Merlin:moesin:ezrin:radixin

Overview
NameMerlin:moesin:ezrin:radixin
Smed IDSMED30004242
Length (bp)2716
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Merlin:moesin:ezrin:radixin (SMED30004242) t-SNE clustered cells

Violin plots show distribution of expression levels for Merlin:moesin:ezrin:radixin (SMED30004242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Merlin:moesin:ezrin:radixin (SMED30004242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Merlin:moesin:ezrin:radixin (SMED30004242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
whole organismSMED30004242h1SMcG0022545 mersmed_ncbi_20240424PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30004242h1SMcG0022544 mersmed_ncbi_20240424PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30004242h1SMcG0022545 dd_Smed_v4_7300_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Human
Match: RDX (radixin [Source:HGNC Symbol;Acc:HGNC:9944])

HSP 1 Score: 173.711 bits (439), Expect = 1.671e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIK--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Human
Match: RDX (radixin [Source:HGNC Symbol;Acc:HGNC:9944])

HSP 1 Score: 174.866 bits (442), Expect = 1.698e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Human
Match: RDX (radixin [Source:HGNC Symbol;Acc:HGNC:9944])

HSP 1 Score: 174.866 bits (442), Expect = 1.730e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIK--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Human
Match: RDX (radixin [Source:HGNC Symbol;Acc:HGNC:9944])

HSP 1 Score: 174.866 bits (442), Expect = 2.258e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Human
Match: RDX (radixin [Source:HGNC Symbol;Acc:HGNC:9944])

HSP 1 Score: 174.866 bits (442), Expect = 2.258e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Celegans
Match: erm-1 (ERM-1B; Ezrin/Radixin/Moesin [Source:UniProtKB/TrEMBL;Acc:G5EBK3])

HSP 1 Score: 159.844 bits (403), Expect = 4.690e-41
Identity = 101/315 (32.06%), Postives = 156/315 (49.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGD-LSETECQD--DEDRMFXXXXXXXXXXXXXXMQCQL-SQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            KA++++V + D++LEF +   TTG+ LF+ V  +IGL E +YFGL+  Y D+ G      WLKL K++ +Q +   P    KF    KF+PED+  E+IQ +T  LFYL VK+ ++   +             C                               P + ++LLAS + QA+YGD + ET        DR+     L          Q +L S+E  RR+   +  H+  +RE A L YLK+A    ++G++YF I +K     + GV A G++IY   +++ P   F W  I+N+S+ D+KF IK
Sbjct:    4 KAINVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQ--YTDNKG---FPTWLKLNKKVLSQDVKKDPTLVFKF--RAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIY------------C-------------------------------PPETSVLLASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLG---------QFKLNSEEWERRIMTWWADHRATTREQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKVGFPWSEIRNISFNDKKFVIK 259          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Celegans
Match: erm-1 (ERM-1B; Ezrin/Radixin/Moesin [Source:UniProtKB/TrEMBL;Acc:G5EBK3])

HSP 1 Score: 156.762 bits (395), Expect = 6.286e-40
Identity = 99/313 (31.63%), Postives = 154/313 (49.20%), Query Frame = 3
Query:  117 LHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGD-LSETECQD--DEDRMFXXXXXXXXXXXXXXMQCQL-SQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            ++++V + D++LEF +   TTG+ LF+ V  +IGL E +YFGL+  Y D+ G      WLKL K++ +Q +   P    KF    KF+PED+  E+IQ +T  LFYL VK+ ++   +             C                               P + ++LLAS + QA+YGD + ET        DR+     L          Q +L S+E  RR+   +  H+  +RE A L YLK+A    ++G++YF I +K     + GV A G++IY   +++ P   F W  I+N+S+ D+KF IK
Sbjct:    7 INVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQ--YTDNKG---FPTWLKLNKKVLSQDVKKDPTLVFKF--RAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIY------------C-------------------------------PPETSVLLASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLG---------QFKLNSEEWERRIMTWWADHRATTREQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKVGFPWSEIRNISFNDKKFVIK 260          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Celegans
Match: nfm-1 (NeuroFibroMatosis homolog [Source:UniProtKB/TrEMBL;Acc:Q5LK46])

HSP 1 Score: 147.517 bits (371), Expect = 1.437e-36
Identity = 102/316 (32.28%), Postives = 155/316 (49.05%), Query Frame = 3
Query:  105 NSKALHIKVNTYDNDLEFHLSHKT-TGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNH-SPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTR-RVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            N+K ++ KV+T D DLE  +  KT TG  LFE VC  IGL ET+YFGL+        +  +  WL+ +K I  Q +   +      FL   KF+PED+E E+I   TRHLF+L ++ A++  ++             C+ +A                               ++LLAS + QA +GD +E     D D+      +          Q  +S ++ R R+K+ +  + G SRE+AEL YL+VA    ++GI Y+ I +        G+SA G+ IY+  N+I P   FSW  IKN+ +K+RKF +K
Sbjct:   10 NTKPIYAKVSTMDADLEKIVIEKTWTGRHLFEAVCRIIGLRETWYFGLQ-----FTNKKNIPCWLQNDKTICGQDIQKDTSDGTFNFLFLVKFYPEDVEPEIILDATRHLFFLQIREAILSMNLY------------CSPEA-------------------------------SVLLASFAVQAMHGDCTEEVGPIDLDKHLPKSVID---------QYDMSADMWRDRIKRWWSRNAGQSREEAELEYLRVAQDLEMYGILYYPICNNKETDLHLGISAQGLGIYKGVNRITPRPFFSWSEIKNIQFKNRKFHMK 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Celegans
Match: nfm-1 (NeuroFibroMatosis homolog [Source:UniProtKB/TrEMBL;Acc:Q5LK46])

HSP 1 Score: 147.517 bits (371), Expect = 1.662e-36
Identity = 102/316 (32.28%), Postives = 155/316 (49.05%), Query Frame = 3
Query:  105 NSKALHIKVNTYDNDLEFHLSHKT-TGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNH-SPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTR-RVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            N+K ++ KV+T D DLE  +  KT TG  LFE VC  IGL ET+YFGL+        +  +  WL+ +K I  Q +   +      FL   KF+PED+E E+I   TRHLF+L ++ A++  ++             C+ +A                               ++LLAS + QA +GD +E     D D+      +          Q  +S ++ R R+K+ +  + G SRE+AEL YL+VA    ++GI Y+ I +        G+SA G+ IY+  N+I P   FSW  IKN+ +K+RKF +K
Sbjct:   10 NTKPIYAKVSTMDADLEKIVIEKTWTGRHLFEAVCRIIGLRETWYFGLQ-----FTNKKNIPCWLQNDKTICGQDIQKDTSDGTFNFLFLVKFYPEDVEPEIILDATRHLFFLQIREAILSMNLY------------CSPEA-------------------------------SVLLASFAVQAMHGDCTEEVGPIDLDKHLPKSVID---------QYDMSADMWRDRIKRWWSRNAGQSREEAELEYLRVAQDLEMYGILYYPICNNKETDLHLGISAQGLGIYKGVNRITPRPFFSWSEIKNIQFKNRKFHMK 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Celegans
Match: nfm-1 (NeuroFibroMatosis homolog [Source:UniProtKB/TrEMBL;Acc:Q5LK46])

HSP 1 Score: 147.517 bits (371), Expect = 2.491e-36
Identity = 102/316 (32.28%), Postives = 155/316 (49.05%), Query Frame = 3
Query:  105 NSKALHIKVNTYDNDLEFHLSHKT-TGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNH-SPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTR-RVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            N+K ++ KV+T D DLE  +  KT TG  LFE VC  IGL ET+YFGL+        +  +  WL+ +K I  Q +   +      FL   KF+PED+E E+I   TRHLF+L ++ A++  ++             C+ +A                               ++LLAS + QA +GD +E     D D+      +          Q  +S ++ R R+K+ +  + G SRE+AEL YL+VA    ++GI Y+ I +        G+SA G+ IY+  N+I P   FSW  IKN+ +K+RKF +K
Sbjct:   10 NTKPIYAKVSTMDADLEKIVIEKTWTGRHLFEAVCRIIGLRETWYFGLQ-----FTNKKNIPCWLQNDKTICGQDIQKDTSDGTFNFLFLVKFYPEDVEPEIILDATRHLFFLQIREAILSMNLY------------CSPEA-------------------------------SVLLASFAVQAMHGDCTEEVGPIDLDKHLPKSVID---------QYDMSADMWRDRIKRWWSRNAGQSREEAELEYLRVAQDLEMYGILYYPICNNKETDLHLGISAQGLGIYKGVNRITPRPFFSWSEIKNIQFKNRKFHMK 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Fly
Match: Mer (gene:FBgn0086384 transcript:FBtr0074754)

HSP 1 Score: 169.474 bits (428), Expect = 9.309e-44
Identity = 102/326 (31.29%), Postives = 178/326 (54.60%), Query Frame = 3
Query:   96 SKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLN-HSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNS 1067
            SK N ++L ++V+T+D++LEF L  + +G+ LF++VC +IGL E++YFGL+  Y+D+   +    WLK+EKR+  Q++  H+      F  + KFFPE++  ELIQ +T+HLF+L VK +++   +             C  +A                               ++LLAS +   +YG     + +  +D M   G LL    +    Q Q++ E+   R+K  Y  H+ M+R++ E+ YLK+A    ++G++YF I++K     W GV++ G++IY   +K+ P  +F W  I++VS+ D+KFTI+L  + +++
Sbjct:    6 SKKN-RSLSVRVSTFDSELEFKLEPRASGQDLFDLVCRTIGLRESWYFGLQ--YVDTRSNV---SWLKMEKRVRDQRVELHASNNVYVFSFYAKFFPENVSEELIQEITQHLFFLQVKQSILSMDIY------------CRPEA-------------------------------SVLLASYAVHVQYGPY---DYETYKDGMLAGGELLPKGVTD---QYQMTPEMWEERIKTWYMDHEPMTRDEVEMEYLKIAQDLDMYGVNYFPITNKNKTKLWLGVTSVGLNIYDERDKLTPKTTFQWNEIRHVSFDDKKFTIRLVDAKVSN 276          

HSP 2 Score: 51.6026 bits (122), Expect = 2.865e-6
Identity = 19/43 (44.19%), Postives = 35/43 (81.40%), Query Frame = 3
Query: 1395 KLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQ 1523
            K+++ L KGN +L+M+RR+P++ ++QQM+ QA+ E+ RR +E+
Sbjct:  288 KMILDLCKGNHDLYMRRRKPDTMEIQQMKAQAKEEKQRRQIER 330          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Fly
Match: Mer (gene:FBgn0086384 transcript:FBtr0345992)

HSP 1 Score: 169.474 bits (428), Expect = 9.309e-44
Identity = 102/326 (31.29%), Postives = 178/326 (54.60%), Query Frame = 3
Query:   96 SKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLN-HSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNS 1067
            SK N ++L ++V+T+D++LEF L  + +G+ LF++VC +IGL E++YFGL+  Y+D+   +    WLK+EKR+  Q++  H+      F  + KFFPE++  ELIQ +T+HLF+L VK +++   +             C  +A                               ++LLAS +   +YG     + +  +D M   G LL    +    Q Q++ E+   R+K  Y  H+ M+R++ E+ YLK+A    ++G++YF I++K     W GV++ G++IY   +K+ P  +F W  I++VS+ D+KFTI+L  + +++
Sbjct:    6 SKKN-RSLSVRVSTFDSELEFKLEPRASGQDLFDLVCRTIGLRESWYFGLQ--YVDTRSNV---SWLKMEKRVRDQRVELHASNNVYVFSFYAKFFPENVSEELIQEITQHLFFLQVKQSILSMDIY------------CRPEA-------------------------------SVLLASYAVHVQYGPY---DYETYKDGMLAGGELLPKGVTD---QYQMTPEMWEERIKTWYMDHEPMTRDEVEMEYLKIAQDLDMYGVNYFPITNKNKTKLWLGVTSVGLNIYDERDKLTPKTTFQWNEIRHVSFDDKKFTIRLVDAKVSN 276          

HSP 2 Score: 51.6026 bits (122), Expect = 2.865e-6
Identity = 19/43 (44.19%), Postives = 35/43 (81.40%), Query Frame = 3
Query: 1395 KLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQ 1523
            K+++ L KGN +L+M+RR+P++ ++QQM+ QA+ E+ RR +E+
Sbjct:  288 KMILDLCKGNHDLYMRRRKPDTMEIQQMKAQAKEEKQRRQIER 330          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Fly
Match: Moe (gene:FBgn0011661 transcript:FBtr0071277)

HSP 1 Score: 164.081 bits (414), Expect = 2.805e-42
Identity = 104/328 (31.71%), Postives = 167/328 (50.91%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQ-EVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            KAL+++V T D +LEF +   TTG+ LF+ V  +IGL E ++FGL+  Y DS G    + W+KL K++  Q +   +PL   +F    KF+PED+  ELIQ +T  LFYL VKNA++                  T++  C                         P + ++LLAS + QA +GD ++T         DR+     +          Q ++S+ E  + +   ++ H+ M REDA + YLK+A    ++G++YF I +K     W GV A G++IY+ D+++ P   F W  I+N+S+ ++KF IK    D  +P ++
Sbjct:    4 KALNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQ--YTDSKGD---STWIKLYKKVMNQDVKKENPL---QFRFRAKFYPEDVAEELIQDITLRLFYLQVKNAIL------------------TDEIYC-------------------------PPETSVLLASYAVQARHGDHNKTTHTAGFLANDRLLPQRVID---------QHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIK--PIDKKAPDFM 269          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Fly
Match: Moe (gene:FBgn0011661 transcript:FBtr0071276)

HSP 1 Score: 164.081 bits (414), Expect = 2.805e-42
Identity = 104/328 (31.71%), Postives = 167/328 (50.91%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQ-EVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            KAL+++V T D +LEF +   TTG+ LF+ V  +IGL E ++FGL+  Y DS G    + W+KL K++  Q +   +PL   +F    KF+PED+  ELIQ +T  LFYL VKNA++                  T++  C                         P + ++LLAS + QA +GD ++T         DR+     +          Q ++S+ E  + +   ++ H+ M REDA + YLK+A    ++G++YF I +K     W GV A G++IY+ D+++ P   F W  I+N+S+ ++KF IK    D  +P ++
Sbjct:    4 KALNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQ--YTDSKGD---STWIKLYKKVMNQDVKKENPL---QFRFRAKFYPEDVAEELIQDITLRLFYLQVKNAIL------------------TDEIYC-------------------------PPETSVLLASYAVQARHGDHNKTTHTAGFLANDRLLPQRVID---------QHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIK--PIDKKAPDFM 269          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Fly
Match: Moe (gene:FBgn0011661 transcript:FBtr0071269)

HSP 1 Score: 164.081 bits (414), Expect = 2.805e-42
Identity = 104/328 (31.71%), Postives = 167/328 (50.91%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQ-EVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            KAL+++V T D +LEF +   TTG+ LF+ V  +IGL E ++FGL+  Y DS G    + W+KL K++  Q +   +PL   +F    KF+PED+  ELIQ +T  LFYL VKNA++                  T++  C                         P + ++LLAS + QA +GD ++T         DR+     +          Q ++S+ E  + +   ++ H+ M REDA + YLK+A    ++G++YF I +K     W GV A G++IY+ D+++ P   F W  I+N+S+ ++KF IK    D  +P ++
Sbjct:    4 KALNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQ--YTDSKGD---STWIKLYKKVMNQDVKKENPL---QFRFRAKFYPEDVAEELIQDITLRLFYLQVKNAIL------------------TDEIYC-------------------------PPETSVLLASYAVQARHGDHNKTTHTAGFLANDRLLPQRVID---------QHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIK--PIDKKAPDFM 269          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Zebrafish
Match: ezrb (ezrin b [Source:ZFIN;Acc:ZDB-GENE-050803-1])

HSP 1 Score: 174.866 bits (442), Expect = 1.050e-45
Identity = 113/325 (34.77%), Postives = 173/325 (53.23%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLN-HSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  +IGL E +YFGL+  Y+DS G +    WLKL+K++S+Q +   +PL+   F    KFFPED+  ELIQ +T+ LF++ VK+ ++   +                   C                         P + A+LLAS S QA++GD S+      E          RLLP  +L Q +LS+E    R++  ++ H+GM REDA L YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPVNVRVTTMDAELEFAVQPSTTGKQLFDQVVKTIGLREIWYFGLQ--YMDSKGYL---TWLKLDKKVSSQDVKKENPLQ---FKFRAKFFPEDVADELIQDITQKLFFMQVKDGILSDEIY------------------C-------------------------PPETAVLLASYSVQAKFGDFSK------ELHRPGYLTSERLLPQRVLDQHKLSREQWEERIQVWHEEHRGMLREDAMLEYLKIAQDLEMYGVNYFDIKNKKGTELWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIK--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Zebrafish
Match: ezrb (ezrin b [Source:ZFIN;Acc:ZDB-GENE-050803-1])

HSP 1 Score: 174.866 bits (442), Expect = 1.050e-45
Identity = 113/325 (34.77%), Postives = 173/325 (53.23%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLN-HSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  +IGL E +YFGL+  Y+DS G +    WLKL+K++S+Q +   +PL+   F    KFFPED+  ELIQ +T+ LF++ VK+ ++   +                   C                         P + A+LLAS S QA++GD S+      E          RLLP  +L Q +LS+E    R++  ++ H+GM REDA L YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPVNVRVTTMDAELEFAVQPSTTGKQLFDQVVKTIGLREIWYFGLQ--YMDSKGYL---TWLKLDKKVSSQDVKKENPLQ---FKFRAKFFPEDVADELIQDITQKLFFMQVKDGILSDEIY------------------C-------------------------PPETAVLLASYSVQAKFGDFSK------ELHRPGYLTSERLLPQRVLDQHKLSREQWEERIQVWHEEHRGMLREDAMLEYLKIAQDLEMYGVNYFDIKNKKGTELWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIK--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Zebrafish
Match: msnb (moesin b [Source:ZFIN;Acc:ZDB-GENE-030717-7])

HSP 1 Score: 166.007 bits (419), Expect = 1.014e-42
Identity = 111/331 (33.53%), Postives = 169/331 (51.06%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETE------CQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  +IGL E +YFGL+  Y DS G    + WLKL KR++AQ +   +PL  IKF    KF+PED+  ELIQ  T+ LF+L VK A++   +             C                               P + A+LLAS + Q ++ D +         C+D            +LLP   L Q +L++E   +R++  ++ HK MSREDA + YLK++    ++G++YF I +K     W GV A G++IY+  +K+ P   F W  I+N+S+ D+KF IK    D  SP ++
Sbjct:    3 KPINVRVTTMDAELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQ--YQDSKG---FSTWLKLNKRVTAQDVRKENPLL-IKF--RAKFYPEDVAEELIQEATQRLFFLQVKEAILNDDIY------------C-------------------------------PPETAVLLASYAVQMKHSDYNSEHHIPGYLCRD------------KLLPQRFLEQHKLTKEQWEQRIQVWHEQHKSMSREDAMIEYLKISQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYERSDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKSPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Zebrafish
Match: msnb (moesin b [Source:ZFIN;Acc:ZDB-GENE-030717-7])

HSP 1 Score: 165.622 bits (418), Expect = 1.291e-42
Identity = 110/330 (33.33%), Postives = 170/330 (51.52%), Query Frame = 3
Query:  114 ALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETE------CQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            +++++V T D +LEF +   TTG+ LF+ V  +IGL E +YFGL+  Y DS G    + WLKL KR++AQ +   +PL  IKF    KF+PED+  ELIQ  T+ LF+L VK A++   +             C                               P + A+LLAS + Q ++ D +         C+D            +LLP  +L Q +L++E   +R++  ++ HK MSREDA + YLK++    ++G++YF I +K     W GV A G++IY+  +K+ P   F W  I+N+S+ D+KF IK    D  SP ++
Sbjct:    2 SINVRVTTMDAELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQ--YQDSKG---FSTWLKLNKRVTAQDVRKENPLL-IKF--RAKFYPEDVAEELIQEATQRLFFLQVKEAILNDDIY------------C-------------------------------PPETAVLLASYAVQMKHSDYNSEHHIPGYLCRD------------KLLPQRVLEQHKLTKEQWEQRIQVWHEQHKSMSREDAMIEYLKISQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYERSDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKSPDFV 266          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Zebrafish
Match: nf2a (neurofibromin 2a (merlin) [Source:NCBI gene;Acc:561184])

HSP 1 Score: 165.622 bits (418), Expect = 1.664e-42
Identity = 102/329 (31.00%), Postives = 163/329 (49.54%), Query Frame = 3
Query:   93 VSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKE--IKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGD----------LSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            + +  +K  ++ V T D DLEF    K  G+ LFE+VC ++GL ET++FGL     D+        WLK++K++    L+H   KE  I F    KF+PE++E EL+Q +T+HLF+L VK +++ + +                   C                         P + ++LLAS +  A+YGD          LS+ E             L + + +   M  ++ +E   R+  CY  H+G +R++AE+ YLK+A    ++G++YF I +K   +   GV A G+ IY LDN++ P  SF W  I+N+SY D++F IK
Sbjct:   13 LRRKQAKIFNVTVVTMDADLEFSCELKWRGKDLFELVCRTLGLRETWFFGLRYDVKDT------VAWLKMDKKV----LDHDVPKEEPIVFYFLAKFYPENVEEELVQDITQHLFFLQVKKSILEEEIY------------------C-------------------------PPEASVLLASYAVHAKYGDYNPNVHKPGFLSQDEL------------LPKRVINLYQMTAEMWEE---RITVCYAEHRGRTRDEAEMEYLKIAQDLEMYGVNYFSIRNKKGTSLLLGVDALGLHIYDLDNRLTPKISFPWNEIRNISYSDKEFAIK 273          

HSP 2 Score: 50.447 bits (119), Expect = 8.601e-6
Identity = 22/46 (47.83%), Postives = 36/46 (78.26%), Query Frame = 3
Query: 1395 KLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQAHL 1532
            KL+++L  GN +LFM+RR+ +S ++QQM+ QAR E+AR+ +E+  L
Sbjct:  293 KLILQLCIGNHDLFMRRRRVDSLEVQQMKTQAREEKARKQMERQRL 338          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Xenopus
Match: RDX (radixin [Source:NCBI gene;Acc:447978])

HSP 1 Score: 174.481 bits (441), Expect = 2.521e-45
Identity = 105/329 (31.91%), Postives = 169/329 (51.37%), Query Frame = 3
Query:  108 SKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            +K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD S+   +      DR+     L          Q +L++E    R++  ++ H+ M RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    5 TKIINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVRKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYSKEAHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQTWHEEHRSMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 271          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Xenopus
Match: RDX (radixin [Source:NCBI gene;Acc:447978])

HSP 1 Score: 174.096 bits (440), Expect = 2.577e-45
Identity = 105/329 (31.91%), Postives = 169/329 (51.37%), Query Frame = 3
Query:  108 SKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            +K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD S+   +      DR+     L          Q +L++E    R++  ++ H+ M RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    2 TKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVRKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYSKEAHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQTWHEEHRSMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Xenopus
Match: RDX (radixin [Source:NCBI gene;Acc:447978])

HSP 1 Score: 173.711 bits (439), Expect = 2.835e-45
Identity = 105/328 (32.01%), Postives = 168/328 (51.22%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD S+   +      DR+     L          Q +L++E    R++  ++ H+ M RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVRKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYSKEAHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQTWHEEHRSMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Xenopus
Match: RDX (radixin [Source:NCBI gene;Acc:447978])

HSP 1 Score: 174.096 bits (440), Expect = 3.079e-45
Identity = 105/328 (32.01%), Postives = 168/328 (51.22%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD S+   +      DR+     L          Q +L++E    R++  ++ H+ M RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVRKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYSKEAHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQTWHEEHRSMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Xenopus
Match: RDX (radixin [Source:NCBI gene;Acc:447978])

HSP 1 Score: 172.555 bits (436), Expect = 1.064e-44
Identity = 102/314 (32.48%), Postives = 162/314 (51.59%), Query Frame = 3
Query:  117 LHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL+   F    KFFPED+  ELIQ +T+ LF+L VK A++   +                   C                         P + A+LLAS + QA+YGD S+   +      DR+     L          Q +L++E    R++  ++ H+ M RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK
Sbjct:    8 INVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVRKENPLQ---FKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------------C-------------------------PPETAVLLASYAVQAKYGDYSKEAHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQTWHEEHRSMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIK 261          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Mouse
Match: Rdx (radixin [Source:MGI Symbol;Acc:MGI:97887])

HSP 1 Score: 171.785 bits (434), Expect = 3.054e-46
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQE-VTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIK--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Mouse
Match: Rdx (radixin [Source:MGI Symbol;Acc:MGI:97887])

HSP 1 Score: 174.481 bits (441), Expect = 1.281e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Mouse
Match: Rdx (radixin [Source:MGI Symbol;Acc:MGI:97887])

HSP 1 Score: 174.481 bits (441), Expect = 1.281e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Mouse
Match: Rdx (radixin [Source:MGI Symbol;Acc:MGI:97887])

HSP 1 Score: 174.866 bits (442), Expect = 1.493e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Mouse
Match: Ezr (ezrin [Source:MGI Symbol;Acc:MGI:98931])

HSP 1 Score: 165.236 bits (417), Expect = 2.044e-42
Identity = 101/328 (30.79%), Postives = 168/328 (51.22%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQD---DEDRMFXXXXXXXXXXXXXXMQCQLSQEVTR-RVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  +IGL E +YFGL+  Y+D+ G      WLKL+K++SAQ++   +P   ++F    KF+PED+  ELIQ +T+ LF+L VK+ ++   +             C                               P + A+LL S + QA++GD ++   +      +R+     +          Q +LS++    R++  +  H+GM ++ A L YLK+A    ++GI+YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQ--YVDNKG---FPTWLKLDKKVSAQEVRKENP---VQFKFRAKFYPEDVAEELIQDITQKLFFLQVKDGILSDEIY------------C-------------------------------PPETAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMD---------QHKLSRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIK--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. UniProt/SwissProt
Match: sp|Q32LP2|RADI_BOVIN (Radixin OS=Bos taurus OX=9913 GN=RDX PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 7.356e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIK--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. UniProt/SwissProt
Match: sp|P26043|RADI_MOUSE (Radixin OS=Mus musculus OX=10090 GN=Rdx PE=1 SV=3)

HSP 1 Score: 174.866 bits (442), Expect = 7.782e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. UniProt/SwissProt
Match: sp|P35241|RADI_HUMAN (Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 8.310e-45
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIK--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. UniProt/SwissProt
Match: sp|P26044|RADI_PIG (Radixin OS=Sus scrofa OX=9823 GN=RDX PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.165e-44
Identity = 105/328 (32.01%), Postives = 169/328 (51.52%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLE---------QHKLTKEQWEERIQNWHEEHRGMLREDSIMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIK--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. UniProt/SwissProt
Match: sp|Q9PU45|RADI_CHICK (Radixin OS=Gallus gallus OX=9031 GN=RDX PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 3.029e-44
Identity = 107/325 (32.92%), Postives = 171/325 (52.62%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A++   +             C                               P + A+LLAS + Q++YGD ++      E          RLLP  +L Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVRKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIY------------C-------------------------------PPETAVLLASYAVQSKYGDYNK------EIHKLGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIK--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. TrEMBL
Match: A0A5K4EXI7 (Putative merlin/moesin/ezrin/radixin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 3.229e-70
Identity = 198/576 (34.38%), Postives = 291/576 (50.52%), Query Frame = 3
Query:   84 MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVN-NSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMI-----------------------SDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTS------------------DLNSPTYLPSQAS----TPRITTPGGA---------------DPSLISSASMSTHL--SVPGLPINLLKDQLSLPNDSATTNL-SIDTTKTVS-----------LETGPQ---------NCTNASLMLPTIKMDSCTPGPNLAKLE---------------------------VWLHTIQEAKLVMRLSKGNSELFMKRRQPESCQMQQM 1478
            MKW + S++K L I+V  ++++LEF++S K+TG+ LF++VC++IGL ET+YFGL+ Y    NG+++L+ WLKL+K+I +QK      K + F  H KFFPED+E+ELIQ  TR LFYL VK+ ++ +S  N N N F                 GD                  P  DVAILLASL++QAEYGDL E E  D E+  FLP R+LRL+P+ L  Q   +Q VT++ ++ YKSHKGM+R+ AEL YLKVA ++ LFG+D+F I                       +++ +  +W GV+A+G+ +Y    +  P  +F W +IKNVSY++RKFTIKLT++                  +   P  + S+AS    +P I+  G A                 + + S  +S  L  +VP +  NLL   ++L +  A +   S DT + +            LE G +         +C +A+    T    +C   P +   E                           VWL    +AK VM +  GN  LFM+RRQP+S ++QQM
Sbjct:    1 MKW-NNSDAKCLKIRVTLHESELEFNISPKSTGKYLFDLVCSTIGLRETWYFGLQFYSFFPNGRMQLSHWLKLDKKIVSQKPEDIS-KSLCFFFHTKFFPEDVEQELIQATTRRLFYLSVKSTILNRSESNMNGNCF-----------------GDLC----------------PSLDVAILLASLASQAEYGDLCEEELSDTEELTFLPRRILRLIPAQLWTQIHSTQGVTQKFREHYKSHKGMNRDKAELQYLKVAQMHNLFGVDFFPIVYVRMKFPRTLSLAQNESTIWDNTNQCHTNAWLGVTAAGLQLYGKCQRDPPQFTFPWNMIKNVSYRERKFTIKLTSTCRATSKPSQITSIPTLLNETRGPVVISSKASQPSRSPLISITGQAFVGVAVGSSAGGSGTSAASLPSTPISARLVPAVPPVSPNLLDASVNLSSPRAVSKFESCDTAQQLGAPKGFKGRAKVLELGSRCIPGLSIKSSCYSANEFAVTRTSVNCLRAPRVQSAENNVSLPSKGLLKSSNLNFETVSISVVEVWLADPNQAKTVMSMCAGNHSLFMRRRQPDSIEVQQM 541          
BLAST of Merlin:moesin:ezrin:radixin vs. TrEMBL
Match: A0A5J4NWW1 (FERM domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0008312 PE=4 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 4.118e-70
Identity = 149/334 (44.61%), Postives = 211/334 (63.17%), Query Frame = 3
Query:   84 MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL------------NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQD-DEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKL 1046
            MKW    + K L IKV +++++LEF++SHK+TG+ LF++VC++IGL ET+YFGL+NY +  NG++ L +WLKL+K++ +  +              S  K++ F  H KFFPEDIE+ELIQ  TRHLFYL VK+ ++ ++  N                     NG+ S D              P  +VAI LASL AQAEYGDL E E    D+D  FLP RLLRL+P  L+ Q Q  Q + +++K CYKS++G++R+ AEL YLK+A ++ LFG+DYF I DK +  +W GV+A+GI +Y  + + +P  +F W IIKNVSY++RKFTIKL
Sbjct:    1 MKWNRSPSKKLLRIKVTSHESELEFNISHKSTGKYLFDLVCSTIGLRETWYFGLQNYTMLPNGRMRLLQWLKLDKKVPSSTICFLDFVQILSQKTQSDHKQLCFFFHTKFFPEDIEQELIQATTRHLFYLSVKSTILNRNETN--------------------VNGNLSGD------------LCPSVNVAIHLASLIAQAEYGDLCEDELDGKDDDSPFLPNRLLRLIPKQLVSQMQSDQRLAQKLKDCYKSYRGINRDRAELQYLKIAQMHHLFGVDYFPIVDKHHTNAWLGVTAAGIQLYGRNQRERPRYTFQWNIIKNVSYRERKFTIKL 302          
BLAST of Merlin:moesin:ezrin:radixin vs. TrEMBL
Match: A0A5K4EWI2 (Putative merlin/moesin/ezrin/radixin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 5.958e-70
Identity = 198/576 (34.38%), Postives = 291/576 (50.52%), Query Frame = 3
Query:   84 MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVN-NSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMI-----------------------SDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTS------------------DLNSPTYLPSQAS----TPRITTPGGA---------------DPSLISSASMSTHL--SVPGLPINLLKDQLSLPNDSATTNL-SIDTTKTVS-----------LETGPQ---------NCTNASLMLPTIKMDSCTPGPNLAKLE---------------------------VWLHTIQEAKLVMRLSKGNSELFMKRRQPESCQMQQM 1478
            MKW + S++K L I+V  ++++LEF++S K+TG+ LF++VC++IGL ET+YFGL+ Y    NG+++L+ WLKL+K+I +QK      K + F  H KFFPED+E+ELIQ  TR LFYL VK+ ++ +S  N N N F                 GD                  P  DVAILLASL++QAEYGDL E E  D E+  FLP R+LRL+P+ L  Q   +Q VT++ ++ YKSHKGM+R+ AEL YLKVA ++ LFG+D+F I                       +++ +  +W GV+A+G+ +Y    +  P  +F W +IKNVSY++RKFTIKLT++                  +   P  + S+AS    +P I+  G A                 + + S  +S  L  +VP +  NLL   ++L +  A +   S DT + +            LE G +         +C +A+    T    +C   P +   E                           VWL    +AK VM +  GN  LFM+RRQP+S ++QQM
Sbjct:    1 MKW-NNSDAKCLKIRVTLHESELEFNISPKSTGKYLFDLVCSTIGLRETWYFGLQFYSFFPNGRMQLSHWLKLDKKIVSQKPEDIS-KSLCFFFHTKFFPEDVEQELIQATTRRLFYLSVKSTILNRSESNMNGNCF-----------------GDLC----------------PSLDVAILLASLASQAEYGDLCEEELSDTEELTFLPRRILRLIPAQLWTQIHSTQGVTQKFREHYKSHKGMNRDKAELQYLKVAQMHNLFGVDFFPIVYVRMKFPRTLSLAQNESTIWDNTNQCHTNAWLGVTAAGLQLYGKCQRDPPQFTFPWNMIKNVSYRERKFTIKLTSTCRATSKPSQITSIPTLLNETRGPVVISSKASQPSRSPLISITGQAFVGVAVGSSAGGSGTSAASLPSTPISARLVPAVPPVSPNLLDASVNLSSPRAVSKFESCDTAQQLGAPKGFKGRAKVLELGSRCIPGLSIKSSCYSANEFAVTRTSVNCLRAPRVQSAENNVSLPSKGLLKSSNLNFETVSISVVEVWLADPNQAKTVMSMCAGNHSLFMRRRQPDSIEVQQM 541          
BLAST of Merlin:moesin:ezrin:radixin vs. TrEMBL
Match: A0A4S2M2Q7 (FERM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003140 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.056e-68
Identity = 152/349 (43.55%), Postives = 212/349 (60.74%), Query Frame = 3
Query:   84 MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMIS---------------------------DKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLT 1049
            MKW    + K L IKV +++++LEF+LS K+TG+ LF++VC++IGL ET+YFGL++Y +  NG++ L++WLKL+K+I +QK + S  K   F  H KFFPEDIE+ELIQ  TRHLFYL VK  ++ ++  N                     NG+ S D              P  DVAILLASL+AQAEYGD+ E +    ++  FLP RLLRLLP  L+ Q Q +Q + +++K CYKS+KG++R+ AEL YLKVA L+ LFG+DYF I                            DK +  +W GV+A+GI +Y  + + +P  +F W IIKNVSY++RKFT+KL 
Sbjct:    1 MKWYRGPSKKLLRIKVTSHESELEFNLSSKSTGKYLFDLVCSTIGLRETWYFGLQSYTLLPNGRMRLSQWLKLDKKIVSQK-DESGQKLRCFFFHTKFFPEDIEQELIQATTRHLFYLSVKATILNRNETN--------------------VNGNLSGD------------LCPSMDVAILLASLAAQAEYGDVCEDDLDGKDESPFLPQRLLRLLPKTLIHQVQSNQSLAQKLKDCYKSYKGITRDKAELQYLKVAQLHHLFGVDYFPIVCVRMKCPRTLSLTRYLTRNELTPWHSWDKHHTNAWLGVTAAGIQLYGKNQRERPRYTFQWNIIKNVSYRERKFTVKLV 316          
BLAST of Merlin:moesin:ezrin:radixin vs. TrEMBL
Match: A0A504YRN6 (Radixin OS=Fasciola gigantica OX=46835 GN=FGIG_03562 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 5.826e-68
Identity = 171/452 (37.83%), Postives = 249/452 (55.09%), Query Frame = 3
Query:   84 MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMIS---------------------------DKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKL-------------------TTSDLNSPTYLPSQASTPRIT--TPGGADPSLISS---------ASMSTHLSVPGLPINLLKDQLSLPNDSATTNLSIDTTKTVS 1268
            MKW      K L IKV +++++LEF++S K+TG+ LF++VC++IGL ET+YFGL++Y +  NG++ L +WLKL+K+I +Q+ N +  K++ F  H KFFPEDIE+ELIQ  TRHLFYL VK  ++ +    N   F+ T S            GD                  P  DVAI+LASL+AQAEYGDL E E  D +D  FLP RLLRL+P  L+   Q +Q + +++++CYKS+KG++R+ AEL YLK+A  + LFG+D+F I                            DK +  +W GV+A+GI +Y  + + +P  +F W IIKNVSY++RKFT+KL                   TTS  +     PS  S PR +  + GG  P L+S+          +  ++LS   LP   L  +L+LP  S   N  + +   ++
Sbjct:    1 MKWNKGPTKKLLRIKVTSHESELEFNISPKSTGKYLFDLVCSTIGLRETWYFGLQSYSLLPNGRMRLAQWLKLDKKIVSQRANAT-QKQLCFFFHTKFFPEDIEQELIQATTRHLFYLSVKATILNR----NETDFNGTFS------------GDLC----------------PSLDVAIVLASLAAQAEYGDLCEDELDDKDDPNFLPTRLLRLIPVQLVQHVQTNQVLAQKLRECYKSYKGINRDKAELQYLKLAQTHHLFGVDFFPIVCVRMKCPRALSLARYLTRNELTAWHGWDKHHTNAWLGVTAAGIQLYGKNRRERPRYTFQWNIIKNVSYRERKFTVKLIAGWRFPHKSCQPPVAATSTTSGASCVETFPS-GSRPRQSSRSTGGRSP-LVSATGPKLTVGLGAGGSNLSATSLPSTPLSARLALPASSPMGNSGLGSPSNLA 417          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Cavefish
Match: ENSAMXT00000054018.1 (radixin [Source:NCBI gene;Acc:103042331])

HSP 1 Score: 173.711 bits (439), Expect = 2.042e-45
Identity = 107/328 (32.62%), Postives = 171/328 (52.13%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQD---DEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y DS G    T WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A     ++N+ N+       C                               P + A+LLAS S QA+YGD ++   +      +R+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ ++K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YTDSKG---YTTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEA-----ILNDENY-------C-------------------------------PPETAVLLASYSVQAKYGDYNKDIHKPGYLGNERLLPQRVLE---------QHKLTKEQWEERIQTWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHEDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Cavefish
Match: ENSAMXT00000053554.1 (radixin [Source:NCBI gene;Acc:103042331])

HSP 1 Score: 173.711 bits (439), Expect = 2.150e-45
Identity = 107/328 (32.62%), Postives = 171/328 (52.13%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQD---DEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y DS G    T WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T+ LF+L VK A     ++N+ N+       C                               P + A+LLAS S QA+YGD ++   +      +R+     L          Q +L++E    R++  ++ H+GM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ ++K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YTDSKG---YTTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITQRLFFLQVKEA-----ILNDENY-------C-------------------------------PPETAVLLASYSVQAKYGDYNKDIHKPGYLGNERLLPQRVLE---------QHKLTKEQWEERIQTWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHEDKLTPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Cavefish
Match: msna (moesin [Source:NCBI gene;Acc:103037010])

HSP 1 Score: 164.081 bits (414), Expect = 3.592e-42
Identity = 103/316 (32.59%), Postives = 158/316 (50.00%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSE---TECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            K + ++V T D +LEF +   TTG+ LF+ V  +IGL E ++FGL+  Y D+ G      WLKL K+++AQ +   SPL    F    KFFPED+  ELIQ  T+ LF+L VK  ++   +                   C                         P + A+LLAS + QA+Y D ++   T      D++     L          Q +L++E    R++  ++ HKGM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ ++K+ P   F W  I+N+S+ D+KF IK
Sbjct:    3 KTISVRVTTMDAELEFAILPNTTGKQLFDQVVKTIGLREVWFFGLQ--YQDTKG---FPTWLKLNKKVTAQDVRKESPLL---FKFRGKFFPEDVSEELIQEATQRLFFLQVKEGILNDDIY------------------C-------------------------PPETAVLLASYAVQAKYADYNKDAHTPGYLSNDKLLPQRVLE---------QHKLNKEQWEERIQVWHEEHKGMLREDSMMEYLKIAQDLEMYGVNYFSIKNKKGTELWLGVDALGLNIYEQNDKMTPKIGFPWSEIRNISFNDKKFVIK 258          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Cavefish
Match: msna (moesin [Source:NCBI gene;Acc:103037010])

HSP 1 Score: 164.081 bits (414), Expect = 3.592e-42
Identity = 103/316 (32.59%), Postives = 158/316 (50.00%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSE---TECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            K + ++V T D +LEF +   TTG+ LF+ V  +IGL E ++FGL+  Y D+ G      WLKL K+++AQ +   SPL    F    KFFPED+  ELIQ  T+ LF+L VK  ++   +                   C                         P + A+LLAS + QA+Y D ++   T      D++     L          Q +L++E    R++  ++ HKGM RED+ + YLK+A    ++G++YF I +K     W GV A G++IY+ ++K+ P   F W  I+N+S+ D+KF IK
Sbjct:    3 KTISVRVTTMDAELEFAILPNTTGKQLFDQVVKTIGLREVWFFGLQ--YQDTKG---FPTWLKLNKKVTAQDVRKESPLL---FKFRGKFFPEDVSEELIQEATQRLFFLQVKEGILNDDIY------------------C-------------------------PPETAVLLASYAVQAKYADYNKDAHTPGYLSNDKLLPQRVLE---------QHKLNKEQWEERIQVWHEEHKGMLREDSMMEYLKIAQDLEMYGVNYFSIKNKKGTELWLGVDALGLNIYEQNDKMTPKIGFPWSEIRNISFNDKKFVIK 258          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Cavefish
Match: nf2a (neurofibromin 2 [Source:NCBI gene;Acc:103036819])

HSP 1 Score: 163.31 bits (412), Expect = 4.511e-42
Identity = 98/317 (30.91%), Postives = 160/317 (50.47%), Query Frame = 3
Query:   93 VSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            + +  ++  ++K+ T D DLEF    K  G+ LFE+VC ++GL ET++FGL+    D+        WLK++K++  Q +       + FL   KF+PE+IE EL+Q +T+HLF+L VK  ++ + V             C                               P + ++LLAS + QA+YGD   +  +     +     L + + +   M  ++ +E   R+  CY  H+G +R++AE+ YLK+A    ++G++YF I +K       GV A G+ IY  +NK+ P  SF W  I+N+SY DR+F IK
Sbjct:   14 LRRRQARNFNVKIVTVDADLEFSCETKWKGKDLFELVCRTLGLRETWFFGLQYSVKDT------VAWLKMDKKVLDQDVPKEEPIILNFL--AKFYPENIEEELVQDITQHLFFLQVKKKILEEEVY------------C-------------------------------PPEASVLLASYAVQAKYGDYDPSVHKP--GFLAQEELLPKRVINLYQMTAEMWEE---RITVCYAEHRGRTRDEAEMEYLKIAQDLEMYGVNYFFIRNKKGTDLLLGVDALGLHIYDPENKLTPKISFPWNEIRNISYSDREFAIK 274          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008042.1 (pep scaffold:Pmarinus_7.0:GL501310:70164:110449:1 gene:ENSPMAG00000007245.1 transcript:ENSPMAT00000008042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.369 bits (381), Expect = 1.293e-38
Identity = 103/335 (30.75%), Postives = 167/335 (49.85%), Query Frame = 3
Query:  117 LHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKE--IKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQ-EVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYLPSQASTPRITT 1112
            ++++V T D ++EF + H   G  LF+ +  +IGL E ++FGL+  Y D  G I    WLK++K++S+    H   KE  ++F    K+FPED+  ELIQ  T+ LFYL +K  ++ + +             C                               P +  +LLAS + QA+YGD S+      E          +LLPS +L Q +LS  +   R++  +  H GM REDA + Y+K+A    ++G++YF I +K       GV A G++IY+ ++K+ P   F W  I+N+S+ D+KF I+    D  +P ++     +PR+ T
Sbjct:    2 INVRVTTLDAEMEFSILHTIYGRQLFDQLVRTIGLREVWFFGLQ--YTDLKGSI---GWLKMDKKVSS----HDIRKENPVQFRFRAKYFPEDVSEELIQEATQRLFYLQIKEGILSEEIY------------C-------------------------------PPETGVLLASYAVQAKYGDYSK------EKNPPGYLANEKLLPSRVLEQHKLSNAQWEERIQAWHSEHNGMLREDAIMEYMKIAQDLEMYGVNYFDIKNKKGTDLQLGVDALGLNIYEKNDKLTPKIGFPWSEIRNISFTDKKFCIR--PIDKKAPDFV---FYSPRLQT 273          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Sea Lamprey
Match: nf2b (neurofibromin 2b (merlin) [Source:ZFIN;Acc:ZDB-GENE-040622-3])

HSP 1 Score: 142.124 bits (357), Expect = 8.491e-36
Identity = 97/299 (32.44%), Postives = 153/299 (51.17%), Query Frame = 3
Query:  171 KTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETE------CQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIK 1043
            K  G+ LF++VC +IGL ET++FGL     D+     LT WLK+EK++  Q++    P   I F    KF+PE ++ EL+Q +T+HLF+L VK  ++ + +             C+ +A                               ++LLAS +  A+YG+   +        QD+            LLP  ++ Q QL+Q +   R+   YK H+GM+R++AE+ YLK+A    ++G++YF I DK       GV A G+ I++ ++K+Q  +SF W  IKNV Y D++FTIK
Sbjct:    3 KMKGKDLFDLVCRTIGLRETWFFGLCFMVKDT-----LT-WLKMEKKVLEQEVPKEDP---ICFQFLAKFYPESVDEELVQEITQHLFFLQVKKKILDEEIF------------CSPEA-------------------------------SVLLASYAVLAKYGEYDRSLHTPGFLAQDE------------LLPKKVINQYQLTQPMWEERITNWYKGHQGMTRDEAEMEYLKIAQDLEMYGVNYFPIKDKKGVDFLLGVDALGLKIFEPNDKLQAKKSFPWSGIKNVQYSDKEFTIK 237          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 3.820e-14
Identity = 78/307 (25.41%), Postives = 125/307 (40.72%), Query Frame = 3
Query:  129 VNTYDND-LEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKL 1046
            +N  DN  +    +    G++L + V A + L ET YFGL+ +  DS    E  +WL   K +  Q    SP     F    KFF  D  + L +  TR+ ++L ++N ++                                            +R   P + A LLAS   Q+E GD SETE              L    S L    +   +  + V + +K H GM+  DAE  YL VA     +G++     D+ N     GV+A G+++Y  +N ++ + +F W  I  + +K + F ++L
Sbjct:   33 INLLDNTAITLRANKSEAGKALLDAVFAHLDLAETDYFGLQ-FADDST---ETPRWLDPTKPLRKQIKRSSPYI---FNFRVKFFVTDPSK-LQEEYTRYHYFLQLRNDIL-------------------------------------------EARLPCPHNTAALLASYIVQSELGDYSETE-------------HLPGYLSDLRFLPRQGLDFEKEVAKLHKQHVGMTPADAEFNYLNVAKNVEFYGVELHYARDQSNVEIMVGVTAGGVNVY--NNGVR-ISNFPWIKIVKIFFKLKHFFVQL 272          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006866.1 (pep scaffold:Pmarinus_7.0:GL479164:324:35742:-1 gene:ENSPMAG00000006197.1 transcript:ENSPMAT00000006866.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.236e-12
Identity = 28/89 (31.46%), Postives = 53/89 (59.55%), Query Frame = 3
Query:  780 RVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKL 1046
            R+ + YK  KG +R  A + Y+ V      +G+ Y+ + DK     W G+S  GIS Y   +K++P Q + W+ ++N+ ++++KF+I++
Sbjct:   93 RIIEHYKKLKGQTRGQAIVNYMSVVETLPSYGVHYYPVKDKKGLPWWLGLSNKGISQYDFQDKLKPRQIYQWRQLENLYFREKKFSIEV 181          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Sea Lamprey
Match: si:ch211-220f12.1 (FERM domain containing 4A [Source:HGNC Symbol;Acc:HGNC:25491])

HSP 1 Score: 61.2326 bits (147), Expect = 4.265e-10
Identity = 24/89 (26.97%), Postives = 50/89 (56.18%), Query Frame = 3
Query:  780 RVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKL 1046
            RV + Y+   G++   A + Y+ +      +GI Y+ + DK     W G+S  GI  Y   +++QP + F W  ++N+ ++++KF++++
Sbjct:   34 RVIENYQRLVGLTHGQAIVNYMSIIEALPTYGIHYYNVKDKQGIPWWLGLSWKGIFQYDYQDRVQPRKVFHWAQLENLFFREKKFSVEV 122          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Nematostella
Match: EDO44119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWH0])

HSP 1 Score: 154.066 bits (388), Expect = 2.322e-39
Identity = 101/325 (31.08%), Postives = 165/325 (50.77%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKE-IKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K  ++ ++T D +LEF L     G  LF++V  ++G+ ET+YFGL+  Y    G++    WL+ +K++  Q   +  LKE     L  KF+PED+  EL+Q +T+HLFYL VK+A++                  T K  C                         P + ++LLAS + QA++GD       D +       +   LLP  ++ Q Q++  +   R+   Y  H G++R++AE+ YLK+A    ++G+ YF I++K   A   G+   G++IY+ DN++ P  SF WK IKN+S+  R F IK  + D  +P ++
Sbjct:    3 KTFNVCISTMDAELEFPLEQSAKGSELFDLVVRTLGVRETWYFGLQFEY--PTGEL---AWLQFDKKVYKQ---NKTLKEPFALRLRAKFYPEDVAEELVQEITQHLFYLQVKDAIL------------------TMKTFC-------------------------PPEASVLLASYAVQAKFGDY------DKDLHKPGFLQNEHLLPQTVIEQYQMTPAMWEERITSWYAEHHGLTRDEAEMEYLKLAQDLEMYGVSYFDITNKKGTAISLGIDCRGLNIYEKDNRLNPKTSFPWKEIKNISFHSRTFVIK--SIDKQAPDFI 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Nematostella
Match: EDO31608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXF9])

HSP 1 Score: 152.91 bits (385), Expect = 7.447e-39
Identity = 132/487 (27.10%), Postives = 211/487 (43.33%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFE----MVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLN-HSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQA---EYGDLSETECQDDE---DRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL---PSQASTPRITTPGGADPSLISSASMSTHLSVPGLPINLLKDQLSLPNDSATTNLSIDTTKTVSLETGPQNCTNASLMLPTIKMDSCTPGPNLAKLEVWLHTIQEAKLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQA 1526
            KA++++V T D +LEF +   TTG+ LF+     V  +IGL E ++FGL+  + D+ G      WLKL K++ +Q +   +PL+   F    KFFPED+  ELIQ +T+ +F+L +K A+    V             C                               P +  +LLAS   QA   EY D S    +D++   DR+                Q  LS+E    R+   +K H  M++EDA + YLK+     ++G++YF I +K +   + GV A G++IY  ++K+ P   F W  I+N+S+ D+KF IK    D  +P ++   P   S  RI      +  L         + V  +     ++++    +           K     T  +N  +  L+   +K          A  E      +E +   +L + N EL  KR Q +  + Q  R+Q   ERA R+ E A
Sbjct:    3 KAINVRVTTMDAELEFAIQPSTTGKQLFDQASNFVVKTIGLREIWFFGLQ--FTDNKGD---ASWLKLNKKVMSQDVKKETPLQ---FKFRVKFFPEDVAEELIQEVTQKMFFLQIKEAIFTSDVF------------C-------------------------------PPETTVLLASYMCQAKHGEYTDESAALIKDEKLLPDRVLD--------------QHTLSKEQWDERIILWWKEHGRMAKEDAVIEYLKITQDLEMYGVNYFQIKNKKHTDLYLGVDALGLNIYDQNDKLTPKIGFPWSEIRNISFNDKKFCIKPI--DKKAPDFIFFSPRLRSNKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKVRREKERNA------LVKEAEARTKAEN--DRKLLEEKLKQSEAEKEEMRAAQEEERRIKEELEKERKLIEQNRELLEKRVQEQEAETQ--RLQEEFERAARERENA 412          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Nematostella
Match: EDO38965 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBA4])

HSP 1 Score: 90.8929 bits (224), Expect = 4.408e-19
Identity = 76/306 (24.84%), Postives = 127/306 (41.50%), Query Frame = 3
Query:  141 DNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTS 1055
            +  L+F +  +     L +MV +   LHE  YFGL   Y +  G      WL+L+KR+   +L  H PL     L   +FF  +I   L +P+T  LF+L  +  + + S+            +C                                ++    LA    QA YGD +  E    + +         L     +  C+  ++V  R K C    KG    +A + YL +      +G+ Y+ + DK +   W G+S  GI +Y   +KI+P + F W  I+N+ ++DRKF++++  S
Sbjct:   10 ERRLDFLIQPRLMSCDLLDMVASHFNLHEKEYFGLS--YAEEGGA---QTWLRLDKRVLDHELPRHDPLI---LLFAVRFFVPNI-LILKEPVTVELFFLQARALIFKGSI------------QCD-------------------------------TETVFELAGYVLQAVYGDFTSVEATKQDLKKIAVLPTRTLKEHPSISYCE--EKVLTRYKLCVGQTKG----EAIVRYLCIFQSLPTYGVHYYEVKDKGSIPWWLGLSPRGIGVYDHTDKIKPRKLFQWNQIENIYFRDRKFSLEIRDS 257          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Nematostella
Match: EDO30224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E3])

HSP 1 Score: 84.3445 bits (207), Expect = 3.361e-17
Identity = 83/311 (26.69%), Postives = 131/311 (42.12%), Query Frame = 3
Query:  123 IKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDS-NGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDL--SETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKL 1046
            ++V   D+D E  +   T G+ LF+ VC  IGL E  YFGL   YID  +GQ     WL+ ++ I  Q +  +PL    F    KF+PE+    L + +TR+ F L ++  L++  +            +C                            SNP   +  LLAS   QAE GDL   E E     D  F P               +   E+ ++++  ++ H GM+  DAE  YL       L+G D +        A    +SA G+ ++Q + +   +  F W  I ++ +K +KF++ L
Sbjct:   11 VQVAGLDSDYECPIDKTTKGDHLFDQVCDHIGLAEKEYFGLR--YIDEKDGQF---NWLEGDRSIKRQ-MGKAPL---HFYFAVKFYPEN-PTTLREDITRYQFVLQLREDLLKGRI------------QC----------------------------SNP---IHALLASYVMQAELGDLHPEEHEVAYLSDLKFFP---------------KQPPELRQKIEAFHRKHVGMTPSDAEFQYLDNVRKLPLYGRDMYQAWGDEGQAVTIAISAWGVEVFQNNRQ---MHRFVWPKIISIGFKSKKFSLTL 250          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Nematostella
Match: EDO36130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ3])

HSP 1 Score: 63.929 bits (154), Expect = 6.781e-11
Identity = 76/320 (23.75%), Postives = 125/320 (39.06%), Query Frame = 3
Query:  162 LSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPT-----YLPSQASTPRI 1106
            L     G  L   V   + L E  YFGL     D  G+     WL  +K I  Q   + P     F L  KF+ E    +L   MTR++  L V++ +I                 C  +  C+                G+ +          LL S   Q+E+GD    E + +               +GL+     S E+  R+K+ +K H+G++ E+A+  YL+ A    ++G+D     D        GVS +G+ +++ D +      F W  +  +SYK R F++K    +L   T      LP++ +  R+
Sbjct:    1 LQKTAKGIDLMVAVAEHLNLDEKEYFGL---LYDHKGE---KYWLDPQKEIKKQLKGNLP----HFELAVKFY-EPYPSKLKHDMTRYMMVLQVRDDII-----------------C-ERLPCSF---------------GAQA----------LLGSYVVQSEFGDYDPHEHKGN-------------YLAGLVFSPNQSHELVERIKELHKEHRGLTPEEADTQYLEAARKLTMYGVDAHPARDGNGDEVLVGVSYAGVLVFKDDLR---QNKFPWPKVVYLSYKGRDFSVKSRPGELEELTTTMTFKLPTEKAAKRL 250          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Medaka
Match: ENSORLT00000015174.2 (ezrin [Source:NCBI gene;Acc:101155563])

HSP 1 Score: 176.022 bits (445), Expect = 5.219e-46
Identity = 108/327 (33.03%), Postives = 169/327 (51.68%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            KA++++V T D +LEF +   TTG+ LFE V  ++GL E +YFGL+  Y+D+ G    + WLKLEK+++AQ++      + +FL   KFFPED+  ELIQ +T+ LF++ VK  ++   V             C                               P + A+LLAS S QA +GD  ++  Q      +R+     +          Q +LS+E    R++  ++ H GM +EDA L YLK+A    ++G+++F I +K     W GV A G++IY+ D+K+ P   F W  I+N+S+ D+KF IK    D  SP ++
Sbjct:   42 KAVNVRVTTMDAELEFAIQPSTTGKQLFEQVVKTVGLREIWYFGLQ--YVDTKG---YSTWLKLEKKVTAQEIKKENPLQFRFL--AKFFPEDVAEELIQDITQKLFFMQVKETILSDEVY------------C-------------------------------PPETAVLLASYSVQARFGDYDKSIHQTGYLLSERLLPQRVME---------QHKLSKEQWEERIQVWHEEHCGMLKEDAMLEYLKIAQDLEMYGVNFFGIKNKKGTELWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFIIK--PIDKKSPDFV 307          

HSP 2 Score: 53.9138 bits (128), Expect = 7.205e-7
Identity = 23/46 (50.00%), Postives = 36/46 (78.26%), Query Frame = 3
Query: 1395 KLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQAHL 1532
            K V++L  GN EL+M+RR+P+S ++QQM+ QA+ E+ +R  E+AHL
Sbjct:  317 KRVLQLCMGNHELYMRRRKPDSIEVQQMKTQAKEEKNQRQTEKAHL 362          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Medaka
Match: ENSORLT00000011512.2 (radixin [Source:NCBI gene;Acc:101156778])

HSP 1 Score: 173.326 bits (438), Expect = 2.400e-45
Identity = 107/328 (32.62%), Postives = 171/328 (52.13%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNH-SPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y DS G +    WLKL K+++ Q +   +PL+   F    KFFPED+  ELIQ +T+ LF+L VK A     ++N+ N+             C                         P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM REDA + YLK+A    ++G++YF I +K     W GV A G++IY+ ++K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YTDSKGYV---TWLKLNKKVTQQDVKKDNPLQ---FKFRAKFFPEDVSEELIQEITQKLFFLQVKEA-----ILNDENY-------------C-------------------------PPETAVLLASYAVQAKYGDYNKDIHKPGYLASDRLLPQRVLE---------QHKLTKEQWEDRIQTWHEEHRGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHEDKLSPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Medaka
Match: ENSORLT00000040831.1 (radixin [Source:NCBI gene;Acc:101156778])

HSP 1 Score: 173.326 bits (438), Expect = 2.445e-45
Identity = 107/328 (32.62%), Postives = 171/328 (52.13%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNH-SPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEV-TRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y DS G +    WLKL K+++ Q +   +PL+   F    KFFPED+  ELIQ +T+ LF+L VK A     ++N+ N+             C                         P + A+LLAS + QA+YGD ++   +      DR+     L          Q +L++E    R++  ++ H+GM REDA + YLK+A    ++G++YF I +K     W GV A G++IY+ ++K+ P   F W  I+N+S+ D+KF IK    D  +P ++
Sbjct:    3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YTDSKGYV---TWLKLNKKVTQQDVKKDNPLQ---FKFRAKFFPEDVSEELIQEITQKLFFLQVKEA-----ILNDENY-------------C-------------------------PPETAVLLASYAVQAKYGDYNKDIHKPGYLASDRLLPQRVLE---------QHKLTKEQWEDRIQTWHEEHRGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHEDKLSPKIGFPWSEIRNISFNDKKFVIKPI--DKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Medaka
Match: ENSORLT00000006905.2 (radixin [Source:NCBI gene;Acc:101156069])

HSP 1 Score: 168.703 bits (426), Expect = 1.086e-43
Identity = 102/327 (31.19%), Postives = 167/327 (51.07%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T  LF+L VK A     ++N+ N+       C                               P + A+LLAS + QA+YGD S    +      +R+     L +   +    +         R++  ++ H+G+ REDA + YLK+A    ++G++YF I +K     W GV A G++IY+ ++K+ P   F W  I+N+S+ D+KF I+    D  +P ++
Sbjct:    3 KPVNVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITHRLFFLQVKEA-----ILNDENY-------C-------------------------------PPETAVLLASYAVQAKYGDYSRDVHKPGYLTHERLLPQRVLEQHKLTKDQWEV--------RIQTWHEEHRGILREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTQLWLGVDALGLNIYEHEDKLTPKIGFPWSEIRNISFNDKKFFIR--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Medaka
Match: ENSORLT00000028018.1 (radixin [Source:NCBI gene;Acc:101156069])

HSP 1 Score: 168.703 bits (426), Expect = 1.086e-43
Identity = 102/327 (31.19%), Postives = 167/327 (51.07%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKL-NHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDD---EDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K ++++V T D +LEF +   TTG+ LF+ V  ++GL E ++FGL+  Y+DS G    + WLKL K+++ Q +   +PL   +F    KFFPED+  ELIQ +T  LF+L VK A     ++N+ N+       C                               P + A+LLAS + QA+YGD S    +      +R+     L +   +    +         R++  ++ H+G+ REDA + YLK+A    ++G++YF I +K     W GV A G++IY+ ++K+ P   F W  I+N+S+ D+KF I+    D  +P ++
Sbjct:    3 KPVNVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQ--YVDSKG---YSTWLKLNKKVTQQDVKKENPL---QFKFRAKFFPEDVSEELIQEITHRLFFLQVKEA-----ILNDENY-------C-------------------------------PPETAVLLASYAVQAKYGDYSRDVHKPGYLTHERLLPQRVLEQHKLTKDQWEV--------RIQTWHEEHRGILREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTQLWLGVDALGLNIYEHEDKLTPKIGFPWSEIRNISFNDKKFFIR--PIDKKAPDFV 268          
BLAST of Merlin:moesin:ezrin:radixin vs. Planmine SMEST
Match: SMESG000016264.1 (SMESG000016264.1)

HSP 1 Score: 1493.02 bits (3864), Expect = 0.000e+0
Identity = 770/773 (99.61%), Postives = 772/773 (99.87%), Query Frame = 3
Query:   84 MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYLPSQASTPRITTPGGADPSLISSASMSTHLSVPGLPINLLKDQLSLPNDSATTNLSIDTTKTVSLETGPQNCTNASLMLPTIKMDSCTPGPNLAKLEVWLHTIQEAKLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQAHLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCKTAGQLMXXXXXXXXXXXXLHEEQVHELTRCLDRSLGLPEQLLYWGASGAGGECSQSRISLAHPGNSLPSLRCHTVDTRLAMPGTDPLARRKLSPQALVKNSLVSDTISVRHLEAELQKEKARFSVLQTQFLSELCEAYSHLEMVHGTKLYNRNNKFYPFLNSPWQPGLDSWDQKKEFGPNYREIVGWNDQGLCFPQELLELDNQEKLIEHHYSVPITNIDPTVSAPHTWTSETPMMRKRIIDPLPHYYEMGGYIVNTT 2402
            MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFLPGRLLRLLPSGLLMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYLPSQASTPRITTPGGADPSLISSASMSTHLSVPGLPINLLKDQLSLPNDSATTNLSIDTTKTVSLETGPQNCTNASLMLPTIKMDSCTPGPNLAKLEVWLHTIQEAKLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQAHLCRARAEKQAALEAKAVLEEKVAELEAALESCKTAGQLMAEKARYAKEEAKLHEEQVHELTRCLDRSLGLPEQLLYWGASGAGGEC+QSRISLAHPGNSLPSLRCH VDTRLAMPGTDPLARRKLSPQALVKNSLVSDTISVRHLEAELQKEKARFSVLQTQFLSELCEAYSHLEMVHGTKLYNRNNKFYPFLNSPWQPGLDSWDQKKEFGPNYREIVGWNDQGLCFPQELLELDNQEKLIEHHYSVPITNIDPTVSAPHTWTSETPMMRKR+IDPLPHYYEMGGYIVNTT
Sbjct:    1 MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFLPGRLLRLLPSGLLMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYLPSQASTPRITTPGGADPSLISSASMSTHLSVPGLPINLLKDQLSLPNDSATTNLSIDTTKTVSLETGPQNCTNASLMLPTIKMDSCTPGPNLAKLEVWLHTIQEAKLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQAHLCRARAEKQAALEAKAVLEEKVAELEAALESCKTAGQLMAEKARYAKEEAKLHEEQVHELTRCLDRSLGLPEQLLYWGASGAGGECNQSRISLAHPGNSLPSLRCHAVDTRLAMPGTDPLARRKLSPQALVKNSLVSDTISVRHLEAELQKEKARFSVLQTQFLSELCEAYSHLEMVHGTKLYNRNNKFYPFLNSPWQPGLDSWDQKKEFGPNYREIVGWNDQGLCFPQELLELDNQEKLIEHHYSVPITNIDPTVSAPHTWTSETPMMRKRVIDPLPHYYEMGGYIVNTT 773          
BLAST of Merlin:moesin:ezrin:radixin vs. Planmine SMEST
Match: SMESG000016264.1 (SMESG000016264.1)

HSP 1 Score: 1492.25 bits (3862), Expect = 0.000e+0
Identity = 770/773 (99.61%), Postives = 772/773 (99.87%), Query Frame = 3
Query:   84 MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYLPSQASTPRITTPGGADPSLISSASMSTHLSVPGLPINLLKDQLSLPNDSATTNLSIDTTKTVSLETGPQNCTNASLMLPTIKMDSCTPGPNLAKLEVWLHTIQEAKLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQAHLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCKTAGQLMXXXXXXXXXXXXLHEEQVHELTRCLDRSLGLPEQLLYWGASGAGGECSQSRISLAHPGNSLPSLRCHTVDTRLAMPGTDPLARRKLSPQALVKNSLVSDTISVRHLEAELQKEKARFSVLQTQFLSELCEAYSHLEMVHGTKLYNRNNKFYPFLNSPWQPGLDSWDQKKEFGPNYREIVGWNDQGLCFPQELLELDNQEKLIEHHYSVPITNIDPTVSAPHTWTSETPMMRKRIIDPLPHYYEMGGYIVNTT 2402
            MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFLPGRLLRLLPSGLLMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYLPSQASTPRITTPGGADPSLISSASMSTHLSVPGLPINLLKDQLSLPNDSATTNLSIDTTKTVSLETGPQNCTNASLMLPTIKMDSCTPGPNLAKLEVWLHTIQEAKLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQAHLCRARAEKQAALEAKAVLEEKVAELEAALESCKTAGQLMAEKARYAKEEAKLHEEQVHELTRCLDRSLGLPEQLLYWGASGAGGEC+QSRISLAHPGNSLPSLRCH VDTRLAMPGTDPLARRKLSPQALVKNSLVSDTISVRHLEAELQKEKARFSVLQTQFLSELCEAYSHLEMVHGTKLYNRNNKFYPFLNSPWQPGLDSWDQKKEFGPNYREIVGWNDQGLCFPQELLELDNQEKLIEHHYSVPITNIDPTVSAPHTWTSETPMMRKR+IDPLPHYYEMGGYIVNTT
Sbjct:    1 MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFLPGRLLRLLPSGLLMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYLPSQASTPRITTPGGADPSLISSASMSTHLSVPGLPINLLKDQLSLPNDSATTNLSIDTTKTVSLETGPQNCTNASLMLPTIKMDSCTPGPNLAKLEVWLHTIQEAKLVMRLSKGNSELFMKRRQPESCQMQQMRIQARAERARRDVEQAHLCRARAEKQAALEAKAVLEEKVAELEAALESCKTAGQLMAEKARYAKEEAKLHEEQVHELTRCLDRSLGLPEQLLYWGASGAGGECNQSRISLAHPGNSLPSLRCHAVDTRLAMPGTDPLARRKLSPQALVKNSLVSDTISVRHLEAELQKEKARFSVLQTQFLSELCEAYSHLEMVHGTKLYNRNNKFYPFLNSPWQPGLDSWDQKKEFGPNYREIVGWNDQGLCFPQELLELDNQEKLIEHHYSVPITNIDPTVSAPHTWTSETPMMRKRVIDPLPHYYEMGGYIVNTT 773          
BLAST of Merlin:moesin:ezrin:radixin vs. Planmine SMEST
Match: SMESG000070273.1 (SMESG000070273.1)

HSP 1 Score: 168.703 bits (426), Expect = 5.432e-44
Identity = 114/324 (35.19%), Postives = 169/324 (52.16%), Query Frame = 3
Query:  108 SKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            SK + +K++T +++LEF ++  TTGE LFE V  ++ L ET++FGL   + DS G      WLK  ++I+AQ +      + KF +  K++PE++E EL+Q +T+ LFYL V+N                                        DI DGS      P + ++LLAS + Q +YGD  E E  DD +  F+    L         +   ++ +   VK  YK+HK M RE+A + YLK+A    +FG++YF I +K       GV A G+SIY+ DNK+ P   F W  IKNVSY ++KFTIK  +SD NS  ++
Sbjct:    2 SKPISVKISTVESELEFSVAANTTGEKLFEQVVKTLNLRETWFFGL--LFKDSKG---FPTWLKYNRKITAQDVGKQYPLQFKFCV--KYYPEEVENELVQEVTQRLFYLQVRN----------------------------------------DILDGSIY---CPPESSVLLASYACQCKYGDFRE-ELIDDPNN-FINTDNLLPERVIEQHEISKAKWIETIVK-MYKNHKDMLREEAIVEYLKLAQDLEMFGVNYFNIKNKKGSELLLGVDALGLSIYKQDNKLTPTIGFPWSEIKNVSYSNKKFTIK--SSDKNSSNFV 270          
BLAST of Merlin:moesin:ezrin:radixin vs. Planmine SMEST
Match: SMESG000056380.1 (SMESG000056380.1)

HSP 1 Score: 159.844 bits (403), Expect = 5.574e-41
Identity = 105/325 (32.31%), Postives = 175/325 (53.85%), Query Frame = 3
Query:  108 SKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNH-SPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQDDEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            SK + IKV+T D++LEF ++  TTG+ LF+ V  ++ + E ++FGL+  YIDS G   LT WLKL +++++Q +    PLK ++F +  K++PED+  ELIQ  T+ LFYL V     RQ +++   +             C                         P +  +LLAS + Q +Y D +++   + E+ ++    L + +     M    +++   ++   YKSHK M RED+ L YLK+A    ++G++YF I++K     + G+ A G++IY  DNK+     F W  I+NVSY ++KF+IK  ++D NS  ++
Sbjct:    2 SKTIAIKVSTIDSELEFSVASNTTGKQLFDQVVRTLNIREIWWFGLK--YIDSKG---LTSWLKLNRKVTSQDVGKIYPLK-LQFCV--KYYPEDVGVELIQEATQRLFYLQV-----RQDILSGDIY-------------C-------------------------PPETCVLLASYACQCKYLDFNDSLVANKEEFIYKDRLLPQKIVDQHGM---TNEQWIDKIVMMYKSHKDMLREDSMLEYLKIAQDLDMYGVNYFEITNKKGTELYLGIDALGLNIYNKDNKLTAKIGFPWSEIRNVSYSNKKFSIK--STDKNSSNFV 270          
BLAST of Merlin:moesin:ezrin:radixin vs. Planmine SMEST
Match: SMESG000068090.1 (SMESG000068090.1)

HSP 1 Score: 141.354 bits (355), Expect = 6.773e-35
Identity = 94/326 (28.83%), Postives = 160/326 (49.08%), Query Frame = 3
Query:  111 KALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETYYFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFPEDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCTLQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQD---DEDRMFXXXXXXXXXXXXXXMQCQLSQEVTRRVKQCYKSHKGMSREDAELAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQSFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYL 1079
            K +++ V T D +L+F +     G++LF+ +  +IGL ET+YFGL   YID  G +    WL LEK++S   +N     E++F    KF+PED+  ELIQ +T   FYL V+ +++   +             C                               P + A+LLAS + Q ++GD   +  +     ++R+  P  L +   S        +Q+   ++ + Y  ++GM R +A L YLK+A    ++G+ YF I +K     + G+ A G++IY+  +K+ P   F W  I+N+S+KD++F IK  + D  +P ++
Sbjct:    3 KNINVNVTTVDAELQFSIQSNAIGKTLFDQIIKTIGLRETWYFGL--LYIDVKGNL---CWLNLEKKVSH--INVLSKTEMEFQFRIKFYPEDVSEELIQEITIKFFYLQVRESILGSDIF------------C-------------------------------PPEPALLLASYACQVKFGDYDPSVQKPGFLSDERILPPRILNQHKWS--------NQQWESKIVKWYSEYRGMLRVEAMLEYLKIAQDLEMYGVSYFEIKNKKGSQLYIGIDALGLNIYKFKDKLTPQVGFPWGEIRNISFKDKRFVIK--SIDKKAPDFV 268          
The following BLAST results are available for this feature:
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RDX1.671e-4532.01radixin [Source:HGNC Symbol;Acc:HGNC:9944][more]
RDX1.698e-4532.01radixin [Source:HGNC Symbol;Acc:HGNC:9944][more]
RDX1.730e-4532.01radixin [Source:HGNC Symbol;Acc:HGNC:9944][more]
RDX2.258e-4532.01radixin [Source:HGNC Symbol;Acc:HGNC:9944][more]
RDX2.258e-4532.01radixin [Source:HGNC Symbol;Acc:HGNC:9944][more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erm-14.690e-4132.06ERM-1B; Ezrin/Radixin/Moesin [Source:UniProtKB/Tr... [more]
erm-16.286e-4031.63ERM-1B; Ezrin/Radixin/Moesin [Source:UniProtKB/Tr... [more]
nfm-11.437e-3632.28NeuroFibroMatosis homolog [Source:UniProtKB/TrEMB... [more]
nfm-11.662e-3632.28NeuroFibroMatosis homolog [Source:UniProtKB/TrEMB... [more]
nfm-12.491e-3632.28NeuroFibroMatosis homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mer9.309e-4431.29gene:FBgn0086384 transcript:FBtr0074754[more]
Mer9.309e-4431.29gene:FBgn0086384 transcript:FBtr0345992[more]
Moe2.805e-4231.71gene:FBgn0011661 transcript:FBtr0071277[more]
Moe2.805e-4231.71gene:FBgn0011661 transcript:FBtr0071276[more]
Moe2.805e-4231.71gene:FBgn0011661 transcript:FBtr0071269[more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ezrb1.050e-4534.77ezrin b [Source:ZFIN;Acc:ZDB-GENE-050803-1][more]
ezrb1.050e-4534.77ezrin b [Source:ZFIN;Acc:ZDB-GENE-050803-1][more]
msnb1.014e-4233.53moesin b [Source:ZFIN;Acc:ZDB-GENE-030717-7][more]
msnb1.291e-4233.33moesin b [Source:ZFIN;Acc:ZDB-GENE-030717-7][more]
nf2a1.664e-4231.00neurofibromin 2a (merlin) [Source:NCBI gene;Acc:56... [more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RDX2.521e-4531.91radixin [Source:NCBI gene;Acc:447978][more]
RDX2.577e-4531.91radixin [Source:NCBI gene;Acc:447978][more]
RDX2.835e-4532.01radixin [Source:NCBI gene;Acc:447978][more]
RDX3.079e-4532.01radixin [Source:NCBI gene;Acc:447978][more]
RDX1.064e-4432.48radixin [Source:NCBI gene;Acc:447978][more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rdx3.054e-4632.01radixin [Source:MGI Symbol;Acc:MGI:97887][more]
Rdx1.281e-4532.01radixin [Source:MGI Symbol;Acc:MGI:97887][more]
Rdx1.281e-4532.01radixin [Source:MGI Symbol;Acc:MGI:97887][more]
Rdx1.493e-4532.01radixin [Source:MGI Symbol;Acc:MGI:97887][more]
Ezr2.044e-4230.79ezrin [Source:MGI Symbol;Acc:MGI:98931][more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q32LP2|RADI_BOVIN7.356e-4532.01Radixin OS=Bos taurus OX=9913 GN=RDX PE=2 SV=1[more]
sp|P26043|RADI_MOUSE7.782e-4532.01Radixin OS=Mus musculus OX=10090 GN=Rdx PE=1 SV=3[more]
sp|P35241|RADI_HUMAN8.310e-4532.01Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1[more]
sp|P26044|RADI_PIG1.165e-4432.01Radixin OS=Sus scrofa OX=9823 GN=RDX PE=2 SV=1[more]
sp|Q9PU45|RADI_CHICK3.029e-4432.92Radixin OS=Gallus gallus OX=9031 GN=RDX PE=2 SV=1[more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4EXI73.229e-7034.38Putative merlin/moesin/ezrin/radixin OS=Schistosom... [more]
A0A5J4NWW14.118e-7044.61FERM domain-containing protein OS=Paragonimus west... [more]
A0A5K4EWI25.958e-7034.38Putative merlin/moesin/ezrin/radixin OS=Schistosom... [more]
A0A4S2M2Q73.056e-6843.55FERM domain-containing protein OS=Opisthorchis fel... [more]
A0A504YRN65.826e-6837.83Radixin OS=Fasciola gigantica OX=46835 GN=FGIG_035... [more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000054018.12.042e-4532.62radixin [Source:NCBI gene;Acc:103042331][more]
ENSAMXT00000053554.12.150e-4532.62radixin [Source:NCBI gene;Acc:103042331][more]
msna3.592e-4232.59moesin [Source:NCBI gene;Acc:103037010][more]
msna3.592e-4232.59moesin [Source:NCBI gene;Acc:103037010][more]
nf2a4.511e-4230.91neurofibromin 2 [Source:NCBI gene;Acc:103036819][more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008042.11.293e-3830.75pep scaffold:Pmarinus_7.0:GL501310:70164:110449:1 ... [more]
nf2b8.491e-3632.44neurofibromin 2b (merlin) [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000001312.13.820e-1425.41pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
ENSPMAT00000006866.11.236e-1231.46pep scaffold:Pmarinus_7.0:GL479164:324:35742:-1 ge... [more]
si:ch211-220f12.14.265e-1026.97FERM domain containing 4A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441192.322e-3931.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316087.447e-3927.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389654.408e-1924.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302243.361e-1726.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361306.781e-1123.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015174.25.219e-4633.03ezrin [Source:NCBI gene;Acc:101155563][more]
ENSORLT00000011512.22.400e-4532.62radixin [Source:NCBI gene;Acc:101156778][more]
ENSORLT00000040831.12.445e-4532.62radixin [Source:NCBI gene;Acc:101156778][more]
ENSORLT00000006905.21.086e-4331.19radixin [Source:NCBI gene;Acc:101156069][more]
ENSORLT00000028018.11.086e-4331.19radixin [Source:NCBI gene;Acc:101156069][more]
back to top
BLAST of Merlin:moesin:ezrin:radixin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016264.10.000e+099.61SMESG000016264.1[more]
SMESG000016264.10.000e+099.61SMESG000016264.1[more]
SMESG000070273.15.432e-4435.19SMESG000070273.1[more]
SMESG000056380.15.574e-4132.31SMESG000056380.1[more]
SMESG000068090.16.773e-3528.83SMESG000068090.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004242 ID=SMED30004242|Name=Merlin:moesin:ezrin:radixin|organism=Schmidtea mediterranea sexual|type=transcript|length=2716bp
ATTGCAATTAGATATATTTGGTTTTTTAAATTATACTTATTATTAGATCG
AATTTGGTTTTCAATGATCTTTTTATTGGTTTGATGAAGTGGGTTAGTAA
ATCCAATTCGAAGGCGTTACATATTAAAGTTAATACATACGATAATGACT
TAGAATTTCACTTATCGCACAAGACTACTGGTGAGTCTTTATTTGAAATG
GTTTGTGCCAGCATTGGACTTCATGAAACGTACTATTTTGGATTGGAAAA
TTATTACATCGACAGCAATGGCCAGATAGAATTAACAAAATGGCTTAAAT
TGGAAAAACGAATATCGGCGCAAAAGCTCAATCATTCACCATTGAAAGAG
ATAAAGTTTCTGCTTCATCCCAAGTTTTTCCCTGAGGATATTGAGCGGGA
ATTAATCCAACCTATGACGAGACATTTGTTTTATCTCGACGTGAAAAATG
CATTGATTCGTCAGTCGGTTGTCAACAACAGTAACCATTTCTCTGCAACC
ACATCGGAGTGCACAAATAAGGCCGATTGCACCCTGCAGAACGGTGACAA
ATCGTCTGATGGTCAACTCGATATCGATGATGGCTCCTCGTCTCGGTCGA
ATCCTCCGTCTGATGTCGCGATCCTTTTGGCATCTCTCAGTGCTCAGGCG
GAATACGGAGATCTCAGTGAAACTGAGTGTCAAGATGATGAAGATCGAAT
GTTTCTTCCAGGCAGGCTATTGCGACTCCTTCCAAGCGGATTGCTAATGC
AATGTCAGCTGAGCCAGGAAGTCACTCGTCGTGTGAAACAGTGTTACAAA
AGTCATAAAGGAATGAGCAGAGAGGATGCTGAATTGGCGTATCTTAAAGT
AGCACATCTTTATCGATTATTTGGAATCGATTATTTTATGATTTCGGATA
AAATGAATTGTGCTAGCTGGTTTGGAGTTTCCGCTTCAGGAATATCGATT
TATCAACTGGACAACAAAATCCAGCCTCTCCAATCGTTCTCTTGGAAAAT
CATCAAAAACGTATCATATAAAGACAGAAAATTCACCATCAAGCTGACGA
CCAGTGATCTCAATTCACCAACATATCTGCCTAGCCAAGCTAGCACTCCT
AGAATTACAACGCCAGGTGGAGCTGACCCGTCCCTGATTAGCAGTGCCTC
CATGTCAACCCATCTGTCAGTGCCGGGGCTCCCGATAAATCTGCTGAAGG
ACCAACTGTCATTACCGAATGATTCTGCCACAACAAATCTTTCAATCGAC
ACTACAAAAACCGTCTCCTTGGAAACCGGTCCTCAGAATTGCACCAACGC
CTCTCTCATGCTGCCCACAATAAAAATGGATTCCTGCACTCCTGGTCCGA
ATCTGGCCAAGCTCGAGGTGTGGCTCCACACAATCCAGGAGGCAAAGCTG
GTTATGAGATTGAGCAAGGGCAACTCGGAATTGTTCATGAAGCGTCGGCA
GCCCGAGTCCTGTCAGATGCAACAGATGCGAATTCAAGCCCGGGCAGAGC
GGGCACGTCGCGATGTTGAGCAGGCCCATCTGTGCCGAGCCAGAGCAGAG
AAGCAGGCAGCCCTTGAAGCCAAAGCTGTGCTGGAGGAAAAGGTTGCAGA
GCTTGAGGCTGCGCTTGAATCGTGCAAAACCGCGGGCCAATTGATGGCCG
AGAAAGCTCGATATGCCAAGGAAGAAGCGAAGCTCCATGAAGAACAAGTG
CACGAGCTCACTCGGTGCCTCGATCGAAGTCTAGGGCTCCCGGAGCAGCT
GTTGTATTGGGGTGCCTCTGGTGCCGGTGGTGAGTGTAGCCAGTCCCGCA
TCAGCTTGGCGCATCCCGGCAACAGCTTGCCTTCACTGCGTTGCCATACC
GTGGATACCCGATTGGCGATGCCTGGAACTGATCCGTTGGCACGCAGGAA
ATTATCTCCGCAAGCACTCGTCAAAAATTCTCTTGTATCAGATACGATTT
CAGTGCGCCATTTGGAGGCGGAATTGCAGAAGGAGAAGGCGAGATTCAGC
GTGCTACAAACACAATTCCTTTCGGAATTATGCGAGGCGTATTCGCACCT
GGAAATGGTGCACGGTACAAAATTGTACAACCGCAACAACAAATTCTATC
CGTTTCTAAACAGTCCATGGCAGCCCGGACTCGATTCCTGGGACCAGAAG
AAAGAATTCGGTCCGAATTATCGGGAAATTGTCGGTTGGAATGATCAAGG
TTTGTGCTTTCCTCAGGAGCTATTGGAATTGGATAACCAAGAGAAATTGA
TCGAGCACCATTATTCTGTACCGATCACTAATATCGATCCGACGGTTTCT
GCGCCTCACACTTGGACCAGTGAGACCCCGATGATGAGGAAACGTATTAT
TGATCCGTTACCCCATTATTATGAGATGGGCGGTTATATCGTCAACACAA
CCAGGTAATTGTAGCCGTGGCAACCGTTGTGATCATTTGTAACCATGGCC
CTGATCTATTGCTTGATCTCAGATTTGAAATAAATATATTTCTTTTTGTG
TGTTTGCGAATGTTCTTATTGATCTTATGTGCAATTGGCATAGATTTATG
TGCGCGTGTATGTATGCTATCAATATCAATAATAATATCCTTATTTTCAT
TTTCCACGAGATTACGCTATTGTATTGCTGTGCAACGCCGTGATATGTGA
GAATGATTATAACAATCGATAAATATACTGCTATTATTTCATTTTATAAA
TAAATTTATTGATTCG
back to top

protein sequence of SMED30004242-orf-1

>SMED30004242-orf-1 ID=SMED30004242-orf-1|Name=SMED30004242-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=775bp
MKWVSKSNSKALHIKVNTYDNDLEFHLSHKTTGESLFEMVCASIGLHETY
YFGLENYYIDSNGQIELTKWLKLEKRISAQKLNHSPLKEIKFLLHPKFFP
EDIERELIQPMTRHLFYLDVKNALIRQSVVNNSNHFSATTSECTNKADCT
LQNGDKSSDGQLDIDDGSSSRSNPPSDVAILLASLSAQAEYGDLSETECQ
DDEDRMFLPGRLLRLLPSGLLMQCQLSQEVTRRVKQCYKSHKGMSREDAE
LAYLKVAHLYRLFGIDYFMISDKMNCASWFGVSASGISIYQLDNKIQPLQ
SFSWKIIKNVSYKDRKFTIKLTTSDLNSPTYLPSQASTPRITTPGGADPS
LISSASMSTHLSVPGLPINLLKDQLSLPNDSATTNLSIDTTKTVSLETGP
QNCTNASLMLPTIKMDSCTPGPNLAKLEVWLHTIQEAKLVMRLSKGNSEL
FMKRRQPESCQMQQMRIQARAERARRDVEQAHLCRARAEKQAALEAKAVL
EEKVAELEAALESCKTAGQLMAEKARYAKEEAKLHEEQVHELTRCLDRSL
GLPEQLLYWGASGAGGECSQSRISLAHPGNSLPSLRCHTVDTRLAMPGTD
PLARRKLSPQALVKNSLVSDTISVRHLEAELQKEKARFSVLQTQFLSELC
EAYSHLEMVHGTKLYNRNNKFYPFLNSPWQPGLDSWDQKKEFGPNYREIV
GWNDQGLCFPQELLELDNQEKLIEHHYSVPITNIDPTVSAPHTWTSETPM
MRKRIIDPLPHYYEMGGYIVNTTR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000136whole organism
Vocabulary: INTERPRO
TermDefinition
IPR035963FERM_2
IPR018980FERM_PH-like_C
IPR019749Band_41_domain
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR019748FERM_central
IPR011993PH-like_dom_sf
IPR018979FERM_N
IPR000299FERM_domain
IPR029071Ubiquitin-like_domsf
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0008092cytoskeletal protein binding
Vocabulary: biological process
TermDefinition
GO:0008285negative regulation of cell proliferation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 624..644
NoneNo IPR availableCOILSCoilCoilcoord: 471..517
NoneNo IPR availableGENE3DG3DSA:1.20.5.450coord: 452..506
e-value: 1.5E-6
score: 30.3
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 7..98
e-value: 1.2E-20
score: 75.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 154..174
NoneNo IPR availablePANTHERPTHR23281MERLIN/MOESIN/EZRIN/RADIXINcoord: 5..130
NoneNo IPR availablePANTHERPTHR23281MERLIN/MOESIN/EZRIN/RADIXINcoord: 175..543
NoneNo IPR availablePANTHERPTHR23281:SF39MOESIN/EZRIN/RADIXIN HOMOLOG 2coord: 5..130
NoneNo IPR availablePANTHERPTHR23281:SF39MOESIN/EZRIN/RADIXIN HOMOLOG 2coord: 175..543
NoneNo IPR availableCDDcd17186FERM_F1_Merlincoord: 10..101
e-value: 2.31266E-20
score: 83.9725
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 263..488
IPR018980FERM, C-terminal PH-like domainSMARTSM01196FERM_C_3coord: 272..459
e-value: 5.4E-10
score: 49.2
IPR018980FERM, C-terminal PH-like domainPFAMPF09380FERM_Ccoord: 272..339
e-value: 1.2E-13
score: 51.3
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 8..268
e-value: 2.6E-29
score: 113.4
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 23..81
e-value: 9.0E-9
score: 35.2
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 263..343
e-value: 8.8E-19
score: 69.4
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 175..268
e-value: 8.3E-11
score: 42.3
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 175..257
e-value: 7.15424E-10
score: 54.5598
IPR000299FERM domainPROSITEPS50057FERM_3coord: 12..356
score: 42.343
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 170..257
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 9..101