Hexosyltransferase

Overview
NameHexosyltransferase
Smed IDSMED30004253
Length (bp)1541
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hexosyltransferase (SMED30004253) t-SNE clustered cells

Violin plots show distribution of expression levels for Hexosyltransferase (SMED30004253) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hexosyltransferase (SMED30004253) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hexosyltransferase (SMED30004253) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004253

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004253SMESG000042545.1 dd_Smed_v4_6589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004253SMESG000042545.1 dd_Smed_v4_6589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004253SMESG000042545.1 dd_Smed_v4_6589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004253SMESG000042545.1 dd_Smed_v4_6589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GNT10 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 10 (putative) [Source:HGNC Symbol;Acc:HGNC:53652])

HSP 1 Score: 66.6254 bits (161), Expect = 2.843e-11
Identity = 47/179 (26.26%), Postives = 93/179 (51.96%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVAR 1144
            F++ L+ S+  N   R+ IR++W ++  +    + TLF +    P++   +  + KE+ +  D++    L S + +    + M Q++V  C  + + + +++  FVNLP+L + +L  K+       + + + +V   V   R+ ++  +V   E+PEK+YP YC      +MSQ VAR
Sbjct:   85 FLLSLIFSSPGNGTRRDLIRKTWGNVTSVQGHPILTLFAL--GMPVSVTTQKEINKESCKNNDIIEGIFLDSSENQTLKIIAMIQWAVAFCPNALFILKVDEETFVNLPSLVDYLLNLKE-----HLEDIYVGRVLHQVTPNRDPQNRDFVPLSEYPEKYYPDYCS-GEAFIMSQDVAR 255          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:916])

HSP 1 Score: 64.3142 bits (155), Expect = 1.155e-10
Identity = 53/211 (25.12%), Postives = 104/211 (49.29%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDK-PLTDKQKAAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F+V L+ +    F  R+ IR++W         K+ TLF +  +  P+ ++    +++E++ ++D++    + S     L+  + M   + F C K++Y +  +  +FVN+  L   +L      ST  R+      V  N   +R+ +S WY+    +P+ +YP +C  T G + S  VA  +   S ++  L + DV++ G+  +KL I+
Sbjct:   79 FLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQM---VEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATF-CSKAKYVMKTDSDIFVNMDNLIYKLLK----PSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGT-GYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 278          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GNT5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:15684])

HSP 1 Score: 63.5438 bits (153), Expect = 3.183e-10
Identity = 62/269 (23.05%), Postives = 121/269 (44.98%), Query Frame = 2
Query:  473 RELVNELNSAKDYRKICSNNKSPNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNV-DNFPMREKIRQSWSS---IRQMHESKLNTLFFVYSDKPLTDKQ-KAAMKKENEQYYDVVYFPVLFSQKTELEFY------LKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGI--VMSQYVARDLLMCSFYSN-KLWINDVFLT------GILPQ 1219
            R L+N  +   D   +   +  P   + I+      +   C     ++ L V    +N+  R  IR++W +   +R    + + TLF + +  PL  ++ +  +  E+++Y D++       Q     FY      L  F ++   C  +++ +  +D +F+++P L E + + + I      +   + +V +    +R+K S +YV+ + +    +PAY D T G   V+S  VA  +   S   N  L+I+DVF+       GI+PQ
Sbjct:   49 RYLINSYDFVNDTLSLKHTSAGPRYQYLIN------HKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDII------QQDFVDSFYNLTLKLLMQFSWANTYCPHAKFLMTADDDIFIHMPNLIEYLQSLEQIGV----QDFWIGRVHRGAPPIRDKSSKYYVSYEMY---QWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQ 298          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GNT5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:15684])

HSP 1 Score: 63.5438 bits (153), Expect = 3.183e-10
Identity = 62/269 (23.05%), Postives = 121/269 (44.98%), Query Frame = 2
Query:  473 RELVNELNSAKDYRKICSNNKSPNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNV-DNFPMREKIRQSWSS---IRQMHESKLNTLFFVYSDKPLTDKQ-KAAMKKENEQYYDVVYFPVLFSQKTELEFY------LKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGI--VMSQYVARDLLMCSFYSN-KLWINDVFLT------GILPQ 1219
            R L+N  +   D   +   +  P   + I+      +   C     ++ L V    +N+  R  IR++W +   +R    + + TLF + +  PL  ++ +  +  E+++Y D++       Q     FY      L  F ++   C  +++ +  +D +F+++P L E + + + I      +   + +V +    +R+K S +YV+ + +    +PAY D T G   V+S  VA  +   S   N  L+I+DVF+       GI+PQ
Sbjct:   49 RYLINSYDFVNDTLSLKHTSAGPRYQYLIN------HKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDII------QQDFVDSFYNLTLKLLMQFSWANTYCPHAKFLMTADDDIFIHMPNLIEYLQSLEQIGV----QDFWIGRVHRGAPPIRDKSSKYYVSYEMY---QWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQ 298          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GNT5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:15684])

HSP 1 Score: 63.5438 bits (153), Expect = 3.183e-10
Identity = 62/269 (23.05%), Postives = 121/269 (44.98%), Query Frame = 2
Query:  473 RELVNELNSAKDYRKICSNNKSPNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNV-DNFPMREKIRQSWSS---IRQMHESKLNTLFFVYSDKPLTDKQ-KAAMKKENEQYYDVVYFPVLFSQKTELEFY------LKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGI--VMSQYVARDLLMCSFYSN-KLWINDVFLT------GILPQ 1219
            R L+N  +   D   +   +  P   + I+      +   C     ++ L V    +N+  R  IR++W +   +R    + + TLF + +  PL  ++ +  +  E+++Y D++       Q     FY      L  F ++   C  +++ +  +D +F+++P L E + + + I      +   + +V +    +R+K S +YV+ + +    +PAY D T G   V+S  VA  +   S   N  L+I+DVF+       GI+PQ
Sbjct:   49 RYLINSYDFVNDTLSLKHTSAGPRYQYLIN------HKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDII------QQDFVDSFYNLTLKLLMQFSWANTYCPHAKFLMTADDDIFIHMPNLIEYLQSLEQIGV----QDFWIGRVHRGAPPIRDKSSKYYVSYEMY---QWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQ 298          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: B0024.15 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q8MQG4])

HSP 1 Score: 58.9214 bits (141), Expect = 3.257e-9
Identity = 54/215 (25.12%), Postives = 99/215 (46.05%), Query Frame = 2
Query:  593 CPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLN--TLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSI 1231
            C   + +   ++S   NF +R+ IR++W++         N   + F+ S K   +    A++KE E++ D++   +  S +  +     +  +    C  +++ + ++D + V++  L+ S L +K   S N    ++     KN   VR KK  WYV    + EK +P Y D    ++    V R L     Y N+  I DVF TG++ + L I
Sbjct:   81 CSNNTKLQITILSTAGNFDIRQAIRETWANPNNSEHVANNDVRISFIIS-KTSNEFLNFALQKEIEKFDDMIVTDLYESYELLILKVHAILSYKQSHCQLADFQLKIDDDMAVDMDGLYRS-LEDKKQASINGISGIIW----KNSPPVREKKHRWYVPKTLYSEKFFPPYIDGPIYLIGKNAVPRMLEEAKNY-NQWIIEDVFWTGVIGKALKI 288          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: B0024.15 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q8MQG4])

HSP 1 Score: 58.9214 bits (141), Expect = 3.257e-9
Identity = 54/215 (25.12%), Postives = 99/215 (46.05%), Query Frame = 2
Query:  593 CPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLN--TLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSI 1231
            C   + +   ++S   NF +R+ IR++W++         N   + F+ S K   +    A++KE E++ D++   +  S +  +     +  +    C  +++ + ++D + V++  L+ S L +K   S N    ++     KN   VR KK  WYV    + EK +P Y D    ++    V R L     Y N+  I DVF TG++ + L I
Sbjct:   81 CSNNTKLQITILSTAGNFDIRQAIRETWANPNNSEHVANNDVRISFIIS-KTSNEFLNFALQKEIEKFDDMIVTDLYESYELLILKVHAILSYKQSHCQLADFQLKIDDDMAVDMDGLYRS-LEDKKQASINGISGIIW----KNSPPVREKKHRWYVPKTLYSEKFFPPYIDGPIYLIGKNAVPRMLEEAKNY-NQWIIEDVFWTGVIGKALKI 288          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: C47F8.6 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O62115])

HSP 1 Score: 52.7582 bits (125), Expect = 3.520e-7
Identity = 54/232 (23.28%), Postives = 103/232 (44.40%), Query Frame = 2
Query:  611 IVFLVVSNVDNFPMREKIRQSW---SSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLN--DGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGI--VMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAF--MEDFSSNIMKN 1279
            I+ +V S  D++  R  +RQ+W   S+   +   ++ +LF V    P   K K  + +E + Y D++   ++    T  E   K     +F   K+  + ++   D   +  P    ++     I ST      ++    +++   R+K + WYV    +    YPAY    +G+  + ++  A+ LL  + + + + + DV LTGIL + L I +     +  F  +I KN
Sbjct:   93 ILMIVASRTDSYARRNIMRQTWMNKSNSEIVANGRMKSLFLV-GLAPADYKVKKMVMQEAKLYGDII---IVDMDDTYEELIYKSLMIFLFGVSKAPQYKIIGKIDEDIMFFPDKLMALYEQGIIDSTPVSLYGLVIPAGRDIF--RDKTNRWYVPESAYSCSQYPAYL---SGMYYMATREAAQMLLKSTKHRDFIQVEDVLLTGILAEDLGIPIRDMPKLYKFPHDIKKN 315          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: E03H4.11 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O17750])

HSP 1 Score: 52.373 bits (124), Expect = 4.024e-7
Identity = 51/219 (23.29%), Postives = 94/219 (42.92%), Query Frame = 2
Query:  611 IVFLVVSNVDNFPMREKIRQSW---SSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLN--DGVFVNLPTLFESILTNKDIKSTNDRKSLMLC----KVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQY-VARDLLMCSFYSNKLWINDVFLTGILPQKLSINV 1237
            I+ +V S  D++  R  +RQ+W   S    +   ++  LF V    P   K K  + +E + Y D++   V+    T  E   K     ++   K+  + ++   D   +  P    ++     I +T       LC    K++      R+K   WYV    +    +P Y  ++  + M  +  A+ ++  + Y + + + DVFLTGIL + L I+V
Sbjct:  117 ILMIVASRTDSYARRNIMRQTWMNKSDSEIVANGRMKPLFLV-GLTPGDYKMKKMVMQEAKLYGDII---VVDMNDTYEELTYKSLAILLYGVSKAPRYQMIGKIDEDVIFFPDKLTALYEQGIIDATP------LCAYGYKIQAGARIFRDKNDRWYVPESSYSCSKFPEY--VSGMLYMVTWEAAQQIIKSTKYRDFIQVEDVFLTGILAEDLGISV 323          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: C54C8.3 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O02231])

HSP 1 Score: 48.1358 bits (113), Expect = 9.081e-6
Identity = 50/219 (22.83%), Postives = 92/219 (42.01%), Query Frame = 2
Query:  611 IVFLVVSNVDNFPMREKIRQSWSSIRQ---MHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLN--DGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFME 1252
            I+ +V S  D++  R  +RQ+W S      +   ++  LF V    P   K K  + +E + Y D++   V+       E   K     ++   K+  + ++   D   +  P     +     I +T  R  +   K++      R+K   WYV    +    +P Y      +V  +  A+ ++  + Y + + + DVFLTGIL + L I+V+   E
Sbjct:   78 ILIIVASRTDSYARRNILRQTWMSKANSEIVANGRMKPLFLV-GLTPGEYKMKKMVMQEAKLYGDII---VVDMNDNYEELTYKSLAILLYGVSKAPRYQMIGKIDEDVMFFPDKLTELYDQGFIDATPLR--IYGLKMQSGANIFRDKTHRWYVPESSYSCSKFPEYVSGMLYMVTWE-AAQQIIKSTKYRDFIQVEDVFLTGILAEDLGISVKNLPE 289          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0073310)

HSP 1 Score: 80.8777 bits (198), Expect = 5.539e-16
Identity = 68/278 (24.46%), Postives = 122/278 (43.88%), Query Frame = 2
Query:  539 PNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDR-KSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLS------------------INVEAFMEDFSSNIMKNHYVYDDLSRSIF 1315
            PN  + ID+         C      + LV S V N   R  IR++W++   + ++ L   F V      ++K +  + +EN  + D++      + +     ++   ++    C  ++  V ++D VF+N P L + + T    + +  R  +LMLC+   +    R+ +S W VT +E+P + YP YC     IV +  V R L   +  S   W++DV +TGIL ++                    +  EA +ED    +  NH +  D S +I+
Sbjct:  119 PNFVYLIDQPA-------CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCP-GMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQKDVRKLVGGEADLED-PPFLFTNHAIKPDESMTIW 387          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0304987)

HSP 1 Score: 80.8777 bits (198), Expect = 5.539e-16
Identity = 68/278 (24.46%), Postives = 122/278 (43.88%), Query Frame = 2
Query:  539 PNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDR-KSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLS------------------INVEAFMEDFSSNIMKNHYVYDDLSRSIF 1315
            PN  + ID+         C      + LV S V N   R  IR++W++   + ++ L   F V      ++K +  + +EN  + D++      + +     ++   ++    C  ++  V ++D VF+N P L + + T    + +  R  +LMLC+   +    R+ +S W VT +E+P + YP YC     IV +  V R L   +  S   W++DV +TGIL ++                    +  EA +ED    +  NH +  D S +I+
Sbjct:  119 PNFVYLIDQPA-------CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCP-GMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQKDVRKLVGGEADLED-PPFLFTNHAIKPDESMTIW 387          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0113143)

HSP 1 Score: 80.8777 bits (198), Expect = 5.539e-16
Identity = 68/278 (24.46%), Postives = 122/278 (43.88%), Query Frame = 2
Query:  539 PNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDR-KSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLS------------------INVEAFMEDFSSNIMKNHYVYDDLSRSIF 1315
            PN  + ID+         C      + LV S V N   R  IR++W++   + ++ L   F V      ++K +  + +EN  + D++      + +     ++   ++    C  ++  V ++D VF+N P L + + T    + +  R  +LMLC+   +    R+ +S W VT +E+P + YP YC     IV +  V R L   +  S   W++DV +TGIL ++                    +  EA +ED    +  NH +  D S +I+
Sbjct:  119 PNFVYLIDQPA-------CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCP-GMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQKDVRKLVGGEADLED-PPFLFTNHAIKPDESMTIW 387          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0113142)

HSP 1 Score: 80.8777 bits (198), Expect = 5.539e-16
Identity = 68/278 (24.46%), Postives = 122/278 (43.88%), Query Frame = 2
Query:  539 PNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDR-KSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLS------------------INVEAFMEDFSSNIMKNHYVYDDLSRSIF 1315
            PN  + ID+         C      + LV S V N   R  IR++W++   + ++ L   F V      ++K +  + +EN  + D++      + +     ++   ++    C  ++  V ++D VF+N P L + + T    + +  R  +LMLC+   +    R+ +S W VT +E+P + YP YC     IV +  V R L   +  S   W++DV +TGIL ++                    +  EA +ED    +  NH +  D S +I+
Sbjct:  119 PNFVYLIDQPA-------CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCP-GMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQKDVRKLVGGEADLED-PPFLFTNHAIKPDESMTIW 387          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG8668 (gene:FBgn0031988 transcript:FBtr0339671)

HSP 1 Score: 61.2326 bits (147), Expect = 1.396e-9
Identity = 56/235 (23.83%), Postives = 106/235 (45.11%), Query Frame = 2
Query:  563 ESLFSSNDVD--------CPTGS-FIVFLVV--SNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYS-DKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSI 1231
            E+L+    VD        CP G  FI  LV+  S + +   R  IRQ+W     MH      +   +   +   +    A+ +EN  Y D++    + S        +   +++   C K++Y +  +D +F+N+P L   +  +KD       K  +  ++ K    +RNKKS +YV+  ++    +P++       V++  +  +L + S  +  L + DVF TGI+ + L++
Sbjct:  315 ETLYEPGHVDEEIDAERICPKGGEFIKLLVLISSAMSHDAARMSIRQTW-----MHYGTRRDVGMAFVLGRGTNETINKALTQENFIYGDLIRGNFIDSYNNLTLKTISTLEWADVHCPKAKYILKTDDDMFINVPKLLTFLDKHKD-------KRTIYGRLAKKWKPIRNKKSKYYVSVDQFAAGVFPSFT-TGPAYVLTGDIVHELYVRSLKTVYLKLEDVFTTGIVAKSLNV 536          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: B3GNT10 (si:ch73-29c22.2 [Source:ZFIN;Acc:ZDB-GENE-091204-199])

HSP 1 Score: 67.0106 bits (162), Expect = 1.386e-11
Identity = 56/224 (25.00%), Postives = 106/224 (47.32%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFS----QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSN 1267
             I+ +V+S+  N   RE +R SW++   +H   + T+FF+    PL   +   +K+E+E+Y D+V F    S    Q    +      ++ +  C ++ + +L  D V++NLP L   +L    +++  D   L L +V       R+     Y+  Q +P+K+ P YC      ++SQ V R + + +  ++    +D+ L G+  ++  + V      FS N
Sbjct:   86 LILTVVLSSPGNSSQREAVRNSWANQTVVHNVAVRTVFFL-GASPL-GAELGVIKEESERYGDIVQFEGGISRGDWQGGHWDQVKMALKWILHFCPQARFIILSEDSVYLNLPALTSYLL---GLRTHPD--DLYLGRVIHRAAPERDPDKPHYLPYQVYPDKYLPDYCS-GPAFLLSQDVVRKIYVAAEDASLPLPSDI-LIGLCARRAGV-VATHSARFSGN 299          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3galt1a (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-120215-203])

HSP 1 Score: 62.7734 bits (151), Expect = 2.395e-10
Identity = 54/213 (25.35%), Postives = 105/213 (49.30%), Query Frame = 2
Query:  599 TGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFV-YSDKPLTDKQKAAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSI 1231
            T  F+V L+ +N   F  R+ IR++W          + TLF + YS +P+ ++    +++E++ ++D++    + S     L+  + M   S+F C  ++Y +  +  +FVN+  L  ++L      +   R+      V  N   +R+  S W++  + +P+  YP +C  T G V S  +A  L   S ++  L + DV++ G+  +KL I
Sbjct:   78 TTPFLVLLISTNHKEFDARQAIRETWGDENTFSNVHILTLFLLGYSTEPVLNQM---VEQESQIFHDILVEDFVDSYHNLTLKTLMGMRWVSLF-CPNAQYVMKTDSDIFVNMDNLVFNLLR----PNAKPRRRFFTGHV-INGGPIRDVHSKWFMPRELYPDSRYPPFCSGT-GYVYSGDMAELLYKTSLHTRLLHLEDVYV-GLCLRKLGI 279          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: zgc:194330 (zgc:194330 [Source:ZFIN;Acc:ZDB-GENE-080722-3])

HSP 1 Score: 59.6918 bits (143), Expect = 3.839e-9
Identity = 64/272 (23.53%), Postives = 116/272 (42.65%), Query Frame = 2
Query:  542 NVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFV-YSDKPLTDKQKAAMKKENEQYYDVV-------YFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDGVP 1333
            N  FT+DE      D+      F+V +V         R  IR +W +   +    + TLF V  +    ++K +  +++E+ Q+ D++       YF +    KT     + +  +    C ++ Y + ++  +F+N+  L  ++L+  +    N    +++    +N   VRNK S WYV+ + +PE  YP Y  L  G V S  +   ++  S Y     I D ++   L Q L +   +  E     I    Y  ++  R+I    G P
Sbjct:  113 NYYFTLDEP-----DICKQRNPFLVLMVPVAPYEVKARNAIRSTWGNETTVQGKAVLTLFLVGLTVGADSEKAQQQLEEESRQHRDLIQSNFVDSYFNLTI--KT-----MVIMDWLATRCPQANYSMKIDSDMFLNVNNLV-TLLSAPNTPRENYITGVLM----RNRFVVRNKNSKWYVSEELYPEPKYPTYL-LGMGYVFSNDLPSKIVEASNYVKPFNIEDAYIGACLKQ-LGVEPSSPPEPSQFRIYMGQYKRENFLRAITTILGSP 365          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: zgc:194330 (zgc:194330 [Source:ZFIN;Acc:ZDB-GENE-080722-3])

HSP 1 Score: 59.6918 bits (143), Expect = 3.839e-9
Identity = 64/272 (23.53%), Postives = 116/272 (42.65%), Query Frame = 2
Query:  542 NVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFV-YSDKPLTDKQKAAMKKENEQYYDVV-------YFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDGVP 1333
            N  FT+DE      D+      F+V +V         R  IR +W +   +    + TLF V  +    ++K +  +++E+ Q+ D++       YF +    KT     + +  +    C ++ Y + ++  +F+N+  L  ++L+  +    N    +++    +N   VRNK S WYV+ + +PE  YP Y  L  G V S  +   ++  S Y     I D ++   L Q L +   +  E     I    Y  ++  R+I    G P
Sbjct:  113 NYYFTLDEP-----DICKQRNPFLVLMVPVAPYEVKARNAIRSTWGNETTVQGKAVLTLFLVGLTVGADSEKAQQQLEEESRQHRDLIQSNFVDSYFNLTI--KT-----MVIMDWLATRCPQANYSMKIDSDMFLNVNNLV-TLLSAPNTPRENYITGVLM----RNRFVVRNKNSKWYVSEELYPEPKYPTYL-LGMGYVFSNDLPSKIVEASNYVKPFNIEDAYIGACLKQ-LGVEPSSPPEPSQFRIYMGQYKRENFLRAITTILGSP 365          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: zgc:194679 (zgc:194679 [Source:ZFIN;Acc:ZDB-GENE-030131-2847])

HSP 1 Score: 59.3066 bits (142), Expect = 4.285e-9
Identity = 51/212 (24.06%), Postives = 96/212 (45.28%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAA--MKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINV 1237
            F+V L+     N   R+ +R +W +  ++   K+ TL F+       D QK    + KE+EQY+D+V      S        + M ++    C  + Y + ++  +F+N+  L        ++  +  +++ M   V +  + +RN  S WY+    +    YP Y  L  G V S  +++ L+  +     ++I DV+L G+  Q L I +
Sbjct:  104 FVVLLIPVAPSNKAARDAVRSTWGT-EKLVGDKVVTLLFLLGVSTSNDSQKLHEDLLKESEQYHDIVQSDFWDSYYNLTIKTMIMMEWLTAYCQNTSYVMKVDSDIFLNVKNLV-------NLLQSAPKQNYMSGLVARGAVVLRNPNSKWYLPKTTFAPDFYPPYA-LGLGYVFSIDLSQKLVEAAQLVKPVYIEDVYL-GLCMQHLRIGL 305          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: atp5pf (ATP synthase peripheral stalk subunit F6 [Source:Xenbase;Acc:XB-GENE-987263])

HSP 1 Score: 70.0922 bits (170), Expect = 2.643e-12
Identity = 60/234 (25.64%), Postives = 97/234 (41.45%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFY--------LKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHY 1285
            F++ L+         RE IRQ+W      H   +  LF +  D   TD+   A+  E+ QY+D++       Q+  L+ Y        + M   + F C    Y +  +  +FVN   L   +L       TN      +    K     RNK S WY+  + +P   YP +C  T G V S  +A  +   S    +L + DV++ G+  +KL I      ++   NI + +Y
Sbjct:  131 FLILLIAVEPQQLSAREAIRQTWGKEDLFHGILIVKLFLLGRDSKGTDRTDQAIVDESNQYHDII-------QQDYLDTYNNLTIKTLMGMHWIATF-CPNVSYIMKTDSDMFVNTEHLIYRLLKPDAAPQTNYFTGYFM----KGYAPNRNKNSKWYMPPELYPGDLYPPFCSGT-GYVFSGDLAEKIYKVSLSIPRLHLEDVYI-GVCLEKLGIKPVPPPKESYFNIWRVYY 350          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: tcp11l1 (t-complex 11, testis-specific-like 1 [Source:Xenbase;Acc:XB-GENE-5887205])

HSP 1 Score: 68.5514 bits (166), Expect = 4.862e-12
Identity = 54/213 (25.35%), Postives = 104/213 (48.83%), Query Frame = 2
Query:  602 GSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDK-PLTDKQKAAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            G F+V L+ +    F  R+ IR++W +       K+ TLF +  +  P+ ++    +++E++ ++D+V    + S     L+  + M   + F C K++Y +  +  +FVN+  L   +L     K T   +         N   +R+ +S WY+    +PE +YP +C  T G + S  VA  +   S ++  L + DV++ G+  +KL I+
Sbjct:   75 GPFLVILISTTHKEFDARQAIRETWGNESNFKGIKIVTLFLLGKNSDPVLNQM---VEQESQIFHDIVVEDFIDSYHNLTLKTLMGMRWVATF-CSKAKYIMKTDSDIFVNMDNLIYKLL-----KPTTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPESNYPPFCSGT-GYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 276          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: B3GALT2 (beta-1,3-galactosyltransferase 2 [Source:NCBI gene;Acc:100487440])

HSP 1 Score: 59.6918 bits (143), Expect = 5.481e-9
Identity = 53/216 (24.54%), Postives = 88/216 (40.74%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFY-------LKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F++ L+ +       R+ IRQ+W +       +   LF +          + A+  E+ QY+D++       Q+  L+ Y       L    +    C K  Y +  +  +FVN   L   +L       TN     ++     N    RNK S WY+    +P + YP +C  T G V S  +A  +   S    +L + DV++ GI   KL I+
Sbjct:  151 FLILLIAAEPRQIEARQAIRQTWGNESLAPGFRTVRLFLLGLHATADGLIQQAIMDESRQYHDII-------QQEYLDTYYNLTIKTLMGMNWVATYCPKVLYVMKTDSDMFVNTEYLIHKLLKPDLPPRTNYFTGYLMRGYAPN----RNKDSKWYMPQDLYPSERYPVFCSGT-GYVFSGDLAEKIFKVSLSIRRLHLEDVYV-GICLAKLRID 353          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: pja2 (praja ring finger 2, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-966471])

HSP 1 Score: 58.9214 bits (141), Expect = 7.465e-9
Identity = 55/226 (24.34%), Postives = 109/226 (48.23%), Query Frame = 2
Query:  560 DESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKS--LMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSI 1231
            +E L S  DV      F++ +V S+ +N   R+ IR++W ++    +  +  +F +   +P +++ +A +  E++ + D+V    L + +      +   ++ V  C  + + + ++   FVN+    ES++       T +R+S  + + +V    +  R  KS  +V    +P+  YP YC  T  +V+SQ VAR + + S     L   DVFL G+  +K  +
Sbjct:   77 EEGLCSGRDV------FLLMVVSSSPENKTRRDTIRRTWGNMTNYKDLVVVRMFAL--GRPTSEETQAELLVESQVHKDMVEASFLDTYENRTLKVITSMEWIVTFCPNARFILKVDQEAFVNV----ESLVDYLSYLLTLERRSEDVYIGRVIHQGVPDREPKSLHFVPTSSYPDAFYPDYCSGT-ALVISQDVARKVYLVSKDETTLLPPDVFL-GMCARKAGV 288          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: usp54 (ubiquitin specific peptidase 54 [Source:Xenbase;Acc:XB-GENE-940633])

HSP 1 Score: 58.151 bits (139), Expect = 1.412e-8
Identity = 49/212 (23.11%), Postives = 101/212 (47.64%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVY--FPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINV 1237
            F++ LV+S   +   R   R++W +     +  + T+F V     +TD+ +  +++E   Y D+V   F   +S  T L+  + M   S + C  + Y + +++ +F+N+  L   +L   ++    +  +  +     + +  RNK S WY+  + +P+ +YP YC  T G V S  ++  +   +     L   DVF+ GI  +++ + +
Sbjct:   88 FLILLVISESHDINSRLITRETWGNESNYRDVAVVTVFLVGVSVTMTDRVQEQLEEEMNTYGDLVQQDFTDTYSNLT-LKTLMGMEWISKY-CPDASYVMKIDNDMFLNVDYLVHHLL-QPELPVRQNYFTGYIVANSVSAVPFRNKDSKWYIPYEMYPKSYYPTYCSGT-GYVFSGDLSPRIYKEAMGLTLLPFEDVFV-GICLERMGVQI 294          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: Gm34653 (predicted gene, 34653 [Source:MGI Symbol;Acc:MGI:5593812])

HSP 1 Score: 70.0922 bits (170), Expect = 1.711e-12
Identity = 51/179 (28.49%), Postives = 92/179 (51.40%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVAR 1144
            F++ L+ S+  N   R+ IR++W S+  +    + TLF +     +T +++  +  E+++  D++    L S + +    + M Q++V  C  S  F+L  D +F+NLP L + +L  K        + + L +V    I  R+  S  +V+  E+PEK+YP YC      ++SQ VAR
Sbjct:   85 FLLSLIFSSPGNGTRRDLIRKAWGSVTTVQGYPILTLFALGMPALVTTQEE--IDAESQKNNDIIEGIFLDSSENQTLKIISMTQWAVAFC-PSALFILKADEMFINLPGLVDYLLNLK-----GHLEGIYLGRVIHQDIPNRDPHSQEFVSLSEYPEKYYPDYCS-GEAFILSQDVAR 254          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt1 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1349403])

HSP 1 Score: 64.3142 bits (155), Expect = 7.930e-11
Identity = 53/211 (25.12%), Postives = 104/211 (49.29%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDK-PLTDKQKAAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F+V L+ +    F  R+ IR++W         K+ TLF +  +  P+ ++    +++E++ ++D++    + S     L+  + M   + F C K++Y +  +  +FVN+  L   +L      ST  R+      V  N   +R+ +S WY+    +P+ +YP +C  T G + S  VA  +   S ++  L + DV++ G+  +KL I+
Sbjct:   79 FLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQM---VEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATF-CSKAKYVMKTDSDIFVNMDNLIYKLLK----PSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGT-GYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 278          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt1 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1349403])

HSP 1 Score: 64.3142 bits (155), Expect = 7.930e-11
Identity = 53/211 (25.12%), Postives = 104/211 (49.29%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDK-PLTDKQKAAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F+V L+ +    F  R+ IR++W         K+ TLF +  +  P+ ++    +++E++ ++D++    + S     L+  + M   + F C K++Y +  +  +FVN+  L   +L      ST  R+      V  N   +R+ +S WY+    +P+ +YP +C  T G + S  VA  +   S ++  L + DV++ G+  +KL I+
Sbjct:   79 FLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQM---VEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATF-CSKAKYVMKTDSDIFVNMDNLIYKLLK----PSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGT-GYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 278          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3gnt6 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 (core 3 synthase) [Source:MGI Symbol;Acc:MGI:3039603])

HSP 1 Score: 62.3882 bits (150), Expect = 5.617e-10
Identity = 53/215 (24.65%), Postives = 97/215 (45.12%), Query Frame = 2
Query:  596 PTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKK----ENEQYYDVVYFPVLFSQKTELEFYLK---MFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQ 1219
            P G F++  V S+  ++  RE IR++W   R     ++  LF V +  P    ++  +      E  +Y DV+ +   FS  T L   LK   +  ++   C    + +  +D VFV+      ++L+  +++S      L   ++    + VR   S ++V  Q +P   YPAYC    G ++S+Y  R+L   + +     I+D ++   L Q
Sbjct:  109 PRGVFLLLAVKSSPAHYERRELIRRTWGQERSYSGRQVLRLFLVGTSPPEEAAREPQLADLLSLEAREYGDVLQWD--FS-DTFLNLTLKHLHLLDWTAEHCPGVSFLLSCDDDVFVHT----ANVLSFLEVQSPEHH--LFTGQLMVGSVPVRESGSKYFVPPQIFPGVAYPAYCS-GGGFLLSRYTVRNLRSAAHHVPLFPIDDAYMGMCLQQ 313          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1349461])

HSP 1 Score: 60.4622 bits (145), Expect = 2.473e-9
Identity = 50/216 (23.15%), Postives = 92/216 (42.59%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFY-------LKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F++ L+ +       R  IRQ+W +       ++  +F +     L    + A+++E+ QY+D++       Q+  L+ Y       L    +    C  + Y +  +  +FVN   L   +L   D+     R +     + +     RNK S WY+    +P + YP +C  T G V S  +A  +   S    +L + DV++ GI   KL ++
Sbjct:  152 FLILLIAAEPGQIEARRAIRQTWGNETLAPGIQIIRVFLLGISIKLNGYLQHAIQEESRQYHDII-------QQEYLDTYYNLTIKTLMGMNWVATYCPHTPYVMKTDSDMFVNTEYLIHKLL-KPDLPP---RHNYFTGYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGT-GYVFSGDLAEKIFKVSLGIRRLHLEDVYV-GICLAKLRVD 354          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|A8MXE2|YI036_HUMAN (Putative UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase LOC100288842 OS=Homo sapiens OX=9606 PE=5 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 1.365e-10
Identity = 47/179 (26.26%), Postives = 93/179 (51.96%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVAR 1144
            F++ L+ S+  N   R+ IR++W ++  +    + TLF +    P++   +  + KE+ +  D++    L S + +    + M Q++V  C  + + + +++  FVNLP+L + +L  K+       + + + +V   V   R+ ++  +V   E+PEK+YP YC      +MSQ VAR
Sbjct:   85 FLLSLIFSSPGNGTRRDLIRKTWGNVTSVQGHPILTLFAL--GMPVSVTTQKEINKESCKNNDIIEGIFLDSSENQTLKIIAMIQWAVAFCPNALFILKVDEETFVNLPSLVDYLLNLKE-----HLEDIYVGRVLHQVTPNRDPQNRDFVPLSEYPEKYYPDYCS-GEAFIMSQDVAR 255          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9MYM7|B3GT1_PONPY (Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus OX=9600 GN=B3GALT1 PE=3 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.547e-10
Identity = 53/211 (25.12%), Postives = 104/211 (49.29%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDK-PLTDKQKAAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F+V L+ +    F  R+ IR++W         K+ TLF +  +  P+ ++    +++E++ ++D++    + S     L+  + M   + F C K++Y +  +  +FVN+  L   +L      ST  R+      V  N   +R+ +S WY+    +P+ +YP +C  T G + S  VA  +   S ++  L + DV++ G+  +KL I+
Sbjct:   79 FLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQM---VEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATF-CSKAKYVMKTDSDIFVNMDNLIYKLLK----PSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGT-GYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 278          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q7JK26|B3GT1_PANTR (Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.547e-10
Identity = 53/211 (25.12%), Postives = 104/211 (49.29%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDK-PLTDKQKAAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F+V L+ +    F  R+ IR++W         K+ TLF +  +  P+ ++    +++E++ ++D++    + S     L+  + M   + F C K++Y +  +  +FVN+  L   +L      ST  R+      V  N   +R+ +S WY+    +P+ +YP +C  T G + S  VA  +   S ++  L + DV++ G+  +KL I+
Sbjct:   79 FLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQM---VEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATF-CSKAKYVMKTDSDIFVNMDNLIYKLLK----PSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGT-GYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 278          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q7JK25|B3GT1_PANPA (Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.547e-10
Identity = 53/211 (25.12%), Postives = 104/211 (49.29%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDK-PLTDKQKAAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F+V L+ +    F  R+ IR++W         K+ TLF +  +  P+ ++    +++E++ ++D++    + S     L+  + M   + F C K++Y +  +  +FVN+  L   +L      ST  R+      V  N   +R+ +S WY+    +P+ +YP +C  T G + S  VA  +   S ++  L + DV++ G+  +KL I+
Sbjct:   79 FLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQM---VEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATF-CSKAKYVMKTDSDIFVNMDNLIYKLLK----PSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGT-GYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 278          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|O54904|B3GT1_MOUSE (Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 5.547e-10
Identity = 53/211 (25.12%), Postives = 104/211 (49.29%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDK-PLTDKQKAAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F+V L+ +    F  R+ IR++W         K+ TLF +  +  P+ ++    +++E++ ++D++    + S     L+  + M   + F C K++Y +  +  +FVN+  L   +L      ST  R+      V  N   +R+ +S WY+    +P+ +YP +C  T G + S  VA  +   S ++  L + DV++ G+  +KL I+
Sbjct:   79 FLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQM---VEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATF-CSKAKYVMKTDSDIFVNMDNLIYKLLK----PSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGT-GYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 278          
BLAST of Hexosyltransferase vs. TrEMBL
Match: I1ZIJ3 (Hexosyltransferase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.301e-24
Identity = 84/317 (26.50%), Postives = 157/317 (49.53%), Query Frame = 2
Query:  431 IELPTVLPSFVDLKRELVNELNSAKDYRKICSNNKS---PNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDK---PLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDGVPFNSRIWRLLL 1363
            +E P  + +   +K   VN L       K+ S  KS   PNV  ++D S+       C    F+  +V+S   N  +REKIRQSW+S++ +++  ++++F +  +      TD Q  ++  E+++Y+DV   P   +++  L  Y+   + +   C  SE+ +++ D +F N+P + + +  N            ++C +  +   VRN KS +YV+  ++ E  YP +C   +  ++S  +  +++  +F   KLW  D +L G+LP  L++    F +  S   M+ H+VY +      LT+G     RIW+ L+
Sbjct:   57 LENPLKIHNLSTIKTTTVNRLT-----EKLSSTGKSYQFPNV--SLDFSM------ACRGSIFLYIVVISEKKNEKLREKIRQSWASVKIINQKLVSSVFLLTQNSHTVETTDDQ--SLLNESKKYHDVFLSPFTKTERENLYLYMDALKLAN-QCQTSEFSMMITDDMFPNIPVIIQQLSANVS----------LMCNLVLSNPVVRNTKSIYYVSKSDYSENIYPPHCKNNSPFIISNLLVSNIIK-TFNKTKLWFYDAYLLGVLPHSLNVTPVEFPKSISIIEMRPHFVYVNRRNYGILTNGGLLPGRIWKKLM 346          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A074YXT4 (Hexosyltransferase OS=Opisthorchis viverrini OX=6198 GN=T265_15493 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 7.813e-20
Identity = 78/294 (26.53%), Postives = 140/294 (47.62%), Query Frame = 2
Query:  497 SAKDYRKICSNNKSPNVNFTIDESLFSSNDVDCPTGSF--------IVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVV-------YFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKK----SSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLT 1321
            S  D + + S    P     +D ++F  N    P  ++        ++ +V S+  N   R+ +R +W S+R++   K+  LFF+ S    ++K + A+K+E E Y D+V       Y  +     T +E+       S+  C   +Y V ++D  FV++  L    L +  +K++        C   K     R KK    + W +T +E+ +  +P YC+    IV ++ VA  L +CS ++  +WI+DV++TGIL +KL I+ +AF+   + +         +L  +IFLT
Sbjct:   64 SMYDIQAVYSRCAGPK---HLDATIFEDNPFIIPQTTYCSERPQLKLLIVVHSHPANHHRRDLVRSTWGSLRRVGPEKIGVLFFLGS----SEKTQKAVKEEAETYRDIVQRNFTEDYHNMTHKHLTIMEW------LSMGHCASLQYIVKVDDDTFVDIFHLVR-FLRSDQLKTSPG----FYCSATKGAKPTRPKKGVPETKWVITKEEFDKDVFPVYCEGLGYIVEAR-VAPFLYLCSMFTQTIWIDDVYVTGILAEKLGISRQAFLPGHAYDRAGPSKQSGELLDNIFLT 338          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A267ERD6 (Hexosyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006984g1 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.432e-19
Identity = 78/296 (26.35%), Postives = 141/296 (47.64%), Query Frame = 2
Query:  509 YRKIC--SNNKSPN---VNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKA-AMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFL-TDG---VP-FNSRIWRLLL 1363
            YR+ C  +N  SP    V+ T    L   +   C    F++  V S V +   R+ IR +W+++  +   +L T+FFV +     DK++A A+++E++   D+V    + + +     +L   ++   SC    Y + ++D V +N+  L ES+   + + S  D      C+V ++   +RN++  WYV  +EWP   YP YC    G VMS  +   L  C+ +    WI+DVF++G L   L      + + + +  +       + ++ +    DG   VP  N R+WR ++
Sbjct:   88 YRERCWHANFSSPERRPVDHTPRPFLLGESAARCRGDIFLLIAVQSAVQHRARRDLIRTNWATVTNIGGDRLQTVFFVGT---TNDKRQAEALRRESDSRADIVQADFVDTYRNLTYKHLYALRWIAESCRSVRYVMKVDDDVVLNVFRLRESL--RELVGSRTD--DFFYCQVIRSK-PIRNRRHKWYVAYEEWPGDRYPDYCK-GFGYVMSFGLIEKLHQCAKWRRYFWIDDVFVSGDLASALGAPRIQWEDGWGAKRLHPRLAGPEANQMVLANADGNFMVPSLNRRVWRAIV 374          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A267E8G5 (Hexosyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001193g1 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.724e-19
Identity = 78/296 (26.35%), Postives = 141/296 (47.64%), Query Frame = 2
Query:  509 YRKIC--SNNKSPN---VNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKA-AMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDG----VP-FNSRIWRLLL 1363
            YR+ C  +N  SP    V+ T    L   +   C    F++  V S V +   R+ IR +W+++  +   +L T+FFV +     DK++A A+++E++   D+V    + + +     +L   ++   SC    Y + ++D V +N+  L ES+   + + S  D      C+V + V  +RNKK  W+VT +E+P+  YP YC    G VMS  +   L  C+ +    WI+DVF++G L   L      + + + +  +       + ++ +    G     P  N R+WR ++
Sbjct:  119 YRERCWRANFSSPERRPVDHTPRPFLLGESAARCRGDIFLLIAVQSAVQHRARRDLIRATWAAVTNIGGDRLQTVFFVGT---TNDKRQAEALRRESDSRADIVQADFVDTYRNLTYKHLYALRWIAESCRSVRYVMKVDDDVVLNVFRLRESL--RELVGSRTD--DFFYCQVSQ-VKPIRNKKIKWHVTYEEYPDDRYPDYCK-GFGYVMSFGLIEKLHQCAKWRRYFWIDDVFVSGDLASALGAPRIQWEDGWGAKRLHPRLAGPEANQMVLANAGSNAVAPSLNRRVWRAIV 405          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A1I8GBG9 (Hexosyltransferase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.573e-19
Identity = 79/299 (26.42%), Postives = 143/299 (47.83%), Query Frame = 2
Query:  509 YRKIC--SNNKSPN---VNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKA-AMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDG----VP-FNSRIWRLLLSKS 1372
            YR+ C  +N  SP    V+ T    L   +   C    F++  V S V +   R+ IR +W+++  +   +L T+FFV +     DK++A A+++E++   D+V    + + +     +L   ++   SC    Y + ++D V +N+  L ES+   + + S  D      C+V + V  +RNKK  W+VT +E+P+  YP YC    G VMS  +   L  C+ +    WI+DVF++G L   L      + + + +  +       + ++ +    G     P  N R+WR ++ +S
Sbjct:   80 YRERCWRANFSSPERRPVDHTPRPFLLGESAARCRGDIFLLIAVQSAVQHRARRDLIRATWAAVTNIGGDRLQTVFFVGT---TNDKRQAEALRRESDSRADIVQADFVDTYRNLTYKHLYALRWIAESCRSVRYVMKVDDDVVLNVFRLRESL--RELVGSRTD--DFFYCQVSQ-VKPIRNKKIKWHVTYEEYPDDRYPDYCK-GFGYVMSFGLIEKLHQCAKWRRYFWIDDVFVSGDLASALGAPRIQWEDGWGAKRLHPRLAGPEANQMVLANAGSNAVAPSLNRRVWRAIVIRS 369          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: si:ch73-29c22.2 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 10 (putative) [Source:HGNC Symbol;Acc:HGNC:53652])

HSP 1 Score: 65.4698 bits (158), Expect = 3.785e-11
Identity = 51/185 (27.57%), Postives = 87/185 (47.03%), Query Frame = 2
Query:  620 LVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPV----LFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCS 1162
            +V+S   N   RE +R SW +   +    + TLFF+    PL  +++AA KKE+  Y D+V          S++ + E      ++ +  C ++ + VL  D VF+N+P L   +L    +++  D   L L +V       R+    +Y+    +PE+  P YC      +MSQ V R + + S
Sbjct:   90 VVLSAPGNASQREAVRNSWGNQTSVQGVAVRTLFFL-GPSPLEAEREAA-KKESSHYGDIVQCEGPSSRGGSERGQWERVKLAMRWVLLFCPQTRFVVLAEDSVFLNIPALGNYLL---GLRTHPD--DLYLGRVIHRAAPERDASKPYYLPFHLYPERLLPDYCS-GPAFLMSQDVVRKVYVAS 266          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3galt1a (beta-1,3-galactosyltransferase 1-like [Source:NCBI gene;Acc:103046152])

HSP 1 Score: 62.003 bits (149), Expect = 3.609e-10
Identity = 51/212 (24.06%), Postives = 108/212 (50.94%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFV-YSDKPLTDKQKAAMKKENEQYYDVVY--FPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F++ L+ +N   F  R+ IR++W       + ++ TLF + ++ +P+ ++    +++E++ ++D++   F   +   T L+  + M   S F C  + Y +  +  +FVN+  L  ++L      +   R+      V  N   +R+ +S WY++ + +PE  YP +C  T G V S  +A  +   S ++  + + DV++ G+  +KL I+
Sbjct:   82 FLLILISTNHKEFDARQAIRETWGEENMYSDIRIVTLFLLGHNSEPVLNQM---VEQESQIFHDIIVEDFEDSYHNLT-LKTMMGMRWVSSF-CPNAHYVMKTDSDIFVNMDNLVLNLLR----PNAKPRQRFFTGHVI-NGGPIRDTRSKWYMSREMYPESKYPPFCSGT-GYVFSGDMAELIFKTSLHTRLIHLEDVYV-GLCLRKLGIH 281          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:NCBI gene;Acc:103046404])

HSP 1 Score: 62.003 bits (149), Expect = 4.350e-10
Identity = 55/211 (26.07%), Postives = 101/211 (47.87%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAM-KKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F+V L+ +    F  R+ IR++W       + ++ TLF +      TD     M ++E++ ++D+V    + S     L+  + M   + F C +++Y +  +  +FVN+  L   +L      +T  R+      V  N   +R+ +S WY+    +PE  YP +C  T G V S  VA  +   S ++  L + DV++ G+  +KL I+
Sbjct:   83 FLVILISTTHKEFDARQAIRETWGDESTFSDLRIITLFLLGRS---TDSVLNQMVEQESQIFHDIVVEDFVDSYHNLTLKTLMGMRWVATF-CNQAKYVMKTDSDIFVNMDNLVYKLLK----PATKPRRRYFTGYVI-NGSPIRDMRSKWYMPRDLYPESKYPPFCSGT-GYVFSADVAELIYKTSLHTRLLHLEDVYV-GVCLRKLGIH 282          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3gnt7l (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7, like [Source:ZFIN;Acc:ZDB-GENE-040718-143])

HSP 1 Score: 61.2326 bits (147), Expect = 9.915e-10
Identity = 65/240 (27.08%), Postives = 111/240 (46.25%), Query Frame = 2
Query:  578 SNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQ--KAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVF---SCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDR-KSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKN 1279
            S DVD      ++ +V S ++    RE +R++W + R +   ++ TLF + +  P  D +  +  ++ E+  Y D++ +     Q T     LK   F  +    C  + +    +D VFV+   L E I    D +S   R + L +       I +RN+ S +Y+  +E  +K YP Y     G +MS ++AR L + S       I+DVFL G+  QKL    E+ +   +  I+K 
Sbjct:  137 SADVD------VLLVVKSVIEQHERREAVRRTWGAERTVRGRRVRTLFLLGTPSPGKDARNLQKLLEYEDRIYGDILQWDF---QDTFFNLTLKEVNFLRWFNIYCAHTPFVFKGDDDVFVSTDNLVELI----DFRSDEGRARELFVGDTISKAIPIRNQHSKYYIP-RELFDKPYPPYVG-GGGFLMSSWIARQLFVVSEGLELFPIDDVFL-GMCLQKLGRTPESHLGFRTFGIVKR 360          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3gnt5b (lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase B [Source:NCBI gene;Acc:103033521])

HSP 1 Score: 56.9954 bits (136), Expect = 2.459e-8
Identity = 53/219 (24.20%), Postives = 104/219 (47.49%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNT---LFFVYSDKPLTDKQK---AAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNK-LWINDVFLT------GILPQK 1222
             ++  V S+ +NF  R+ IR +W +   + E  L     + F     P   ++K     + +E+E+Y D++    L +     ++  L++     + C  +++ +  +D +FV++P L   +   ++++ +   K   + KV +    +R K S +YV+ + +P   YP Y     G V+S+ VA  +   S   N  L+I+DVF+       GI PQ+
Sbjct:   89 LLLLFVKSSPENFERRQAIRSTWGNEAYI-ERTLGVSVRVVFALGLHPSPSQRKKLQEMLHQEDEKYNDLIQQDFLDTFHNLTIKLLLQLGWTHAY-CSNAQFLMSADDDIFVHMPNLIHYL---QEVRRSG-VKDFWVGKVHRGAPPIRRKDSKYYVSEEMYPWSMYPDYTP-GAGYVVSKDVAARVYEASLTLNASLYIDDVFMGICANAMGISPQE 300          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 72.7886 bits (177), Expect = 1.175e-14
Identity = 58/225 (25.78%), Postives = 103/225 (45.78%), Query Frame = 2
Query:  569 LFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIR-QMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVY--FPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            L +  D   P   F+V LV S    F  RE IR++W+S    +       LF + +  P +D Q+  +++E+ ++ D++   F   +   T L+  + +   SV  C  + Y +  +  +FVNL  L +++L  +  +     +      V +  +  RN  S WY+    +P   YP +C  T G VMS  +A  L   S    +L + DV++ G+  + L + 
Sbjct:    4 LLNEPDTCRPRAPFLVVLVASESTEFEAREAIRETWASESVALRGVSFRRLFLLGTASPASDAQR-RIEEESRRHGDLIQQNFTDAYDNLT-LKTMMGLHWVSV-HCPHASYVMKTDSDMFVNLEVLVKAVLEQQRRRVPP--RDYFTGYVMRGFLPNRNPASKWYMPEDMYPGATYPTFCSGT-GYVMSATLASRLYRASLAIRRLRLEDVYV-GVCLESLGVE 221          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:13528])

HSP 1 Score: 56.9954 bits (136), Expect = 3.597e-9
Identity = 51/208 (24.52%), Postives = 86/208 (41.35%), Query Frame = 2
Query:  611 IVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQK----AAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVF---SCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGIL 1213
            ++  + S+  N   R+ IR++W     +    +  +F V        +++    A +++E+ ++ D+V +  L    T     LK   F  +    C  + Y    +D VFVN P L E I   +  ++      L    V  NV  +R   S ++V  Q      YP Y     GI+M+   A D+   +     L I+DVFL   L
Sbjct:   53 LLLAIKSDARNLERRDVIRRTWGREGSVRGRPVRRVFLVGVPSGEAPERRVHLNALLQEESREHGDIVQWNFL---DTFFNLTLKQLLFLDWLHERCAGARYVFDGDDDVFVNTPNLLERIAAEE--RAGRGDGHLYEGYVISNVGPIRAPSSKYFVPVQVHAGDSYPPYVG-GGGILMAGRTALDIRRVAGQLAMLPIDDVFLGQCL 254          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: B3GALT4 (beta-1,3-galactosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:919])

HSP 1 Score: 55.8398 bits (133), Expect = 1.120e-8
Identity = 50/220 (22.73%), Postives = 92/220 (41.82%), Query Frame = 2
Query:  572 FSSNDVDCPTGS--FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESK----------LNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDR--------------KSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLL 1153
             SS    C  G+  F++  V S  ++   RE IR++W  +R++  +           +  +F +   +  +D+ +A+++ E+ +  D+V    L + +      +   Q+ V  C    + +  +D VFVN  +L E +       S  D                 L L +V   V   R+  S  +V+++ +P  HY  YC  T   V+S   AR +L
Sbjct:   62 LSSPGELCRPGAEPFLLICVASAPEHRSRREAIRETWGGVRKVAVASPGGGGGRALDVRVVFVLGVTR--SDRTRASVQNESVERRDIVQAEFLDTYRNLTLKTMATLQWFVSRCPGVRFLLKADDDVFVNPHSLVEHLHDAHGPASPADEDYGKGGGVGGGEGGHDLYLGRVHSRVRPNRDPASKAFVSDERFPGDHYAPYCSGT-AYVLSGSAARKVL 278          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO47742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLS0])

HSP 1 Score: 70.8626 bits (172), Expect = 2.855e-14
Identity = 58/195 (29.74%), Postives = 97/195 (49.74%), Query Frame = 2
Query:  593 CPTGS-FIVFLVVSNVDNFPMREKIRQSW----SSIRQMHESK-LNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVY--FPVLFSQKTELEFY----LKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSL--MLCKVK--KNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMS 1129
            CP    +++ LV+S   NF  R+ IR+SW    +S R +   + +  +F V SD    +K  + + KE ++Y D++   F  ++ Q    EF+    L  F+++  SC +S++ + +    FVN+P   E + + K    ++D + L    C          +RNK+S WY+T +EWPE   P Y     GI MS
Sbjct:    1 CPNDDLYLLILVISTGRNFEARKAIRKSWGRADTSKRNVTTPESVRVIFVVGSD----EKSDSRVTKEAKRYKDILRGNFDDVYHQN---EFHSVKALLAFKWATLSC-RSKFILKVLTESFVNVPATMEWLRSKK--PESSDVRGLYTGFCHGHDTGGAAVIRNKESPWYITEEEWPEGRLPPYAS-GMGIAMS 184          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO33449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS41])

HSP 1 Score: 50.447 bits (119), Expect = 2.737e-7
Identity = 42/167 (25.15%), Postives = 83/167 (49.70%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNT--LFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYC 1102
            F+V LV S  +    RE IR++W+     +++KL++  +F V S K  +      +++E +QY D+     L   + E+    K + +   +  + +Y +   D V++ LP++       + +K  + ++ L   K+  +   +R+KK  +YV+  E+ E  YP YC
Sbjct:    1 FLVILVSSLPNAIESREAIRETWAKSLIANDTKLDSCLIFVVGSSK--STHLDIEVEEEAKQYGDIFRSKYLDKPRHEIAKIWKSYYW--VAKYEPKYVIKTKDDVYIYLPSVM------RWLKQRDPKEQLYAGKLINHARVIRDKKDEFYVSWNEFSETFYPDYC 157          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO33326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI5])

HSP 1 Score: 50.447 bits (119), Expect = 3.277e-7
Identity = 50/214 (23.36%), Postives = 91/214 (42.52%), Query Frame = 2
Query:  593 CPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLN-------TLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGIL 1213
            C    F++  V S  ++F MRE IR SW +     E+ +N       T+FF+       D++   ++ E  +Y D+V    L + +      + + +++   C +++Y +  +   FVN+  L         ++    RK L L ++       RNK S +YV+  E+ E  YP Y     G V    +   LL  S  +    + D +   ++
Sbjct:    4 CTGNVFLLAAVHSCHESFSMREAIRLSWGN----QENAINKGKWTWKTVFFLGQSS--DDEKNQLLRLEAARYKDIVIGDFLDTYRNLTLKTILILRWAKKHCPQAQYILKTDHDCFVNVLPL---------MRLLRIRKPLYLGRIHWKNTPTRNKTSKFYVSKAEFSEPVYPPYAA-GGGYVFKGSLLPSLLQASHEAAVFPMEDAYFGSLM 201          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO48791 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RID3])

HSP 1 Score: 47.7506 bits (112), Expect = 2.316e-6
Identity = 50/211 (23.70%), Postives = 97/211 (45.97%), Query Frame = 2
Query:  602 GSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            G F++ LV S   NF  R  IR+SW   R  +++K + +F + + K      K  +K+E   Y D++     F+          +      S ++S++ V  +D ++++   L+E +L ++  +       L   KV++N    R +   + V+ + + E+ YPAYC      V+S+     +L  S   +     D +L G+L +++ I 
Sbjct:    1 GIFLLILVTSAPGNFEARSTIRRSWGK-RGKNDAKFHVVFMLGATKEPEILSK--LKEEIGSYGDLIIGK--FTDSYSNLPLKSLMSLRWASQIESQFTVKTDDDMYIHTTRLYEWLLRHQTSR-------LYAGKVRQNAKVNRFRFHRYSVSYKNYQEQFYPAYC-YGGFYVLSREALTSVLSVSKRYHPFPAEDAYL-GVLAKEVGIT 197          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO40978 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5H7])

HSP 1 Score: 46.595 bits (109), Expect = 6.370e-6
Identity = 41/171 (23.98%), Postives = 78/171 (45.61%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMK------SEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYC 1102
            F++FLV S  ++F  R+ IR +W++ R   +  +  +F V        K    + KE     D+         +T++E   +   F V+   K       +Y    +D ++VN+P L   + T+++IK  N     ++ K K      R++++ W+V + +  +  YP YC
Sbjct:    1 FVLFLVTSMPESFERRQLIRTTWANTRGQPDVTIYCVFMV--GISTIAKYNRRIAKEASILGDIY--------RTKIEESYRNMIFKVWDAYKWALGVSPKYIFKADDDIYVNIPRLIHWLKTDQNIKE-NLYAGYVVYKQKIE----RDEENDWFVNSTDLQQGTYPNYC 156          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: B3GALT2 (beta-1,3-galactosyltransferase 2 [Source:NCBI gene;Acc:105357992])

HSP 1 Score: 70.8626 bits (172), Expect = 8.078e-13
Identity = 66/269 (24.54%), Postives = 115/269 (42.75%), Query Frame = 2
Query:  428 AIELPTVLPSFVDLKRELVNELNSAKDYRKICSNNKSPNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVY-SDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSI 1231
             + LP   P   DL   L+  ++  K+     + N  P + + I+E    +++   P   F+V L+ +       R  IRQ+W +        L  LF +  +D  L   Q+  ++ E++++ D++    L S K      L    +    C ++ Y +  +  +FVN   L   +L  +    TN           +     RNK S WY++ + +PE+ YP +C  T G V S  +A  +   S  +  L + DV++ GI   KL I
Sbjct:   92 GVSLPEGKPHSKDL---LIEHMSQRKEGSGNATQNPGPFL-YIINEPDKCADNRPAP---FLVLLIATEARQVEARNAIRQTWGNTSLAPGLSLIRLFLLGKTDGELGLLQQKMLQAESQRHRDIIQQDFLDSYKNLTIKTLMGMNWVAVHCQRASYVMKTDSDMFVNTEYLIYKLLKPELKAKTN----YFTGNNMRGFAPNRNKNSKWYMSPELYPEEKYPTFCSGT-GYVFSGDMAGKIYQTSLSTPHLHLEDVYV-GICLAKLRI 347          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3galt1a (beta-1,3-galactosyltransferase 1-like [Source:NCBI gene;Acc:101163306])

HSP 1 Score: 65.4698 bits (158), Expect = 2.751e-11
Identity = 53/218 (24.31%), Postives = 99/218 (45.41%), Query Frame = 2
Query:  584 DVDCPT-GSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            D  C T   F+V L+ +    F  R+ IR++W       E ++  LF +   + +       +++E++ ++DVV    + S        L   ++    C K++Y +  +  +FVN+  L  ++L     K T   +         N   +R+ +S WY+    +P+  YP +C  T G V S  VA  +   S ++  L + DV++ G+  +KL I+
Sbjct:   72 DKKCETEAPFLVILISTTHKEFDARQAIRETWGDESTFPEVRVVALFLL--GRSMDAVLNQMVEQESQIFHDVVVEDFIDSYHNLTLKTLMGMRWVATYCTKAQYVLKTDSDIFVNMENLIYNLL-----KPTTKPRRRYFTGYVINGGPIRDIRSKWYMPRDLYPDSKYPPFCSGT-GYVFSADVAELIYKISLHTRLLHLEDVYV-GVCLRKLGIH 280          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3gnt7l (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101170895])

HSP 1 Score: 63.5438 bits (153), Expect = 1.757e-10
Identity = 60/223 (26.91%), Postives = 103/223 (46.19%), Query Frame = 2
Query:  593 CPTGSFIVFLVVSNV-DNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQ------FSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVE 1240
            C  G   + +V+ +V +    RE +R++W   +     K+ TLF + +  P T K    ++K  E Y D +Y  +L     +  F L + +      F +F C   ++    +D VFVN P L + I    +    +    L +       I +RN++S +Y+  + + ++ YP Y     G +MS  +AR LL+ S       I+DVFL G+  Q+L +  E
Sbjct:  125 CADGEVHLLMVIKSVIEQHDRREAVRRTWGREQTRDGRKIRTLFLLGT--PTTGKDTKNLQKLLE-YEDRIYKDILQWDFMDTFFNLTLKEVNFLKWFDIF-CPTVQFVFKGDDDVFVNTPNLLQLIRFRVE---EHKEAQLFVGDTISKAIPIRNRQSKYYIPKELY-DQPYPPYVG-GGGFLMSSRLARRLLVVSEKLELYPIDDVFL-GMCLQRLDVTPE 337          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:NCBI gene;Acc:101156539])

HSP 1 Score: 63.1586 bits (152), Expect = 1.859e-10
Identity = 51/210 (24.29%), Postives = 99/210 (47.14%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFS-QKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F+V L+ +N   F  R+ IR++W       +  + T+F +  +    D     +++E++ ++D+V    + S     L+  + M   + F C K++Y +  +  +FVN+  L   +L     K T   +         N   +R+ +S WY+    +P+  YP +C  T G V S  +A  +   S ++  L + DV++ G+  +KL I+
Sbjct:   81 FLVILISTNHKEFDARQAIRETWGDESTFTQIHILTIFLLGWNS--DDVLNQMVEQESQIFHDIVVENFIDSYHNLTLKTMMGMRWVATF-CPKAQYVMKTDSDIFVNMDNLIYKLL-----KPTTKPRRRYFTGYVINGGPIRDMRSKWYMPRDVYPDSKYPPFCSGT-GYVFSADIAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 280          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: si:ch73-29c22.2 (putative UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase LOC100288842 [Source:NCBI gene;Acc:101162144])

HSP 1 Score: 63.1586 bits (152), Expect = 1.921e-10
Identity = 57/213 (26.76%), Postives = 99/213 (46.48%), Query Frame = 2
Query:  608 FIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKA--AMKKENEQYYDVV--YFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSIN 1234
            F++ LV S+  N   R+ +R++W++   +    + T FF+     L+D   A   +  E+E+Y DV+  Y     S     E  +   ++ +  C  + + +L  + VFVNLP L   +L     +     + L L +V +     R+ KS  Y+    +P K+ P YCD T   V+SQ V R + + S         DVF+ G+  +K  ++
Sbjct:   85 FLLALVFSSAGNISQRDAVRKTWANQTLIEGFPVKTFFFL----ALSDTSAAHQELLSESERYGDVIQAYAGAERSLHGSKERTVLALRWVISFCPLARFVLLTKESVFVNLPALGSYLL-----RLHRHPEDLYLGRVIQQDQPNRDPKSPGYLPPALYPAKYLPEYCDDT-AYVLSQDVVRKVYVASALVLAPVSADVFV-GLCARKAGVS 286          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000042545.1 (SMESG000042545.1)

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 402/403 (99.75%), Postives = 403/403 (100.00%), Query Frame = 2
Query:  176 MNRLIRNRDXXXXXXXXXXXCLFNFHISKGDRSASNQQQKVHSSNHKAKPNTNSKLNSEDHFXXXXXXXXXXXXXXETSNLTNSAIELPTVLPSFVDLKRELVNELNSAKDYRKICSNNKSPNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDGVPFNSRIWRLLLSKSLREF 1384
            MNRLIRNRDILVIVLLIVIICLFNFHISKGDRSASNQQQKVHSSNHKAKPNTNSKLNSEDHFNNSLLIQLNNLQANETSNLTNSAIELPTVLPSFVDLKRELVNELNSAKDYRKICSNNKSPNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAA+KKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDGVPFNSRIWRLLLSKSLREF
Sbjct:    1 MNRLIRNRDILVIVLLIVIICLFNFHISKGDRSASNQQQKVHSSNHKAKPNTNSKLNSEDHFNNSLLIQLNNLQANETSNLTNSAIELPTVLPSFVDLKRELVNELNSAKDYRKICSNNKSPNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAIKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDGVPFNSRIWRLLLSKSLREF 403          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000008720.1 (SMESG000008720.1)

HSP 1 Score: 115.546 bits (288), Expect = 2.615e-28
Identity = 84/317 (26.50%), Postives = 157/317 (49.53%), Query Frame = 2
Query:  431 IELPTVLPSFVDLKRELVNELNSAKDYRKICSNNKS---PNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDK---PLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDGVPFNSRIWRLLL 1363
            +E P  + +   +K   VN L       K+ S  KS   PNV  ++D S+       C    F+  +V+S   N  +REKIRQSW+S++ +++  ++++F +  +      TD Q  ++  E+++Y+DV   P   +++  L  Y+   + +   C  SE+ +++ D +F N+P + + +  N            ++C +  +   VRN KS +YV+  ++ E  YP +C   +  ++S  +  +++  +F   KLW  D +L G+LP  L++    F +  S   M+ H+VY +      LT+G     RIW+ L+
Sbjct:   41 LENPLKIHNLSTIKTTTVNRLT-----EKLSSTGKSYQFPNV--SLDFSM------ACRGSIFLYIVVISEKKNEKLREKIRQSWASVKIINQKLVSSVFLLTQNSHTVETTDDQ--SLLNESKKYHDVFLSPFTKTERENLYLYMDALKLAN-QCQTSEFSMMITDDMFPNIPVIIQQLSANVS----------LMCNLVLSNPVVRNTKSIYYVSKSDYSENIYPPHCKNNSPFIISNLLVSNIIK-TFNKTKLWFYDAYLLGVLPHSLNVTPVEFPKSISIIEMRPHFVYVNRRNYGILTNGGLLPGRIWKKLM 330          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000054572.1 (SMESG000054572.1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.134e-18
Identity = 50/193 (25.91%), Postives = 100/193 (51.81%), Query Frame = 2
Query:  662 IRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKS---SWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSI 1231
            IR+++ SIR++H+  +   FFV   +  + +++  ++KENE   D++    + S +     ++ + ++   +C  +EY +  +D VF+++  +   I+     K         LC   KN    R++K     WYVT +E+ +  YP YC+    +V  +++  ++ +CS  ++  WI+DV + G+LP  L I
Sbjct:    2 IRETFGSIRRIHDYTVRLAFFV--GRSFSAQEQVKLEKENEINNDIIQRDFVESYRNMTRKHITVMEWVTRNCNHAEYLLKSDDDVFIDIYHIVREIVDGNVDKG-------FLCSSTKNAKPQRSQKGHLRKWYVTKEEYKDNKYPTYCEGYGYVVPVKFIP-NVFVCSMLNDFFWIDDVHVGGVLPDMLGI 184          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000023690.1 (SMESG000023690.1)

HSP 1 Score: 82.4185 bits (202), Expect = 4.962e-17
Identity = 70/263 (26.62%), Postives = 126/263 (47.91%), Query Frame = 2
Query:  503 KDYRKICSN------NKSPNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTL--FESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGI--VMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFS 1261
            +D  K CS       N +P  ++ I+E+   S +V      F++  V S+  NF  R+ IR +W S++Q++      LF +      TD+ K  +  E++++ D+V    L + K     ++    +    C ++E+    +D  F+N+ +L  F  I       + N ++  +L ++  N   +R K   W V    +  + YP Y   T G   ++SQ   R LL+CS+Y   L+I+DVF+TGI+ Q+  ++   F  +F 
Sbjct:   27 EDVSKYCSGENFTFYNHTP-FSYIINETTLCSENV------FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDK--IMNESKKFRDLVQADFLDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRI-------NLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPY---TKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHMNFQLNFG 270          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000020765.1 (SMESG000020765.1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.547e-13
Identity = 61/297 (20.54%), Postives = 132/297 (44.44%), Query Frame = 2
Query:  473 RELVNELNSAKDYRKICSNNKSPNVNFTIDESLFSSNDVDCPTGSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFV-YSDKPLTDKQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFVLLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSSWYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFLTGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDGVPFNSRIWRLL 1360
            + ++N   ++   R  C+       N T    +   +D+ C    +++  V S+  +F  R  IR++W S+R +    +   F + YS+     K +  ++KE++ + D++    + S K     ++    + V  C  +++    +D  F+++  L   +      +  N    L+L K+  N   +R     W + ++ +P   YP +       V+S    + L +CS+Y   L+I+DVF+TG++ +   I +++F + F    + N  +  +   ++F      +    WR+L
Sbjct:   17 KHIINPEVNSDSIRLFCTGENLTYFNHTPFSYIIKESDL-CFGDVYLLTYVQSSSIHFKRRMMIRETWGSLRYVSNDPVKLAFVIGYSE---NFKIQKKIEKESKDFGDIIQGDFIDSYKNLTLKHIVALHWIVNYCSHAQFVSKTDDDTFISIFNLVSYLK-----EHLNPADKLILGKISYNETPIREPGFKWTINSEMYPNDKYPPFLK-GFAYVISNAAIKPLFICSYYEKFLFIDDVFITGLVSRLAGIELQSFDKVFGHFWISNEPIPIESMDNLFFVSQTEYYPDQWRIL 303          
The following BLAST results are available for this feature:
BLAST of Hexosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GNT102.843e-1126.26UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GALT11.155e-1025.12beta-1,3-galactosyltransferase 1 [Source:HGNC Symb... [more]
B3GNT53.183e-1023.05UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT53.183e-1023.05UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT53.183e-1023.05UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0024.153.257e-925.12Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
B0024.153.257e-925.12Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
C47F8.63.520e-723.28Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
E03H4.114.024e-723.29Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
C54C8.39.081e-622.83Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG113575.539e-1624.46gene:FBgn0035558 transcript:FBtr0073310[more]
CG113575.539e-1624.46gene:FBgn0035558 transcript:FBtr0304987[more]
CG113575.539e-1624.46gene:FBgn0035558 transcript:FBtr0113143[more]
CG113575.539e-1624.46gene:FBgn0035558 transcript:FBtr0113142[more]
CG86681.396e-923.83gene:FBgn0031988 transcript:FBtr0339671[more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GNT101.386e-1125.00si:ch73-29c22.2 [Source:ZFIN;Acc:ZDB-GENE-091204-1... [more]
b3galt1a2.395e-1025.35UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
zgc:1943303.839e-923.53zgc:194330 [Source:ZFIN;Acc:ZDB-GENE-080722-3][more]
zgc:1943303.839e-923.53zgc:194330 [Source:ZFIN;Acc:ZDB-GENE-080722-3][more]
zgc:1946794.285e-924.06zgc:194679 [Source:ZFIN;Acc:ZDB-GENE-030131-2847][more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp5pf2.643e-1225.64ATP synthase peripheral stalk subunit F6 [Source:X... [more]
tcp11l14.862e-1225.35t-complex 11, testis-specific-like 1 [Source:Xenba... [more]
B3GALT25.481e-924.54beta-1,3-galactosyltransferase 2 [Source:NCBI gene... [more]
pja27.465e-924.34praja ring finger 2, E3 ubiquitin protein ligase [... [more]
usp541.412e-823.11ubiquitin specific peptidase 54 [Source:Xenbase;Ac... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm346531.711e-1228.49predicted gene, 34653 [Source:MGI Symbol;Acc:MGI:5... [more]
B3galt17.930e-1125.12UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3galt17.930e-1125.12UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3gnt65.617e-1024.65UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3galt22.473e-923.15UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
back to top
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8MXE2|YI036_HUMAN1.365e-1026.26Putative UDP-GlcNAc:betaGal beta-1,3-N-acetylgluco... [more]
sp|Q9MYM7|B3GT1_PONPY5.547e-1025.12Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus... [more]
sp|Q7JK26|B3GT1_PANTR5.547e-1025.12Beta-1,3-galactosyltransferase 1 OS=Pan troglodyte... [more]
sp|Q7JK25|B3GT1_PANPA5.547e-1025.12Beta-1,3-galactosyltransferase 1 OS=Pan paniscus O... [more]
sp|O54904|B3GT1_MOUSE5.547e-1025.12Beta-1,3-galactosyltransferase 1 OS=Mus musculus O... [more]
back to top
BLAST of Hexosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIJ31.301e-2426.50Hexosyltransferase OS=Schmidtea mediterranea OX=79... [more]
A0A074YXT47.813e-2026.53Hexosyltransferase OS=Opisthorchis viverrini OX=61... [more]
A0A267ERD61.432e-1926.35Hexosyltransferase OS=Macrostomum lignano OX=28230... [more]
A0A267E8G51.724e-1926.35Hexosyltransferase OS=Macrostomum lignano OX=28230... [more]
A0A1I8GBG92.573e-1926.42Hexosyltransferase OS=Macrostomum lignano OX=28230... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-29c22.23.785e-1127.57UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3galt1a3.609e-1024.06beta-1,3-galactosyltransferase 1-like [Source:NCBI... [more]
B3GALT14.350e-1026.07beta-1,3-galactosyltransferase 1 [Source:NCBI gene... [more]
b3gnt7l9.915e-1027.08UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt5b2.459e-824.20lactosylceramide 1,3-N-acetyl-beta-D-glucosaminylt... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
b3galt21.175e-1425.78UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3GNT33.597e-924.52UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GALT41.120e-822.73beta-1,3-galactosyltransferase 4 [Source:HGNC Symb... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477422.855e-1429.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334492.737e-725.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333263.277e-723.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487912.316e-623.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409786.370e-623.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GALT28.078e-1324.54beta-1,3-galactosyltransferase 2 [Source:NCBI gene... [more]
b3galt1a2.751e-1124.31beta-1,3-galactosyltransferase 1-like [Source:NCBI... [more]
b3gnt7l1.757e-1026.91UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GALT11.859e-1024.29beta-1,3-galactosyltransferase 1 [Source:NCBI gene... [more]
si:ch73-29c22.21.921e-1026.76putative UDP-GlcNAc:betaGal beta-1,3-N-acetylgluco... [more]
back to top
BLAST of Hexosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042545.10.000e+099.75SMESG000042545.1[more]
SMESG000008720.12.615e-2826.50SMESG000008720.1[more]
SMESG000054572.12.134e-1825.91SMESG000054572.1[more]
SMESG000023690.14.962e-1726.62SMESG000023690.1[more]
SMESG000020765.12.547e-1320.54SMESG000020765.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004253 ID=SMED30004253|Name=Hexosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1541bp
TCTTGCATTCAAATTGTGCTGAGATTTCTAAAACAAAGACAAACGAATTT
GTTGTAGAAAATTAATAATGCACTTCGCGCACACAAACTGAATTCTGATT
GGCTGTCATCAAAATGTAGTCTAAACCAATTCATTATAATCATTTGTTGA
AATGAAAAAAATAATTTTCAAAATAATGAATCGTCTGATCAGGAATCGTG
ATATTTTAGTCATTGTACTGTTGATCGTAATTATTTGTTTATTCAATTTC
CACATCAGTAAAGGCGATCGATCAGCGTCAAATCAACAACAAAAAGTTCA
TTCATCGAATCACAAAGCGAAACCAAATACGAATTCCAAACTTAACAGTG
AAGATCACTTCAATAATTCTTTGTTAATTCAGCTCAATAATCTTCAAGCC
AATGAAACTTCTAATCTGACAAATTCTGCAATAGAATTGCCAACAGTTTT
GCCCTCATTTGTCGATCTGAAGCGAGAACTAGTCAATGAATTAAATTCAG
CGAAAGATTATCGTAAAATCTGCAGTAACAATAAATCTCCAAATGTCAAT
TTTACAATTGATGAAAGCCTATTCTCTTCCAACGATGTCGATTGTCCGAC
TGGGTCTTTTATTGTTTTTCTCGTCGTTTCAAATGTAGATAATTTTCCAA
TGAGAGAAAAAATTCGTCAGTCTTGGAGTTCGATTCGACAAATGCACGAA
TCAAAATTGAATACTTTGTTTTTCGTCTACTCAGACAAACCATTGACAGA
TAAGCAGAAAGCTGCAATGAAAAAAGAAAACGAACAGTACTATGACGTGG
TTTACTTTCCCGTTCTGTTTTCACAGAAAACCGAATTGGAATTCTATTTG
AAAATGTTTCAATTTTCCGTTTTCTCCTGTATGAAATCTGAATATTTCGT
GTTGTTGAATGATGGAGTTTTCGTTAATTTGCCGACTCTGTTCGAATCCA
TATTGACGAATAAAGACATCAAATCGACAAATGATAGGAAATCTTTGATG
CTTTGTAAGGTGAAAAAAAACGTCATTGCCGTTAGAAACAAAAAAAGCTC
CTGGTATGTAACGAATCAGGAATGGCCAGAGAAGCATTATCCCGCGTATT
GTGATCTGACCAATGGGATTGTCATGTCTCAATATGTAGCACGCGATTTA
CTGATGTGTTCATTTTATTCGAACAAGCTCTGGATCAACGATGTGTTTCT
CACTGGAATTTTGCCGCAAAAATTATCAATTAATGTTGAAGCATTTATGG
AAGATTTCTCGTCGAATATTATGAAAAATCATTATGTTTATGACGATTTA
TCAAGAAGTATTTTCTTGACTGACGGAGTCCCATTTAATTCTAGAATTTG
GCGGTTGCTTCTTAGTAAATCGTTGAGAGAATTTTAAAATATGTGTATTT
TTTAATTGATCAAGTTTATAAAAAATTTATTGAAATGCAAAAAAAAGAAA
CCAAGCTTTTGTTTGGATGATTGCTTGGTTAGATGCCAATTTTTGTAATT
CTTTATTCAAGATTAAAAAGATTTTAATTGTTGAAAAAAAA
back to top

protein sequence of SMED30004253-orf-1

>SMED30004253-orf-1 ID=SMED30004253-orf-1|Name=SMED30004253-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MKKIIFKIMNRLIRNRDILVIVLLIVIICLFNFHISKGDRSASNQQQKVH
SSNHKAKPNTNSKLNSEDHFNNSLLIQLNNLQANETSNLTNSAIELPTVL
PSFVDLKRELVNELNSAKDYRKICSNNKSPNVNFTIDESLFSSNDVDCPT
GSFIVFLVVSNVDNFPMREKIRQSWSSIRQMHESKLNTLFFVYSDKPLTD
KQKAAMKKENEQYYDVVYFPVLFSQKTELEFYLKMFQFSVFSCMKSEYFV
LLNDGVFVNLPTLFESILTNKDIKSTNDRKSLMLCKVKKNVIAVRNKKSS
WYVTNQEWPEKHYPAYCDLTNGIVMSQYVARDLLMCSFYSNKLWINDVFL
TGILPQKLSINVEAFMEDFSSNIMKNHYVYDDLSRSIFLTDGVPFNSRIW
RLLLSKSLREF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002659Glyco_trans_31
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: molecular function
TermDefinition
GO:0008378galactosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002659Glycosyl transferase, family 31PFAMPF01762Galactosyl_Tcoord: 168..362
e-value: 1.5E-21
score: 77.2
IPR002659Glycosyl transferase, family 31PANTHERPTHR11214BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASEcoord: 21..369
NoneNo IPR availablePANTHERPTHR11214:SF247BETA-1,3-GALACTOSYLTRANSFERASE BRNcoord: 21..369
NoneNo IPR availableTMHMMTMhelixcoord: 12..34