40.79%), Query Frame = 2
Query:  143 GSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQIT----SPEELSQVA------SISANNDHSVGNMISEAIRKVGKTG---------TVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSK-----CEFQNAFILLSQRKIFDVLSI--------------VPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRA------------------KEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLK-ERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDL 1405
            G EA+   +     +  ++  +LGPKG + ++ + +G   +T DG T+   + ++++I    AK++ +++K+ +++ GDGT+   VLA ++ + A   ++ G++ I + +G      + ++ ++++A        + E L Q A       I +     +  +  +A+  V              V  + G  L+DT+ L+ G+  D+    P      K +K     C F+        +   DV ++                +++ +      L I     D EA   L+ N L       AV+    G   +E+   IAIATGG +  +         +  E LG+A                  +E H SR  T+ I G GN+  +      + D L +V N     R +     ++LS  IA+ +     S IE    +A Y DAL     AL E      GL  ++ + D+
Sbjct:   36 GLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQI----AKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIADNFPVDKDNKESLIQTAMTTLGSKIVSRCHRPLAEIAVDAVLSVADLERKDVDFELIKVEGKEGGKLDDTV-LVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHK--LDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWGFDDEANHLLLQNHLP------AVR--WVGGPEIEL---IAIATGGRIVPR------FSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHNSRAVTIFIRG-GNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKISTIEQYAMRA-YADALDNIPLALAE----NSGLNPIQTVADI 483          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Match: hspd1 (heat shock protein family D (Hsp60) member 1 [Source:NCBI gene;Acc:101163801])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 266/508 (52.36%), Postives = 390/508 (76.77%), Query Frame = 2
Query:  116 RTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVT-GDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            R +AK++KFG++ARA M++GV+LL   V+ T+GPKGR VIIE S GSP +TKDGVTVA++I L+++ +N+GA++++D+A NTN+++GDGT+TATVLA +IAKE F+ I+KG N +E+R G++  V+ V+ EL  ++K +T+PEE++QVA+ISAN D  +GN+IS A++KVG+ G +T+++G TL D LE+I G+KFDRGYISPYFIN+ KG KCEFQ+A++LLS++KI  V SIVP LE+ N    PL+I+AEDVD EALS L++N+LK+ LQ+ AVK+P FG+NR   L D+A+ATGG +FG +   + +E ++    G+  E+ I+++DTL++ G GN   +  R   + ++L+   ++YE+E+ L ERL+KLS+G+AV+++GG +S++E+ EKK R  DAL AT+AA++EGIV GGG ALLRCI  LD L     DQ IG+ +++ +L+ P  TIA+NAGV+G LVVER+L+    G ++GYDA+  EYV+M ++GIIDP KVV+
Sbjct:   24 RAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGARLVQDVANNTNEEAGDGTTTATVLARAIAKEGFDNISKGANPVEIRRGVMMAVEAVIGELQRLSKPVTTPEEIAQVATISANGDTEIGNIISNAMKKVGRKGVITVKDGKTLQDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYLLLSEKKISSVQSIVPALEIANQHRKPLVIVAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAVATGGTVFGDEALGLALEDIQAHDFGKVGEVQITKDDTLLLRGGGNPADVEKRAAEIAEQLESTTSDYEKEK-LNERLAKLSDGVAVLKVGG-TSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPFLDTLKAANSDQKIGVDIIRRSLRIPAMTIAKNAGVDGSLVVERILQG---GAELGYDAMQGEYVNMVEKGIIDPTKVVR 526          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:101158813])

HSP 1 Score: 56.9954 bits (136), Expect = 4.299e-8
Identity = 41/116 (35.34%), Postives = 64/116 (55.17%), Query Frame = 2
Query:  113 FRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENS--NGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVN 454
            FR+ A E K    AR     G   +  +V  TLGPKG + I+ +   +G+  +T DG T+ + I     + N  AK+L D++K  +D+ GDGT++ TVLA  + +EA   I K ++
Sbjct:    7 FRSGADEEK-AETARLSSFVGAIAIGDLVKSTLGPKGMDKILLSGGKSGTVTVTNDGATILKAI----GVDNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIH 117          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:101158813])

HSP 1 Score: 56.9954 bits (136), Expect = 5.645e-8
Identity = 41/116 (35.34%), Postives = 64/116 (55.17%), Query Frame = 2
Query:  113 FRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENS--NGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVN 454
            FR+ A E K    AR     G   +  +V  TLGPKG + I+ +   +G+  +T DG T+ + I     + N  AK+L D++K  +D+ GDGT++ TVLA  + +EA   I K ++
Sbjct:   12 FRSGADEEK-AETARLSSFVGAIAIGDLVKSTLGPKGMDKILLSGGKSGTVTVTNDGATILKAI----GVDNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIH 122          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 55.4546 bits (132), Expect = 1.580e-7
Identity = 36/119 (30.25%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  197 VSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELS 553
            V  +LGPKG + +I++  G   IT DG T    I+ + ++ +  AK+L +++K  + ++GDGT++  ++A ++ +     + KG++   +     K VD  V+ LN M++    P ELS
Sbjct:   45 VRTSLGPKGMDKMIQDEKGDVTITNDGAT----ILKQMQVLHPSAKMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMSR----PVELS 155          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:101171367])

HSP 1 Score: 50.447 bits (119), Expect = 5.643e-6
Identity = 104/441 (23.58%), Postives = 187/441 (42.40%), Query Frame = 2
Query:  206 TLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITS-PEELS--------------------QVASISANNDHSVGNMIS-----EAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSK-----CEFQNAFILLSQRKIFDVLSI--------------VPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIP--IETVKL----------EHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLK-ERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDE 1354
            +LGP G + ++ + +G   +T DG T+   + ++++I    AK++ +++K+ +D+ GDGT+   VLA ++ +EA   +++G++ I + +G  +   + +++L+ +A+     P  L                     Q+A I+ N   +V +M       E I+  GK        G  L DT +LI G+  D+ +  P      K  K     C F+        +   DV S+                +++ + S    L I     D EA   L+ N+L       AV+    G   +E+   IAIATGG +  +  +  P  + T  L          +H+   +E   +R  T+ I G GN+  I      L D L ++ N     R +     S+++  +AV R       +E    ++ + DAL+    AL E
Sbjct:   51 SLGPNGLDKMMVDRDGEVTVTNDGATILSMMDVDHQI----AKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAELLLDRGIHPIRISDGYDQAARIAIEKLDKIAETFPCDPNNLEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMQRKDVDFELIKVEGKV-------GGKLEDT-QLIKGVIVDKEFSHPQMPKELKDVKIAILTCPFEPPKPKTKHK--LDVTSVEDYKALQKYEKEKFEEMIQQVKSNGANLAICQWGFDDEANHLLLQNELP------AVR--WVGGPEIEL---IAIATGGRIVPRFSELTPEKLGTAGLVKELSFGTTKDHMLVIQECKNTRAVTIFIRG-GNKMIIEEAKRALHDALCVIRNLIRDNRVVYGGGASEIACALAVNRAADKCPSLEQYAMRS-FADALEVIPMALAE 464          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Match: SMESG000005331.1 (SMESG000005331.1)

HSP 1 Score: 1068.14 bits (2761), Expect = 0.000e+0
Identity = 553/557 (99.28%), Postives = 554/557 (99.46%), Query Frame = 2
Query:   74 MFRQICVQNYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVKXXXXXXXXXXXXXXXXEVVVVDEEAGETVDESETSP 1744
            MFRQICVQNYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSP FGENRLEILNDIAIATGGFLFGQQGDRIPIE VKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQ TQAALDEGIVAGGGLALLRCIGDLDLLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVV+TALTGAAGAASLLITSEVVVVDEEAGETVDESETSP
Sbjct:    1 MFRQICVQNYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPGFGENRLEILNDIAIATGGFLFGQQGDRIPIEAVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQVTQAALDEGIVAGGGLALLRCIGDLDLLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVRTALTGAAGAASLLITSEVVVVDEEAGETVDESETSP 557          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Match: SMESG000065325.1 (SMESG000065325.1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 291/507 (57.40%), Postives = 407/507 (80.28%), Query Frame = 2
Query:  119 TFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLD-LLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVK 1636
            T+AK++KFG+EAR+ M+ GV++L   V+ T+GPKGRNVI+E S GSP ITKDGVTVA++I L+++ QN+GA++++D+A NTN+++GDGT+ ATVLA +IAKE F +I+KG N I+ R G++  VD VV  L  M+K +T+PEE++QVA+ISAN D S+G++ISEA++KVGK GT+T+++G TL+D LE+I G+KFDRGYISPYFIN+DKG+KCEFQ+AFIL S++KI  + S++PVLE+ + Q  PLLI+AEDVD EAL+AL++N+LKL LQ+CAVK+P FG+NR   L D+A ATGG +FG + +   IE V+L  LGRA+E+ I+++DTL++ G+G    I+ RIE ++DE+ +  + YE+E+ ++ERLSKLSNG+AV+++GG SSE+E+ EKK RY DAL AT+AA++EGIV GGG AL+RCI  LD L   T DQ IGI +V++AL +PCYTIA NAGVN  +VVE++     + N++GYDA+NDEYV+M ++GIIDP KVV+
Sbjct:   23 TYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEK-MQERLSKLSNGVAVIKVGG-SSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKV---FSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVR 524          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Match: SMESG000012740.1 (SMESG000012740.1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.186e-12
Identity = 82/333 (24.62%), Postives = 152/333 (45.65%), Query Frame = 2
Query:  143 GSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEE---------LSQVASISANNDH------SVGNMIS-----------EAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSK-----CEFQNAF------ILLSQRKIFDVLS------IVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGG 1012
            G +A    +   + ++ ++  +LGPKG + I+ N +    +T DG T+ E + +E+ I    AK++ +++K+ +D+ GDGT+   VLA S+ ++A   + +G++ I + +G      L ++EL+ ++ Q    +E         ++ + S   N  H      +VG ++S           E I+  GK        G TL+D++ L+ G+  D+ +  P    S K +K     C F+         + +   K F+ L+       V +++ + +    L+I     D EA      N L     + AV+    G   +E+   IAIATGG
Sbjct:   32 GIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEI----AKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKV-------GGTLSDSI-LVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEA------NHLLYQKNLPAVR--WVGGPEIEL---IAIATGG 341          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Match: SMESG000078668.1 (SMESG000078668.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.820e-10
Identity = 50/207 (24.15%), Postives = 106/207 (51.21%), Query Frame = 2
Query:  143 GSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQ--ITSPEELSQVASISANNDHSVGNM--------ISEAIRKVGKTG--------TVTIQNGNTLNDTLELINGLKFDR 709
            GS  R+  +   + +   V  +LGP+G + +I+ S G   +T DG T+ + +    ++ +  A+++  ++++ + ++GDGT++  V+A S+       ++KG++   +     K  ++  + L N +++  I++ E L ++AS S N+   VG          +   +R + KT          +T++ G T+ DT+ L++GL  DR
Sbjct:   16 GSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRM----KLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSK-VVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTV-LVDGLIIDR 216          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.099e-6
Identity = 101/471 (21.44%), Postives = 198/471 (42.04%), Query Frame = 2
Query:  197 VSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELS------QVASISANNDHSVGNMISEAIRKVGKTGTVTIQN------------------GNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLEL---INSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENRLEILNDIAIATGGFLFGQQGDRIPIETVKL---EHLGRAKEI-HISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRI---------GGCSSEIELREKKARYIDAL--------QATQAALD---EGIVAGGGLALLRCIGDLDLLDVTGDQNIGIAVVK 1456
            +  +LGPKG + +I+   G   IT DG T+ + +    ++ +  A++L +++K  + ++GDGT+T  VLA S        ++KG++   + +      +L   +   + + ++ P +L+      ++AS S N+   V +  S  +  +     + IQ+                  G T+ DT EL++GL  DR   S   + + + +K  F    I   + ++   + +    ++   +  +   +L I + + +   + L++ K  L   +  +    F +  + I+  IA     F+    G + PI  V+    E LG AK +  +    + I+   G E   ++    L    ++V +  ER          L + + VVR          GG + EIE+ +K A Y ++L        +A   A+D     +    GL  +  + +L  +   G  N GI + K
Sbjct:   43 IRTSLGPKGMDKMIQEGKGDVTITNDGATILKRM----KLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSF----NLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNS--KVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDT-ELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCK-PIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERS---------LHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGKSQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKK 492          
The following BLAST results are available for this feature:
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPD10.000e+052.65heat shock protein family D (Hsp60) member 1 [Sour... [more]
HSPD10.000e+052.65heat shock protein family D (Hsp60) member 1 [Sour... [more]
HSPD14.053e-8458.29heat shock protein family D (Hsp60) member 1 [Sour... [more]
HSPD17.894e-7753.95heat shock protein family D (Hsp60) member 1 [Sour... [more]
HSPD13.970e-3960.00heat shock protein family D (Hsp60) member 1 [Sour... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-600.000e+052.45Chaperonin homolog Hsp-60, mitochondrial [Source:... [more]
hsp-600.000e+052.45Chaperonin homolog Hsp-60, mitochondrial [Source:... [more]
hsp-602.146e-5045.66Chaperonin homolog Hsp-60, mitochondrial [Source:... [more]
hsp-602.199e-4355.00Chaperonin homolog Hsp-60, mitochondrial [Source:... [more]
hsp-602.199e-4355.00Chaperonin homolog Hsp-60, mitochondrial [Source:... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsp60A0.000e+052.54gene:FBgn0015245 transcript:FBtr0073434[more]
Hsp60A0.000e+052.54gene:FBgn0015245 transcript:FBtr0073435[more]
Hsp60C0.000e+052.23gene:FBgn0031728 transcript:FBtr0079112[more]
Hsp60C0.000e+052.23gene:FBgn0031728 transcript:FBtr0079111[more]
Hsp60C0.000e+052.23gene:FBgn0031728 transcript:FBtr0079110[more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspd10.000e+051.44heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
hspd10.000e+051.44heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
cct52.424e-720.94chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct49.548e-722.27chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct72.705e-625.78chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspd10.000e+052.36heat shock protein family D (Hsp60) member 1 [Sour... [more]
hspd10.000e+052.36heat shock protein family D (Hsp60) member 1 [Sour... [more]
cct51.160e-924.36chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct51.389e-924.36chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
dennd1b1.023e-630.53DENN/MADD domain containing 1B [Source:Xenbase;Acc... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspd10.000e+053.74heat shock protein 1 (chaperonin) [Source:MGI Symb... [more]
Hspd11.552e-6655.31heat shock protein 1 (chaperonin) [Source:MGI Symb... [more]
Hspd13.678e-4358.82heat shock protein 1 (chaperonin) [Source:MGI Symb... [more]
Cct55.346e-1023.71chaperonin containing Tcp1, subunit 5 (epsilon) [S... [more]
Cct51.569e-922.69chaperonin containing Tcp1, subunit 5 (epsilon) [S... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18687|CH60_CRIGR0.000e+053.9460 kDa heat shock protein, mitochondrial OS=Cricet... [more]
sp|P63039|CH60_RAT0.000e+053.7460 kDa heat shock protein, mitochondrial OS=Rattus... [more]
sp|P63038|CH60_MOUSE0.000e+053.7460 kDa heat shock protein, mitochondrial OS=Mus mu... [more]
sp|Q5ZL72|CH60_CHICK0.000e+052.9560 kDa heat shock protein, mitochondrial OS=Gallus... [more]
sp|P10809|CH60_HUMAN0.000e+052.6560 kDa heat shock protein, mitochondrial OS=Homo s... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A481NV520.000e+056.61Heat shock protein 60 OS=Dugesia japonica OX=6161 ... [more]
F8J4970.000e+055.98Heat shock protein 60 OS=Neobenedenia melleni OX=2... [more]
A0A183WHZ60.000e+055.27Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A183K6N70.000e+053.36Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A094ZZQ10.000e+053.5060 kDa heat shock protein, mitochondrial OS=Schist... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspd10.000e+052.40heat shock protein family D (Hsp60) member 1 [Sour... [more]
cct47.978e-822.93chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct22.101e-735.34chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct53.957e-722.18chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct25.407e-735.34chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspd11.652e-15253.98heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000002094.15.668e-937.14pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gen... [more]
cct51.730e-825.23chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct43.176e-722.20chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct77.752e-727.50chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HSP604.053e-15748.02Tetradecameric mitochondrial chaperonin; required ... [more]
CCT53.876e-1427.27Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT71.762e-1031.43Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT21.696e-834.34Subunit beta of the cytosolic chaperonin Cct ring ... [more]
CCT48.160e-624.60Subunit of the cytosolic chaperonin Cct ring compl... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490300.000e+054.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279904.007e-8541.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274113.049e-922.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349816.081e-823.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495716.186e-822.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspd10.000e+052.36heat shock protein family D (Hsp60) member 1 [Sour... [more]
cct24.299e-835.34chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct25.645e-835.34chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct41.580e-730.25chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct55.643e-623.58chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005331.10.000e+099.28SMESG000005331.1[more]
SMESG000065325.10.000e+057.40SMESG000065325.1[more]
SMESG000012740.12.186e-1224.62SMESG000012740.1[more]
SMESG000078668.11.820e-1024.15SMESG000078668.1[more]
SMESG000060610.11.099e-621.44SMESG000060610.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004256 ID=SMED30004256|Name=60 kDa heat shock protein, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=2205bp
CAGAAAAGGAAAGAAATAACCATATTAGCAAATTTAATAATTGCACGTTA
TTTGTTTAAGATATTAATTTGACATGTTTCGACAAATTTGTGTTCAAAAT
TATAAACTTGGTTTTAGAACATTTGCGAAAGAAATTAAATTTGGTTCTGA
GGCAAGAGCTCAAATGATGGAAGGTGTTGAATTGCTTACTAAAGTAGTTT
CGCGTACATTAGGTCCGAAAGGCAGAAATGTTATTATTGAAAATTCAAAT
GGTTCTCCAATTATTACAAAAGATGGAGTTACAGTGGCTGAAAATATTAT
TTTAGAAAATAGAATTCAAAATTTAGGTGCTAAAATATTGCGAGATATCG
CCAAAAATACAAACGATAAATCCGGTGATGGTACTTCTACAGCAACTGTT
TTGGCGTGCTCGATTGCTAAAGAGGCATTTAATAGAATAAACAAAGGAGT
TAATGTTATTGAATTACGCAATGGAATTCTGAAAGGAGTAGATTTAGTTG
TTAAAGAATTAAATAACATGGCTAAACAAATAACCAGCCCAGAAGAATTG
TCTCAAGTGGCTTCTATATCAGCAAATAATGATCATTCCGTTGGAAACAT
GATTTCTGAAGCTATTCGCAAAGTAGGTAAAACCGGAACTGTGACAATTC
AAAATGGAAACACTTTGAATGATACATTAGAGCTAATCAATGGACTGAAA
TTCGATCGGGGATATATTTCACCCTATTTCATTAACTCAGACAAAGGATC
CAAATGTGAATTCCAAAATGCATTTATTCTTTTATCGCAGAGAAAAATAT
TCGATGTTCTTTCAATTGTTCCCGTTTTGGAGCTAATCAATTCCCAAAAC
GTTCCTTTATTGATTATTGCCGAAGATGTCGACAGCGAGGCATTGAGTGC
TCTAATTATGAATAAGTTGAAATTGAATTTGCAAATCTGCGCGGTAAAAT
CTCCCAGTTTCGGTGAAAATCGATTGGAAATCCTAAACGATATCGCAATA
GCAACCGGGGGATTTCTGTTCGGTCAACAAGGGGACCGGATTCCAATCGA
AACGGTTAAACTGGAACATTTAGGGAGAGCGAAAGAAATTCACATCAGTC
GAAATGATACGTTGATAATCGGTGGTCAAGGTAACGAGGGGAAAATCAGG
TCGAGGATTGAAAGGCTGGAAGATGAATTGCAAATCGTAGGGAATAATTA
TGAGCGAGAAAGAAACCTGAAAGAAAGATTGAGTAAATTGTCCAATGGGA
TTGCAGTAGTGAGAATCGGCGGATGCAGCAGTGAAATCGAGCTCAGAGAG
AAAAAGGCGAGATATATCGATGCTTTACAGGCGACTCAGGCTGCTCTTGA
TGAGGGAATTGTTGCTGGAGGAGGTTTGGCGTTGTTGAGATGCATTGGAG
ATCTGGATTTGCTGGACGTGACGGGCGATCAGAACATCGGGATAGCAGTT
GTCAAGGAGGCTTTGAAATCGCCTTGCTATACAATTGCGAGAAATGCTGG
CGTTAACGGTGATCTGGTGGTGGAGAGGTTGTTAAAGCAATTAGAAATTG
GGAACGACATTGGGTATGATGCACTGAATGATGAGTATGTTGACATGTTT
GATCGGGGAATTATCGATCCGGTTAAGGTCGTTAAGACGGCCTTAACTGG
CGCGGCCGGTGCTGCCTCGTTGCTGATTACGTCGGAAGTAGTTGTGGTGG
ACGAGGAGGCCGGTGAAACGGTAGATGAATCGGAAACCAGCCCAGAAATG
GAGATGATGTGAAATTGATTTTTCAGAGAATTCTTGAACTGCATTTAATT
TTTAAATTCTGATTGGTTGAATTATTTTGAATTTGTTAATATGGTATTTA
TTAGCACAACTTTTAGGAGAAATTTTAAAACTTCACAGAAACGTAATTGA
CCTTTGTCTACAGCTGTGATACAACCGTATCTTTAGGGGTACTACAGGTA
AAATATTATGAAAAACCAGATTGAAACTTGAACCAGAATTTCGTCTAAAA
TTCACATTATTAAACTCTGATAATATTGAGTTATGCAAATTTAGACAAGT
TGAGTAGTAACTAGTTCTCAGTTAAATGTGCAATTAACAATTATTTATCT
GATGACAATGAATTTCAGATAATATAAACTTTACTGATTAATAAAATAGA
ATACCAAATTACAATGGCACTGCTACTTCTGGATTCAACACTCTGTTAAA
TCGAT
back to top

protein sequence of SMED30004256-orf-1

>SMED30004256-orf-1 ID=SMED30004256-orf-1|Name=SMED30004256-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=563bp
MFRQICVQNYKLGFRTFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKG
RNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKS
GDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMA
KQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLND
TLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVP
VLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPSFGENR
LEILNDIAIATGGFLFGQQGDRIPIETVKLEHLGRAKEIHISRNDTLIIG
GQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGG
CSSEIELREKKARYIDALQATQAALDEGIVAGGGLALLRCIGDLDLLDVT
GDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDA
LNDEYVDMFDRGIIDPVKVVKTALTGAAGAASLLITSEVVVVDEEAGETV
DESETSPEMEMM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0001530lipopolysaccharide binding
GO:0002039p53 binding
GO:0003725double-stranded RNA binding
GO:0008035high-density lipoprotein particle binding
GO:0016853isomerase activity
GO:0019899enzyme binding
GO:0031625ubiquitin protein ligase binding
GO:0034185apolipoprotein binding
GO:0034186apolipoprotein A-I binding
GO:0051087chaperone binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0002368B cell cytokine production
GO:0002755MyD88-dependent toll-like receptor signaling pathway
GO:0002842positive regulation of T cell mediated immune response to tumor cell
GO:0006919activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006986response to unfolded protein
GO:0032727positive regulation of interferon-alpha production
GO:0032729positive regulation of interferon-gamma production
GO:0032733positive regulation of interleukin-10 production
GO:0032735positive regulation of interleukin-12 production
GO:0032755positive regulation of interleukin-6 production
GO:0042100B cell proliferation
GO:0042110T cell activation
GO:0042113B cell activation
GO:0043032positive regulation of macrophage activation
GO:0043065positive regulation of apoptotic process
GO:0043066negative regulation of apoptotic process
GO:0048291isotype switching to IgG isotypes
GO:0050821protein stabilization
GO:0050870positive regulation of T cell activation
GO:0051702interaction with symbiont
GO:0098761cellular response to interleukin-7
GO:0042026protein refolding
GO:0006457protein folding
GO:0009409response to cold
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0005769early endosome
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005905clathrin-coated pit
GO:0009986cell surface
GO:0016020membrane
GO:0030135coated vesicle
GO:0030141secretory granule
GO:0032991macromolecular complex
GO:0043231intracellular membrane-bounded organelle
GO:0046696lipopolysaccharide receptor complex
GO:0070062extracellular exosome
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
GO:0043234protein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR027410TCP-1-like_intermed_sf
IPR001844Chaprnin_Cpn60
IPR027413GROEL-like_equatorial_sf
IPR002423Cpn60/TCP-1
IPR027409GroEL-like_apical_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 362..382
NoneNo IPR availablePANTHERPTHR45633:SF360 KDA HEAT SHOCK PROTEIN, MITOCHONDRIALcoord: 18..546
NoneNo IPR availablePANTHERPTHR45633FAMILY NOT NAMEDcoord: 18..546
IPR001844Chaperonin Cpn60PRINTSPR00298CHAPERONIN60coord: 42..68
score: 63.46
coord: 283..306
score: 45.86
coord: 367..392
score: 27.22
coord: 416..437
score: 64.53
coord: 98..125
score: 48.29
IPR001844Chaperonin Cpn60TIGRFAMTIGR02348TIGR02348coord: 18..545
e-value: 5.3E-182
score: 603.9
IPR001844Chaperonin Cpn60CDDcd03344GroELcoord: 19..543
e-value: 0.0
score: 673.015
IPR002423Chaperonin Cpn60/TCP-1 familyPFAMPF00118Cpn60_TCP1coord: 38..544
e-value: 4.7E-79
score: 266.3
IPR027409GroEL-like apical domain superfamilyGENE3DG3DSA:3.50.7.10coord: 207..390
e-value: 2.0E-196
score: 655.3
IPR027409GroEL-like apical domain superfamilySUPERFAMILYSSF52029GroEL apical domain-likecoord: 199..393
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 22..541
e-value: 2.0E-196
score: 655.3
IPR027413GroEL-like equatorial domain superfamilySUPERFAMILYSSF48592GroEL equatorial domain-likecoord: 21..541
IPR027410TCP-1-like chaperonin intermediate domain superfamilyGENE3DG3DSA:3.30.260.10coord: 152..428
e-value: 2.0E-196
score: 655.3
IPR027410TCP-1-like chaperonin intermediate domain superfamilySUPERFAMILYSSF54849GroEL-intermediate domain likecoord: 153..218