Protein kinase

Overview
NameProtein kinase
Smed IDSMED30004241
Length (bp)4557
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase (SMED30004241) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase (SMED30004241) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase (SMED30004241) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase (SMED30004241) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004241

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004241h1SMcG0001455 Contig3273GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004241h1SMcG0012766 Contig3273GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30004241h1SMcG0012766 dd_Smed_v4_4734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004241h1SMcG0012766 dd_Smed_v4_4734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004241h1SMcG0012766 dd_Smed_v4_4734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004241h1SMcG0012766 dd_Smed_v6_4734_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004241h1SMcG0012766 dd_Smed_v4_4734_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase vs. Ensembl Human
Match: WNK1 (WNK lysine deficient protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:14540])

HSP 1 Score: 229.565 bits (584), Expect = 1.006e-59
Identity = 136/369 (36.86%), Postives = 203/369 (55.01%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++                I L LR  D + L+     D E++EF  D+    ++D+P+
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE-TGVRVELAEEDDGEK--------------IAIKLWLRIEDIKKLKG-KYKDNEAIEFSFDL----ERDVPE 534          
BLAST of Protein kinase vs. Ensembl Human
Match: WNK1 (WNK lysine deficient protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:14540])

HSP 1 Score: 229.565 bits (584), Expect = 1.079e-59
Identity = 136/369 (36.86%), Postives = 203/369 (55.01%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++                I L LR  D + L+     D E++EF  D+    ++D+P+
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE-TGVRVELAEEDDGEK--------------IAIKLWLRIEDIKKLKG-KYKDNEAIEFSFDL----ERDVPE 534          
BLAST of Protein kinase vs. Ensembl Human
Match: WNK1 (WNK lysine deficient protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:14540])

HSP 1 Score: 229.565 bits (584), Expect = 1.081e-59
Identity = 136/369 (36.86%), Postives = 203/369 (55.01%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++                I L LR  D + L+     D E++EF  D+    ++D+P+
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE-TGVRVELAEEDDGEK--------------IAIKLWLRIEDIKKLKG-KYKDNEAIEFSFDL----ERDVPE 534          
BLAST of Protein kinase vs. Ensembl Human
Match: WNK1 (WNK lysine deficient protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:14540])

HSP 1 Score: 229.565 bits (584), Expect = 1.127e-59
Identity = 136/369 (36.86%), Postives = 203/369 (55.01%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++                I L LR  D + L+     D E++EF  D+    ++D+P+
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE-TGVRVELAEEDDGEK--------------IAIKLWLRIEDIKKLKG-KYKDNEAIEFSFDL----ERDVPE 534          
BLAST of Protein kinase vs. Ensembl Human
Match: WNK1 (WNK lysine deficient protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:14540])

HSP 1 Score: 227.254 bits (578), Expect = 3.808e-59
Identity = 140/375 (37.33%), Postives = 208/375 (55.47%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIP-DLIQNL 1688
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++       IA       I L LR  D + L+     D E++EF  D+    ++D+P D+ Q +
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ-EETGVRVELAEEDDGEK-------IA-------IKLWLRIEDIKKLKGK-YKDNEAIEFSFDL----ERDVPEDVAQEM 540          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 214.927 bits (546), Expect = 8.239e-56
Identity = 134/386 (34.72%), Postives = 214/386 (55.44%), Query Frame = 3
Query:  570 EAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKW--LREIINSCIHPLSCFRPTAEELFFHPIFQPK---GLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYK-AEDQDIPDLIQNLRLEYED 1706
            +A+ + I KSK GR++KF+ ++G G +K V+RG D E    VAWCE +   ++  E+++  FRE   MLK + H +IVR +D       +E        K IV++ ELM  GTLK  +K+ F      +   ++  W  QIL  L ++H + +PP+IHRDLK DN F+ G T     +VK+GD GLAT  + S  K+++GT  FMAPE+++E YDESVD+YAFGM +LE++T   P+ EC     +  K +SG  P+    +  ++  +REII+ CI      R T ++L     F P+   G+ VE++    +++D          N+    +I ++LR  D++  ++    + E L+F  DI   + D+ +  +I+   +  ED
Sbjct:  319 DAQEKPIDKSKNGRFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQESKLNKTERQR--FREEAEMLKDLQHPNIVRFYDY------WESADLCGKRKYIVLVTELMTSGTLKMYLKR-FKR----INIKVLKSWCRQILKGLSFLHTR-NPPVIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPEIREIIDRCIRVRREERSTVKQLLVDDFFTPEDLIGIRVEIKNRDADLND---------LNV----EIQMQLRVYDEKKRKQYRFKENEGLQFAFDIENDSPDEVVQQMIEQQHIPDED 673          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 214.927 bits (546), Expect = 8.239e-56
Identity = 134/386 (34.72%), Postives = 214/386 (55.44%), Query Frame = 3
Query:  570 EAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKW--LREIINSCIHPLSCFRPTAEELFFHPIFQPK---GLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYK-AEDQDIPDLIQNLRLEYED 1706
            +A+ + I KSK GR++KF+ ++G G +K V+RG D E    VAWCE +   ++  E+++  FRE   MLK + H +IVR +D       +E        K IV++ ELM  GTLK  +K+ F      +   ++  W  QIL  L ++H + +PP+IHRDLK DN F+ G T     +VK+GD GLAT  + S  K+++GT  FMAPE+++E YDESVD+YAFGM +LE++T   P+ EC     +  K +SG  P+    +  ++  +REII+ CI      R T ++L     F P+   G+ VE++    +++D          N+    +I ++LR  D++  ++    + E L+F  DI   + D+ +  +I+   +  ED
Sbjct:  319 DAQEKPIDKSKNGRFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQESKLNKTERQR--FREEAEMLKDLQHPNIVRFYDY------WESADLCGKRKYIVLVTELMTSGTLKMYLKR-FKR----INIKVLKSWCRQILKGLSFLHTR-NPPVIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPEIREIIDRCIRVRREERSTVKQLLVDDFFTPEDLIGIRVEIKNRDADLND---------LNV----EIQMQLRVYDEKKRKQYRFKENEGLQFAFDIENDSPDEVVQQMIEQQHIPDED 673          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 214.927 bits (546), Expect = 8.605e-56
Identity = 134/386 (34.72%), Postives = 214/386 (55.44%), Query Frame = 3
Query:  570 EAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKW--LREIINSCIHPLSCFRPTAEELFFHPIFQPK---GLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYK-AEDQDIPDLIQNLRLEYED 1706
            +A+ + I KSK GR++KF+ ++G G +K V+RG D E    VAWCE +   ++  E+++  FRE   MLK + H +IVR +D       +E        K IV++ ELM  GTLK  +K+ F      +   ++  W  QIL  L ++H + +PP+IHRDLK DN F+ G T     +VK+GD GLAT  + S  K+++GT  FMAPE+++E YDESVD+YAFGM +LE++T   P+ EC     +  K +SG  P+    +  ++  +REII+ CI      R T ++L     F P+   G+ VE++    +++D          N+    +I ++LR  D++  ++    + E L+F  DI   + D+ +  +I+   +  ED
Sbjct:  266 DAQEKPIDKSKNGRFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQESKLNKTERQR--FREEAEMLKDLQHPNIVRFYDY------WESADLCGKRKYIVLVTELMTSGTLKMYLKR-FKR----INIKVLKSWCRQILKGLSFLHTR-NPPVIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPEIREIIDRCIRVRREERSTVKQLLVDDFFTPEDLIGIRVEIKNRDADLND---------LNV----EIQMQLRVYDEKKRKQYRFKENEGLQFAFDIENDSPDEVVQQMIEQQHIPDED 620          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 214.927 bits (546), Expect = 8.841e-56
Identity = 134/386 (34.72%), Postives = 214/386 (55.44%), Query Frame = 3
Query:  570 EAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKW--LREIINSCIHPLSCFRPTAEELFFHPIFQPK---GLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYK-AEDQDIPDLIQNLRLEYED 1706
            +A+ + I KSK GR++KF+ ++G G +K V+RG D E    VAWCE +   ++  E+++  FRE   MLK + H +IVR +D       +E        K IV++ ELM  GTLK  +K+ F      +   ++  W  QIL  L ++H + +PP+IHRDLK DN F+ G T     +VK+GD GLAT  + S  K+++GT  FMAPE+++E YDESVD+YAFGM +LE++T   P+ EC     +  K +SG  P+    +  ++  +REII+ CI      R T ++L     F P+   G+ VE++    +++D          N+    +I ++LR  D++  ++    + E L+F  DI   + D+ +  +I+   +  ED
Sbjct:  319 DAQEKPIDKSKNGRFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQESKLNKTERQR--FREEAEMLKDLQHPNIVRFYDY------WESADLCGKRKYIVLVTELMTSGTLKMYLKR-FKR----INIKVLKSWCRQILKGLSFLHTR-NPPVIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPEIREIIDRCIRVRREERSTVKQLLVDDFFTPEDLIGIRVEIKNRDADLND---------LNV----EIQMQLRVYDEKKRKQYRFKENEGLQFAFDIENDSPDEVVQQMIEQQHIPDED 673          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 214.927 bits (546), Expect = 8.841e-56
Identity = 134/386 (34.72%), Postives = 214/386 (55.44%), Query Frame = 3
Query:  570 EAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKW--LREIINSCIHPLSCFRPTAEELFFHPIFQPK---GLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYK-AEDQDIPDLIQNLRLEYED 1706
            +A+ + I KSK GR++KF+ ++G G +K V+RG D E    VAWCE +   ++  E+++  FRE   MLK + H +IVR +D       +E        K IV++ ELM  GTLK  +K+ F      +   ++  W  QIL  L ++H + +PP+IHRDLK DN F+ G T     +VK+GD GLAT  + S  K+++GT  FMAPE+++E YDESVD+YAFGM +LE++T   P+ EC     +  K +SG  P+    +  ++  +REII+ CI      R T ++L     F P+   G+ VE++    +++D          N+    +I ++LR  D++  ++    + E L+F  DI   + D+ +  +I+   +  ED
Sbjct:  319 DAQEKPIDKSKNGRFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQESKLNKTERQR--FREEAEMLKDLQHPNIVRFYDY------WESADLCGKRKYIVLVTELMTSGTLKMYLKR-FKR----INIKVLKSWCRQILKGLSFLHTR-NPPVIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPEIREIIDRCIRVRREERSTVKQLLVDDFFTPEDLIGIRVEIKNRDADLND---------LNV----EIQMQLRVYDEKKRKQYRFKENEGLQFAFDIENDSPDEVVQQMIEQQHIPDED 673          
BLAST of Protein kinase vs. Ensembl Fly
Match: Wnk (gene:FBgn0037098 transcript:FBtr0346819)

HSP 1 Score: 213.001 bits (541), Expect = 4.953e-55
Identity = 136/364 (37.36%), Postives = 198/364 (54.40%), Query Frame = 3
Query:  588 IAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHC-ILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTE--VIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDI 1667
            +A S CGR+ K++ ++G G +K VYRG D      VAWCE   + V   E+  + FRE   MLK + H +IVR +     W        I  +K IV++ ELM  GTLK+ +K+ F + H  +LK      W  QIL  L ++H +  P IIHRDLK DN F+ G T     +VK+GD GLAT  + S  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+  +  P+ EC    Q+  K +SG  P  +  V D  +R+II  CI      RP+  EL             E E   ++I  R E    ++F+++ P+ + I  RLRF D +       ++ E+++F+ +I   E + I
Sbjct:  462 VAMSPCGRFFKYDKEVGRGSFKTVYRGLDTLTGVPVAWCELLDKQVKKSER--TRFREEADMLKKLQHPNIVRFYTY---WEF-----PIGRKKNIVLVTELMLSGTLKSYLKR-FKKIHPKVLK-----SWCRQILKGLNFLHTRQFP-IIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNRSHAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMAISEYPYSECKGPAQIYKKVISGIKPAALAKVEDPNVRDIIERCIELKKEDRPSCNELL------------ESEFFDEDIGIRVEPTASEQFLSD-PSISIIEFRLRFMDPKKRSSRHKEN-EAIQFEYNIRHDEYEQI 790          
BLAST of Protein kinase vs. Ensembl Fly
Match: Wnk (gene:FBgn0037098 transcript:FBtr0346817)

HSP 1 Score: 213.001 bits (541), Expect = 4.953e-55
Identity = 136/364 (37.36%), Postives = 198/364 (54.40%), Query Frame = 3
Query:  588 IAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHC-ILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTE--VIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDI 1667
            +A S CGR+ K++ ++G G +K VYRG D      VAWCE   + V   E+  + FRE   MLK + H +IVR +     W        I  +K IV++ ELM  GTLK+ +K+ F + H  +LK      W  QIL  L ++H +  P IIHRDLK DN F+ G T     +VK+GD GLAT  + S  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+  +  P+ EC    Q+  K +SG  P  +  V D  +R+II  CI      RP+  EL             E E   ++I  R E    ++F+++ P+ + I  RLRF D +       ++ E+++F+ +I   E + I
Sbjct:  462 VAMSPCGRFFKYDKEVGRGSFKTVYRGLDTLTGVPVAWCELLDKQVKKSER--TRFREEADMLKKLQHPNIVRFYTY---WEF-----PIGRKKNIVLVTELMLSGTLKSYLKR-FKKIHPKVLK-----SWCRQILKGLNFLHTRQFP-IIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNRSHAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMAISEYPYSECKGPAQIYKKVISGIKPAALAKVEDPNVRDIIERCIELKKEDRPSCNELL------------ESEFFDEDIGIRVEPTASEQFLSD-PSISIIEFRLRFMDPKKRSSRHKEN-EAIQFEYNIRHDEYEQI 790          
BLAST of Protein kinase vs. Ensembl Fly
Match: Wnk (gene:FBgn0037098 transcript:FBtr0347540)

HSP 1 Score: 212.616 bits (540), Expect = 5.825e-55
Identity = 136/364 (37.36%), Postives = 198/364 (54.40%), Query Frame = 3
Query:  588 IAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHC-ILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTE--VIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDI 1667
            +A S CGR+ K++ ++G G +K VYRG D      VAWCE   + V   E+  + FRE   MLK + H +IVR +     W        I  +K IV++ ELM  GTLK+ +K+ F + H  +LK      W  QIL  L ++H +  P IIHRDLK DN F+ G T     +VK+GD GLAT  + S  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+  +  P+ EC    Q+  K +SG  P  +  V D  +R+II  CI      RP+  EL             E E   ++I  R E    ++F+++ P+ + I  RLRF D +       ++ E+++F+ +I   E + I
Sbjct:  264 VAMSPCGRFFKYDKEVGRGSFKTVYRGLDTLTGVPVAWCELLDKQVKKSER--TRFREEADMLKKLQHPNIVRFYTY---WEF-----PIGRKKNIVLVTELMLSGTLKSYLKR-FKKIHPKVLK-----SWCRQILKGLNFLHTRQFP-IIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNRSHAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMAISEYPYSECKGPAQIYKKVISGIKPAALAKVEDPNVRDIIERCIELKKEDRPSCNELL------------ESEFFDEDIGIRVEPTASEQFLSD-PSISIIEFRLRFMDPKKRSSRHKEN-EAIQFEYNIRHDEYEQI 592          
BLAST of Protein kinase vs. Ensembl Fly
Match: Wnk (gene:FBgn0037098 transcript:FBtr0346818)

HSP 1 Score: 213.001 bits (541), Expect = 6.003e-55
Identity = 136/364 (37.36%), Postives = 198/364 (54.40%), Query Frame = 3
Query:  588 IAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHC-ILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTE--VIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDI 1667
            +A S CGR+ K++ ++G G +K VYRG D      VAWCE   + V   E+  + FRE   MLK + H +IVR +     W        I  +K IV++ ELM  GTLK+ +K+ F + H  +LK      W  QIL  L ++H +  P IIHRDLK DN F+ G T     +VK+GD GLAT  + S  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+  +  P+ EC    Q+  K +SG  P  +  V D  +R+II  CI      RP+  EL             E E   ++I  R E    ++F+++ P+ + I  RLRF D +       ++ E+++F+ +I   E + I
Sbjct:  462 VAMSPCGRFFKYDKEVGRGSFKTVYRGLDTLTGVPVAWCELLDKQVKKSER--TRFREEADMLKKLQHPNIVRFYTY---WEF-----PIGRKKNIVLVTELMLSGTLKSYLKR-FKKIHPKVLK-----SWCRQILKGLNFLHTRQFP-IIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNRSHAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMAISEYPYSECKGPAQIYKKVISGIKPAALAKVEDPNVRDIIERCIELKKEDRPSCNELL------------ESEFFDEDIGIRVEPTASEQFLSD-PSISIIEFRLRFMDPKKRSSRHKEN-EAIQFEYNIRHDEYEQI 790          
BLAST of Protein kinase vs. Ensembl Fly
Match: Madm (gene:FBgn0027497 transcript:FBtr0347493)

HSP 1 Score: 100.138 bits (248), Expect = 5.677e-21
Identity = 83/301 (27.57%), Postives = 138/301 (45.85%), Query Frame = 3
Query:  588 IAKSKCGRWVKFNIKIGE---GGYKFVYRGYDVEEAKNVAWCEFKREHV-DTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLIT--RWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLG-------FMAPEI-FDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIF 1448
            + +S CGRW+K   ++ +    G   V+   D EE   V W E +   + + K + + M +  + +L+++H +IV+       +H Y       +   +V I E M  G+LK  +K+         + PL +  RW  QIL AL Y+H  C PPIIH +L  D+ F+          VK+G   +   VH S R+              F APE    ++   ++DIYAFGM  LE+          ++   +  +T+     + I  + +   R++I  C++P    RP+A +L FHP+ 
Sbjct:   97 LEESPCGRWLKRREEVDQRDVPGIDCVHLAMDTEEGVEVVWNEVQYASLQELKSQEEKMRQVFDNLLQLDHQNIVK-------FHRYWTDTQQAERPRVVFITEYMSSGSLKQFLKRTKRNAK---RLPLESWRRWCTQILSALSYLH-SCSPPIIHGNLTCDSIFIQHNG-----LVKIGSV-VPDAVHYSVRRGRERERERERGAHYFQAPEYGAADQLTAALDIYAFGMCALEMAALEIQPSNSESTA-INEETIQ----RTIFSLENDLQRDLIRKCLNPQPQDRPSANDLLFHPLL 375          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: si:dkey-151g10.3 (si:dkey-151g10.3 [Source:ZFIN;Acc:ZDB-GENE-090312-81])

HSP 1 Score: 219.55 bits (558), Expect = 6.149e-61
Identity = 122/305 (40.00%), Postives = 181/305 (59.34%), Query Frame = 3
Query:  564 EQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIF-QPKGLPVEV 1475
            E+EA+ +A+A S  GR++KF+I++G G +K VY+G D E    VAWCE +   + TK ++Q    E E++  + H +IVR +D    W        +  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPI+HRDLK DN F+ G T     +VK+GD GLAT + TS  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+ T+  P+ EC    Q+  K  SG  P   + V D  ++EII  CI      R + ++L  H  F +  G+ VE+
Sbjct:   86 EEEAEMKAVATSPGGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDRKL-TKAEQQRFKEEAEMLKGLQHPNIVRFYD---SWE-----SVLRGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIVHRDLKCDNIFITGPTG----SVKIGDLGLATLMRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFDKVNDPEVKEIIEGCIRQNRLERLSVKDLLNHAFFAEDTGVRVEL 371          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: CU041388.2 (pep chromosome:GRCz11:CHR_ALT_CTG23_1_26:25152826:25180312:1 gene:ENSDARG00000115009.1 transcript:ENSDART00000191552.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU041388.2)

HSP 1 Score: 221.09 bits (562), Expect = 9.029e-61
Identity = 122/305 (40.00%), Postives = 181/305 (59.34%), Query Frame = 3
Query:  564 EQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIF-QPKGLPVEV 1475
            E+EA+ +A+A S  GR++KF+I++G G +K VY+G D E    VAWCE +   + TK ++Q    E E++  + H +IVR +D    W        +  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPI+HRDLK DN F+ G T     +VK+GD GLAT + TS  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+ T+  P+ EC    Q+  K  SG  P   + V D  ++EII  CI      R + ++L  H  F +  G+ VE+
Sbjct:  123 EEEAEMKAVATSPGGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDRKL-TKAEQQRFKEEAEMLKGLQHPNIVRFYD---SWE-----SVLRGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIVHRDLKCDNIFITGPTG----SVKIGDLGLATLMRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFDKVNDPEVKEIIEGCIRQNRLERLSVKDLLNHAFFAEDTGVRVEL 408          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: si:dkey-151g10.3 (si:dkey-151g10.3 [Source:ZFIN;Acc:ZDB-GENE-090312-81])

HSP 1 Score: 221.476 bits (563), Expect = 1.339e-60
Identity = 147/433 (33.95%), Postives = 228/433 (52.66%), Query Frame = 3
Query:  564 EQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLV 1862
            E+EA+ +A+A S  GR++KF+I++G G +K VY+G D E    VAWCE +   + TK ++Q    E E++  + H +IVR +D    W        +  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPI+HRDLK DN F+ G T     +VK+GD GLAT + TS  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+ T+  P+ EC    Q+  K  SG  P   + V D  ++EII  CI      R + ++L  H  F  +   V VEL  ++   +  +  R     P       +L+ + K         D E++EF  D+         D  + + LE          + K++ KS      D++ L  K + + L++HL  RR   +L + +
Sbjct:  123 EEEAEMKAVATSPGGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDRKL-TKAEQQRFKEEAEMLKGLQHPNIVRFYD---SWE-----SVLRGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIVHRDLKCDNIFITGPTG----SVKIGDLGLATLMRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFDKVNDPEVKEIIEGCIRQNRLERLSVKDLLNHAFFA-EDTGVRVELAEEDTGCKDCLALRIWVEEPK------KLKGKHK---------DNEAIEFSYDLEN-------DSAEEVALEMVKSGFFHESDAKVVGKSI----RDRVTLIKKSRERRLLQHLDERRDSSVLTTSI 509          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: wnk1b (WNK lysine deficient protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2656])

HSP 1 Score: 226.483 bits (576), Expect = 4.816e-59
Identity = 140/370 (37.84%), Postives = 203/370 (54.86%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   +   E+++  F+E   MLK + H +IVR +D       +E P      K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT   +S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R   ++L  H  FQ +   V VEL  +   D  E+I            I L LR  D + L+     D E++EF  D+++    D+PD
Sbjct:  198 EEVETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSRSERQR--FKEEAGMLKGLQHPNIVRFYDS------WESPSK--GRKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLHFLHTRA-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRSSFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNPAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYAIKDLLNHAFFQEE-TGVRVELAEE---DDGEMI-----------AIKLWLRIEDVKKLKG-KYKDNEAIEFSFDLHR----DVPD 527          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: BX321885.1 (WNK lysine deficient protein kinase 1b [Source:NCBI gene;Acc:561159])

HSP 1 Score: 226.483 bits (576), Expect = 4.856e-59
Identity = 140/370 (37.84%), Postives = 203/370 (54.86%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   +   E+++  F+E   MLK + H +IVR +D       +E P      K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT   +S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R   ++L  H  FQ +   V VEL  +   D  E+I            I L LR  D + L+     D E++EF  D+++    D+PD
Sbjct:  198 EEVETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSRSERQR--FKEEAGMLKGLQHPNIVRFYDS------WESPSK--GRKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLHFLHTRA-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRSSFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNPAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYAIKDLLNHAFFQEE-TGVRVELAEE---DDGEMI-----------AIKLWLRIEDVKKLKG-KYKDNEAIEFSFDLHR----DVPD 527          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: WNK3 (WNK lysine deficient protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:14543])

HSP 1 Score: 227.254 bits (578), Expect = 2.980e-59
Identity = 137/367 (37.33%), Postives = 204/367 (55.59%), Query Frame = 3
Query:  582 RAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIF-QPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLI 1679
            +A+A S  GR++KF+I++G G +K V++G D E    VAWCE +   + TK ++Q    E E++  + H +IVR +D    W       ++  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT + TS  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+ T+  P+ EC    Q+  K  SG  P     V D  ++EII SCI      R + +EL  H  F +  GL VE+    D+ +D               + + LRL   D + L+    D+ E++EF  ++    D D PD +
Sbjct:  133 KAVATSPSGRFLKFDIELGRGAFKTVFKGLDTETWVEVAWCELQDRKL-TKAEQQRFKEEAEMLKGLQHPNIVRFYD---SWE-----SSLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLMRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVSDPEVKEIIESCIRQNKAERLSIKELLNHAFFAEDTGLRVEL-AEEDHCTD---------------SSLALRLWVEDPKKLKGKHKDN-EAIEFSFNL----DTDNPDEV 459          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: WNK3 (WNK lysine deficient protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:14543])

HSP 1 Score: 226.868 bits (577), Expect = 3.590e-59
Identity = 137/367 (37.33%), Postives = 204/367 (55.59%), Query Frame = 3
Query:  582 RAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIF-QPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLI 1679
            +A+A S  GR++KF+I++G G +K V++G D E    VAWCE +   + TK ++Q    E E++  + H +IVR +D    W       ++  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT + TS  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+ T+  P+ EC    Q+  K  SG  P     V D  ++EII SCI      R + +EL  H  F +  GL VE+    D+ +D               + + LRL   D + L+    D+ E++EF  ++    D D PD +
Sbjct:  133 KAVATSPSGRFLKFDIELGRGAFKTVFKGLDTETWVEVAWCELQDRKL-TKAEQQRFKEEAEMLKGLQHPNIVRFYD---SWE-----SSLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLMRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVSDPEVKEIIESCIRQNKAERLSIKELLNHAFFAEDTGLRVEL-AEEDHCTD---------------SSLALRLWVEDPKKLKGKHKDN-EAIEFSFNL----DTDNPDEV 459          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: WNK1 (LIM domain transcription factor LMO4.1 [Source:UniProtKB/Swiss-Prot;Acc:Q5FVB2])

HSP 1 Score: 203.756 bits (517), Expect = 6.234e-52
Identity = 130/364 (35.71%), Postives = 194/364 (53.30%), Query Frame = 3
Query:  585 AIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   +   E+++  F+E   MLK + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  S          +  +L++++N                  H  FQ +   V VEL  ++  ++       IA       I L LR  D + L+     D E++EF  D+    ++D+PD
Sbjct:  174 AVGFSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SWE-----STLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKLKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTS----------VSAYLQDLLN------------------HAFFQ-EETGVRVELAEEDDGEK-------IA-------IKLWLRIEDIKKLKGK-YKDNEAIEFSFDL----ERDVPD 469          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: gna13 (guanine nucleotide binding protein (G protein), alpha 13 [Source:Xenbase;Acc:XB-GENE-6257775])

HSP 1 Score: 172.17 bits (435), Expect = 1.098e-45
Identity = 112/311 (36.01%), Postives = 163/311 (52.41%), Query Frame = 3
Query:  735 EKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDI 1667
            +KRQ    E E++  + H +IVR +D    W        +  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+ T+  P+ EC    Q+  K  SG  P   + V D  ++EII  CI      R   ++L  H  F  +   V VEL  ++   ++               I LRL   D + L+    D+G ++EF  D+ K   +D+
Sbjct:   28 KKRQRFKEEAEMLKGLQHPNIVRFYDF---WE-----SCLKGKKYIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLMFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGVKPASFDKVADPEIKEIIGECICKNKEERYGIKDLLSHAFFA-EDTGVRVELAEEDNGRKSS--------------IALRLWVEDPKKLKVKPKDNG-AIEFTFDLEKETPEDV 304          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: gna13 (guanine nucleotide binding protein (G protein), alpha 13 [Source:Xenbase;Acc:XB-GENE-6257775])

HSP 1 Score: 173.711 bits (439), Expect = 8.239e-43
Identity = 112/310 (36.13%), Postives = 162/310 (52.26%), Query Frame = 3
Query:  738 KRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDI 1667
            KRQ    E E++  + H +IVR +D    W        +  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+ T+  P+ EC    Q+  K  SG  P   + V D  ++EII  CI      R   ++L  H  F  +   V VEL  ++   +              + I LRL   D + L+    D+G ++EF  D+ K   +D+
Sbjct:   11 KRQRFKEEAEMLKGLQHPNIVRFYDF---WE-----SCLKGKKYIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLMFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGVKPASFDKVADPEIKEIIGECICKNKEERYGIKDLLSHAFFA-EDTGVRVELAEEDNGRK--------------SSIALRLWVEDPKKLKVKPKDNG-AIEFTFDLEKETPEDV 286          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Wnk3 (WNK lysine deficient protein kinase 3 [Source:MGI Symbol;Acc:MGI:2652875])

HSP 1 Score: 220.32 bits (560), Expect = 3.418e-60
Identity = 134/365 (36.71%), Postives = 201/365 (55.07%), Query Frame = 3
Query:  588 IAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIF-QPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLI 1679
            +A S  GR++KF+I++G G +K VY+G D E    VAWCE +   + TK ++Q    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT + TS  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+ T+  P+ EC    Q+  K  SG  P     V D  ++EII  CI      R + ++L  H  F +  GL VE+    D+ S+               + + LRL   D + L+    D+ E++EF  ++    + D P+ +
Sbjct:  137 VATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDRKL-TKAEQQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLMRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIKDLLNHAFFAEDTGLRVEL-AEEDDCSN---------------SSLALRLWVEDPKKLKGKHKDN-EAIEFSFNL----EADTPEEV 461          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Wnk1 (WNK lysine deficient protein kinase 1 [Source:MGI Symbol;Acc:MGI:2442092])

HSP 1 Score: 229.565 bits (584), Expect = 6.896e-60
Identity = 136/369 (36.86%), Postives = 203/369 (55.01%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++                I L LR  D + L+     D E++EF  D+    ++D+P+
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE-TGVRVELAEEDDGEK--------------IAIKLWLRIEDIKKLKG-KYKDNEAIEFSFDL----ERDVPE 534          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Wnk1 (WNK lysine deficient protein kinase 1 [Source:MGI Symbol;Acc:MGI:2442092])

HSP 1 Score: 229.565 bits (584), Expect = 7.392e-60
Identity = 136/369 (36.86%), Postives = 203/369 (55.01%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++                I L LR  D + L+     D E++EF  D+    ++D+P+
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE-TGVRVELAEEDDGEK--------------IAIKLWLRIEDIKKLKG-KYKDNEAIEFSFDL----ERDVPE 534          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Wnk1 (WNK lysine deficient protein kinase 1 [Source:MGI Symbol;Acc:MGI:2442092])

HSP 1 Score: 229.565 bits (584), Expect = 7.408e-60
Identity = 136/369 (36.86%), Postives = 203/369 (55.01%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++                I L LR  D + L+     D E++EF  D+    ++D+P+
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE-TGVRVELAEEDDGEK--------------IAIKLWLRIEDIKKLKG-KYKDNEAIEFSFDL----ERDVPE 534          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Wnk1 (WNK lysine deficient protein kinase 1 [Source:MGI Symbol;Acc:MGI:2442092])

HSP 1 Score: 226.483 bits (576), Expect = 4.775e-59
Identity = 140/375 (37.33%), Postives = 208/375 (55.47%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIP-DLIQNL 1688
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++       IA       I L LR  D + L+     D E++EF  D+    ++D+P D+ Q +
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ-EETGVRVELAEEDDGEK-------IA-------IKLWLRIEDIKKLKGK-YKDNEAIEFSFDL----ERDVPEDVAQEM 540          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q6R2V0|WNK1_PIG (Serine/threonine-protein kinase WNK1 OS=Sus scrofa OX=9823 GN=WNK1 PE=2 SV=3)

HSP 1 Score: 229.565 bits (584), Expect = 4.822e-59
Identity = 136/369 (36.86%), Postives = 203/369 (55.01%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++                I L LR  D + L+     D E++EF  D+    ++D+P+
Sbjct:  203 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE-TGVRVELAEEDDGEK--------------IAIKLWLRIEDIKKLKG-KYKDNEAIEFSFDL----ERDVPE 532          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P83741|WNK1_MOUSE (Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 4.823e-59
Identity = 136/369 (36.86%), Postives = 203/369 (55.01%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++                I L LR  D + L+     D E++EF  D+    ++D+P+
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE-TGVRVELAEEDDGEK--------------IAIKLWLRIEDIKKLKG-KYKDNEAIEFSFDL----ERDVPE 534          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q9H4A3|WNK1_HUMAN (Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 4.831e-59
Identity = 136/369 (36.86%), Postives = 203/369 (55.01%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++                I L LR  D + L+     D E++EF  D+    ++D+P+
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE-TGVRVELAEEDDGEK--------------IAIKLWLRIEDIKKLKG-KYKDNEAIEFSFDL----ERDVPE 534          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q9JIH7|WNK1_RAT (Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 2.607e-58
Identity = 140/375 (37.33%), Postives = 208/375 (55.47%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIP-DLIQNL 1688
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  ++  ++       IA       I L LR  D + L+     D E++EF  D+    ++D+P D+ Q +
Sbjct:  205 EELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL-TKSERQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ-EETGVRVELAEEDDGEK-------IA-------IKLWLRIEDIKKLKGK-YKDNEAIEFSFDL----ERDVPEDVAQEM 540          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q80XP9|WNK3_MOUSE (Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3)

HSP 1 Score: 222.246 bits (565), Expect = 5.591e-57
Identity = 134/365 (36.71%), Postives = 201/365 (55.07%), Query Frame = 3
Query:  588 IAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIF-QPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLI 1679
            +A S  GR++KF+I++G G +K VY+G D E    VAWCE +   + TK ++Q    E E++  + H +IVR +D    W       T+  +K IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L+++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT + TS  K+++GT  FMAPE+++E YDESVD+YAFGM MLE+ T+  P+ EC    Q+  K  SG  P     V D  ++EII  CI      R + ++L  H  F +  GL VE+    D+ S+               + + LRL   D + L+    D+ E++EF  ++    + D P+ +
Sbjct:  137 VATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDRKL-TKAEQQRFKEEAEMLKGLQHPNIVRFYD---SWE-----STLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLMRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIKDLLNHAFFAEDTGLRVEL-AEEDDCSN---------------SSLALRLWVEDPKKLKGKHKDN-EAIEFSFNL----EADTPEEV 461          
BLAST of Protein kinase vs. TrEMBL
Match: A0A4S2M643 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002431 PE=4 SV=1)

HSP 1 Score: 810.446 bits (2092), Expect = 0.000e+0
Identity = 365/500 (73.00%), Postives = 421/500 (84.20%), Query Frame = 3
Query:  555 YQIEQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANI-------PNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLV-ANKTAKLTEGE-----MESGDDQDEGMNSFTIISQYKGMWTKAKRALDKEMVAYRD 2015
            YQ EQEAK R  AKSKCGRW+K N+KIGEGGYKFVYRGYD  EA+NVAWCEFKREHVDTKEKRQ MF+ETEIMLKMNH HIVRCFDV REW   EDP   I+EKG+VIIQELMGEGTLK++I+KNFLEG CILKFPLITRWWHQILDALRYMH K  PPI+HRDLKADNCFLYG +D+EYLNVKVGDFGLATHV+ SGRKTMLGTLGFMAPEIFDEKYDE VDIYAFGMLMLEVMTNRTP+DEC+T++QVAAKT+SG+GP +++ VL+  LRE+I++CI PL+CFRP+AEEL+FHP+FQPK LPVEVE NYDN +DR EV+DRF+ ++       PN    NLRLRFRDK+MLQELGLDDGESLEFDLDIYKAEDQDIPDLI NLRL YEDKL RV++NPK  DK  +S+HLDKLF SI+LQMQ LVK LLG+RW+ ILDSLV   + ++  +G+      +  D      +SFTII +YKG W++AKR LD+E+ AYR+
Sbjct:  142 YQAEQEAKQRVSAKSKCGRWIKHNLKIGEGGYKFVYRGYDTVEARNVAWCEFKREHVDTKEKRQQMFKETEIMLKMNHPHIVRCFDVFREWIDMEDPNNQIEEKGVVIIQELMGEGTLKSVIRKNFLEGQCILKFPLITRWWHQILDALRYMHHKIQPPILHRDLKADNCFLYGASDEEYLNVKVGDFGLATHVNNSGRKTMLGTLGFMAPEIFDEKYDEKVDIYAFGMLMLEVMTNRTPYDECETVMQVAAKTMSGQGPDIMDKVLNPSLREVISACIQPLTCFRPSAEELYFHPLFQPKTLPVEVEPNYDNATDRAEVLDRFVRSLDVAETRNPN---FNLRLRFRDKKMLQELGLDDGESLEFDLDIYKAEDQDIPDLIHNLRLGYEDKLWRVFENPKQPDKKIVSSHLDKLFNSIRLQMQFLVKVLLGKRWKAILDSLVDEPRVSRKKDGQSALDEDDDSDTDGRETSSFTIIGKYKGKWSRAKRLLDREIQAYRN 638          
BLAST of Protein kinase vs. TrEMBL
Match: A0A4S2M682 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002431 PE=4 SV=1)

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 365/509 (71.71%), Postives = 421/509 (82.71%), Query Frame = 3
Query:  555 YQIEQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQ---------PKGLPVEVELNYDNISDRTEVIDRFIANI-------PNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLV-ANKTAKLTEGE-----MESGDDQDEGMNSFTIISQYKGMWTKAKRALDKEMVAYRD 2015
            YQ EQEAK R  AKSKCGRW+K N+KIGEGGYKFVYRGYD  EA+NVAWCEFKREHVDTKEKRQ MF+ETEIMLKMNH HIVRCFDV REW   EDP   I+EKG+VIIQELMGEGTLK++I+KNFLEG CILKFPLITRWWHQILDALRYMH K  PPI+HRDLKADNCFLYG +D+EYLNVKVGDFGLATHV+ SGRKTMLGTLGFMAPEIFDEKYDE VDIYAFGMLMLEVMTNRTP+DEC+T++QVAAKT+SG+GP +++ VL+  LRE+I++CI PL+CFRP+AEEL+FHP+FQ         PK LPVEVE NYDN +DR EV+DRF+ ++       PN    NLRLRFRDK+MLQELGLDDGESLEFDLDIYKAEDQDIPDLI NLRL YEDKL RV++NPK  DK  +S+HLDKLF SI+LQMQ LVK LLG+RW+ ILDSLV   + ++  +G+      +  D      +SFTII +YKG W++AKR LD+E+ AYR+
Sbjct:  142 YQAEQEAKQRVSAKSKCGRWIKHNLKIGEGGYKFVYRGYDTVEARNVAWCEFKREHVDTKEKRQQMFKETEIMLKMNHPHIVRCFDVFREWIDMEDPNNQIEEKGVVIIQELMGEGTLKSVIRKNFLEGQCILKFPLITRWWHQILDALRYMHHKIQPPILHRDLKADNCFLYGASDEEYLNVKVGDFGLATHVNNSGRKTMLGTLGFMAPEIFDEKYDEKVDIYAFGMLMLEVMTNRTPYDECETVMQVAAKTMSGQGPDIMDKVLNPSLREVISACIQPLTCFRPSAEELYFHPLFQRYQEGDDSWPKTLPVEVEPNYDNATDRAEVLDRFVRSLDVAETRNPN---FNLRLRFRDKKMLQELGLDDGESLEFDLDIYKAEDQDIPDLIHNLRLGYEDKLWRVFENPKQPDKKIVSSHLDKLFNSIRLQMQFLVKVLLGKRWKAILDSLVDEPRVSRKKDGQSALDEDDDSDTDGRETSSFTIIGKYKGKWSRAKRLLDREIQAYRN 647          
BLAST of Protein kinase vs. TrEMBL
Match: A0A4E0RDF5 (Serine:threonine protein kinase WNK1 OS=Fasciola hepatica OX=6192 GN=D915_003672 PE=4 SV=1)

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 370/517 (71.57%), Postives = 423/517 (81.82%), Query Frame = 3
Query:  555 YQIEQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQ---------PKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKI----NLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLVANKTAKLTEGEMESGDDQDE------GMNSFTIISQYKGMWTKAKRALDKEMVAYRDNSLKDANVSHV 2048
            YQ EQEAK +  AKSKCGRW+K N+KIGEGGYKFVYRGYD  EAKNVAWCEFKREHVDTKEKRQ+MF+ETEIMLKMNH HIVRCFDV REW   EDP   I+EKG+VIIQELMGEGTLK++I+KNFLEG CILKFPLITRWWHQILDALRYMH K  PPI+HRDLKADNCFLYG +D+EYLNVKVGDFGLATHV+ SGRKTMLGTLGFMAPEIFDEKYDE VDIYAFGMLMLEVMTNRTP+DEC+T++QVAAKT+SG+GP ++E VL+  LRE+I++CI PL+CFRPTAEEL+FHP+FQ         PK LPVEVE NYDN +DR EV+DRF+ ++ N   +    NLRLRFRDK+MLQELGLDDGESLEFDLDIYKAEDQDIPDLI NLRL YEDKL RV++NPK  DK  +S HLDKLF SI+LQMQ LVK LLG+RW+ ILDSLV    AK  +    + D+ +E      G  SF II QYK  WT+AK+ L+KE+ AYR+ +     +S V
Sbjct:  133 YQAEQEAKQKISAKSKCGRWIKHNLKIGEGGYKFVYRGYDTMEAKNVAWCEFKREHVDTKEKRQAMFKETEIMLKMNHPHIVRCFDVFREWIDMEDPNNQIEEKGVVIIQELMGEGTLKSVIRKNFLEGQCILKFPLITRWWHQILDALRYMHHKIQPPILHRDLKADNCFLYGASDEEYLNVKVGDFGLATHVNNSGRKTMLGTLGFMAPEIFDEKYDEKVDIYAFGMLMLEVMTNRTPYDECETVLQVAAKTMSGQGPDIMEKVLNPSLREVISACIQPLTCFRPTAEELYFHPLFQRYQEGDDSWPKTLPVEVEPNYDNATDRAEVLDRFVRSLDNAESLNPNFNLRLRFRDKKMLQELGLDDGESLEFDLDIYKAEDQDIPDLIHNLRLGYEDKLWRVFENPKQPDKKIVSNHLDKLFNSIRLQMQFLVKVLLGKRWKAILDSLVVEPRAKKRQDGTSAVDEDEESDADVSGAGSFAIIGQYKSKWTRAKKLLEKEIQAYRNATGAAPTISTV 649          
BLAST of Protein kinase vs. TrEMBL
Match: G4VAJ8 (Protein kinase OS=Schistosoma mansoni OX=6183 GN=Smp_154440 PE=4 SV=1)

HSP 1 Score: 794.653 bits (2051), Expect = 0.000e+0
Identity = 361/500 (72.20%), Postives = 421/500 (84.20%), Query Frame = 3
Query:  555 YQIEQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNC----TKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLVANKTAKLTEGEMESGDDQDEG------MNSFTIISQYKGMWTKAKRALDKEMVAYRDNSL 2024
            YQ EQEAK +  AKSKC RW+K N+KIGEGGYKFVYRGYD  EA+NVAWCEFKREHVDTKEKRQ+MFRETEIMLKMNH HIVRCFDV REW   EDP   I+EKG+VIIQELMGEGTLK++I+KNFL+G CILKFPLITRWWHQILDALRYMH K  PPI+HRDLKADNCFLYG +D+EYLNVKVGDFGLATHV  SGRKTMLGTLGFMAPEIFDEKYDE VDIYAFGMLMLEVMTNRTP+DEC+T++QVAAKT+SG+GP +++MV +  LRE+I++CI PL+CFRPTA+EL+FHP+FQPK LPVEVE NYDN +DR EV+DRF+ ++ N        NLRLRFRDK+MLQELGLDDGESLEFDLDIYKAEDQDIPDLI NLRL YEDKL RV++NPK  DK  +S+HLDKLF SI+LQMQ LVK LLG+RW+ ILDSLV ++  +  +    + D+ DE        +SFTII +YK  W +AK+ L+KE+ AYR++++
Sbjct:  135 YQAEQEAKQKVSAKSKCSRWIKHNLKIGEGGYKFVYRGYDSVEARNVAWCEFKREHVDTKEKRQAMFRETEIMLKMNHPHIVRCFDVFREWIDMEDPNNQIEEKGVVIIQELMGEGTLKSVIRKNFLDGQCILKFPLITRWWHQILDALRYMHHKIQPPILHRDLKADNCFLYGASDEEYLNVKVGDFGLATHVSNSGRKTMLGTLGFMAPEIFDEKYDEKVDIYAFGMLMLEVMTNRTPYDECETVLQVAAKTMSGQGPDIMQMVSNPSLREVISACIQPLTCFRPTADELYFHPLFQPKTLPVEVEPNYDNATDRAEVLDRFVRSLGNPETRNPNFNLRLRFRDKKMLQELGLDDGESLEFDLDIYKAEDQDIPDLIHNLRLGYEDKLWRVFENPKQPDKKVVSSHLDKLFSSIRLQMQFLVKVLLGKRWKAILDSLVQDQPVRKKQEGASTVDEDDESDTDAYDTSSFTIIGKYKSKWNRAKKLLEKEIQAYRNSTI 634          
BLAST of Protein kinase vs. TrEMBL
Match: A0A430QPZ3 (WNK lysine deficient protein kinase OS=Schistosoma bovis OX=6184 GN=DC041_0003924 PE=4 SV=1)

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 362/506 (71.54%), Postives = 424/506 (83.79%), Query Frame = 3
Query:  555 YQIEQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNC----TKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLVANKTAKLTEGEMESGDDQDEG------MNSFTIISQYKGMWTKAKRALDKEMVAYRDNSLKDANVS 2042
            YQ EQEAK +  AKSKC RW+K N+KIGEGGYKFVYRGYD  EA+NVAWCEFKREHVDTKEKRQ+MFRETEIMLKMNH HIVRCFDV REW   EDP   I+EKG+VIIQELMGEGTLK++I+KNFL+G CILKFPLITRWWHQILDALRYMH K  PPI+HRDLKADNCFLYG +D+EYLNVKVGDFGLATHV  SGRKTMLGTLGFMAPEIFDEKYDE VDIYAFGMLMLEVMTNRTP+DEC+T++QVAAKT+SG+GP +++MV +  LRE+I++CI PL+CFRPTA+EL+FHP+FQPK LPVEVE NYDN +DR EV+DRF+ ++ N        NLRLRFRDK+MLQELGLDDGESLEFDLDIYKAEDQDIPDLI NLRL YEDKL RV++NPK  DK  +S+HLDKLF SI+LQMQ LVK LLG+RW+ ILDSLV ++  +  +    + D+ DE        +SFTII +YK  W +AK+ L+KE+ AYR++++  ++ S
Sbjct:  135 YQAEQEAKQKVSAKSKCSRWIKHNLKIGEGGYKFVYRGYDSVEARNVAWCEFKREHVDTKEKRQAMFRETEIMLKMNHPHIVRCFDVFREWIDMEDPNNQIEEKGVVIIQELMGEGTLKSVIRKNFLDGQCILKFPLITRWWHQILDALRYMHHKIQPPILHRDLKADNCFLYGASDEEYLNVKVGDFGLATHVSNSGRKTMLGTLGFMAPEIFDEKYDEKVDIYAFGMLMLEVMTNRTPYDECETVLQVAAKTMSGQGPDIMQMVSNPSLREVISACIQPLTCFRPTADELYFHPLFQPKTLPVEVEPNYDNATDRAEVLDRFVRSLGNPETRNPNFNLRLRFRDKKMLQELGLDDGESLEFDLDIYKAEDQDIPDLIHNLRLGYEDKLWRVFENPKQPDKKVVSSHLDKLFSSIRLQMQFLVKVLLGKRWKAILDSLVQDQPVRKKQEGASTIDEDDESDTDAYDTSSFTIIGKYKSKWNRAKKLLEKEIQAYRNSTITVSSAS 640          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: wnk4b (serine/threonine-protein kinase WNK4-like [Source:NCBI gene;Acc:103036582])

HSP 1 Score: 236.113 bits (601), Expect = 2.961e-62
Identity = 143/373 (38.34%), Postives = 203/373 (54.42%), Query Frame = 3
Query:  564 EQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQP-KGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLI 1679
            E E + +A+A S  GR++KFN++IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR +D    W       T+   K I+++ ELM  GTLK  +K+ F E    +K  L+ RW HQIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDE+VD+YAFGM +LE+ T+  P+ EC    Q+  K  SG  P     V    L+EII  CI      R T ++L  HP FQ   G+ VE+    D +                 + + L LR  D + L      D  ++EF  ++YK    D+P+ +
Sbjct:  185 EDEVETKAVATSPDGRFLKFNVEIGRGSFKTVYKGLDTETTVEVAWCELQTRRL-TKVERQRFSEEVEMLKGLQHPNIVRFYD---SWK-----STVKGHKCIILVTELMTSGTLKTYLKR-FKE----MKLKLLQRWSHQILKGLHFLHTRA-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKSASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCILEMTTSEYPYSECQNAAQIYRKVTSGIKPDSFFKVRVPELKEIIEGCIRMNKAERYTIQDLLEHPFFQENNGVHVELAEEDDMVK----------------SGLKLWLRMDDTKKLHG-KYKDNNAIEFLFELYK----DVPEEV 517          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000001896.2 (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:103038802])

HSP 1 Score: 225.328 bits (573), Expect = 6.315e-59
Identity = 145/376 (38.56%), Postives = 208/376 (55.32%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIP-DLIQNL 1688
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   +   E+++  F+E   MLK + H +IVR +D    W   E P     +K IV++ ELM  GTLK  +K+ F E    +K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  +   D  EV+            I L LR  D + L+     D E++EF  D++K    D+P D+ Q +
Sbjct:  194 EEVETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW---ESPSK--GKKYIVLVTELMTSGTLKTYLKR-FKE----MKIKVLRSWCRQILKGLHFLHTRS-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ-EETGVRVELAEE---DDGEVV-----------AIKLWLRIEDVKKLKGK-YKDNEAIEFSFDLHK----DVPEDVAQEM 529          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000050296.1 (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:103038802])

HSP 1 Score: 225.328 bits (573), Expect = 6.795e-59
Identity = 145/376 (38.56%), Postives = 208/376 (55.32%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIP-DLIQNL 1688
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   +   E+++  F+E   MLK + H +IVR +D    W   E P     +K IV++ ELM  GTLK  +K+ F E    +K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  +   D  EV+            I L LR  D + L+     D E++EF  D++K    D+P D+ Q +
Sbjct:  194 EEVETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW---ESPSK--GKKYIVLVTELMTSGTLKTYLKR-FKE----MKIKVLRSWCRQILKGLHFLHTRS-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ-EETGVRVELAEE---DDGEVV-----------AIKLWLRIEDVKKLKGK-YKDNEAIEFSFDLHK----DVPEDVAQEM 529          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000052131.1 (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:103038802])

HSP 1 Score: 224.942 bits (572), Expect = 8.231e-59
Identity = 145/376 (38.56%), Postives = 208/376 (55.32%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIP-DLIQNL 1688
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   +   E+++  F+E   MLK + H +IVR +D    W   E P     +K IV++ ELM  GTLK  +K+ F E    +K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  +   D  EV+            I L LR  D + L+     D E++EF  D++K    D+P D+ Q +
Sbjct:  194 EEVETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW---ESPSK--GKKYIVLVTELMTSGTLKTYLKR-FKE----MKIKVLRSWCRQILKGLHFLHTRS-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ-EETGVRVELAEE---DDGEVV-----------AIKLWLRIEDVKKLKGK-YKDNEAIEFSFDLHK----DVPEDVAQEM 529          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000041214.1 (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:103038802])

HSP 1 Score: 224.942 bits (572), Expect = 8.908e-59
Identity = 145/376 (38.56%), Postives = 208/376 (55.32%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIP-DLIQNL 1688
            +E + +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   +   E+++  F+E   MLK + H +IVR +D    W   E P     +K IV++ ELM  GTLK  +K+ F E    +K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R + ++L  H  FQ +   V VEL  +   D  EV+            I L LR  D + L+     D E++EF  D++K    D+P D+ Q +
Sbjct:  194 EEVETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW---ESPSK--GKKYIVLVTELMTSGTLKTYLKR-FKE----MKIKVLRSWCRQILKGLHFLHTRS-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ-EETGVRVELAEE---DDGEVV-----------AIKLWLRIEDVKKLKGK-YKDNEAIEFSFDLHK----DVPEDVAQEM 529          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001965.1 (pep scaffold:Pmarinus_7.0:GL477178:11064:57293:1 gene:ENSPMAG00000001777.1 transcript:ENSPMAT00000001965.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.777 bits (421), Expect = 3.230e-42
Identity = 109/306 (35.62%), Postives = 159/306 (51.96%), Query Frame = 3
Query:  753 FRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDI 1667
            FRE   MLK + H  IVR +D    W       T+  +  IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++E YDE+VD+YAFGM MLE+ T+  P+ EC    Q+  K  +G  P     V    L+EII  CI      R + ++L  H  F  +   V VEL  ++  ++                I LRLR  D + L+     + E++EF  ++ K   +++
Sbjct:   14 FREEADMLKGLQHPSIVRFYD---SWE-----STLKGKHSIVLVTELMTSGTLKTYLKR-----FKVMKTKVLQSWCRQILKGLHFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEHYDEAVDVYAFGMCMLEMATSEYPYSECQNPAQIYRKVTTGVKPASFNKVAMPELKEIIEGCIRTNKDERYSIKDLLNHGFFA-EDTGVRVELAEEDDGEK--------------PVIGLRLRVEDPKKLKG-KYKENEAIEFSFELDKDAAEEV 285          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001973.1 (pep scaffold:Pmarinus_7.0:GL477178:11064:57290:1 gene:ENSPMAG00000001777.1 transcript:ENSPMAT00000001973.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.851 bits (416), Expect = 2.995e-41
Identity = 109/306 (35.62%), Postives = 159/306 (51.96%), Query Frame = 3
Query:  753 FRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDI 1667
            FRE   MLK + H  IVR +D    W       T+  +  IV++ ELM  GTLK  +K+       ++K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++E YDE+VD+YAFGM MLE+ T+  P+ EC    Q+  K  +G  P     V    L+EII  CI      R + ++L  H  F  +   V VEL  ++  ++                I LRLR  D + L+     + E++EF  ++ K   +++
Sbjct:   14 FREEADMLKGLQHPSIVRFYD---SWE-----STLKGKHSIVLVTELMTSGTLKTYLKR-----FKVMKTKVLQSWCRQILKGLHFLHTR-TPPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEHYDEAVDVYAFGMCMLEMATSEYPYSECQNPAQIYRKVTTGVKPASFNKVAMPELKEIIEGCIRTNKDERYSIKDLLNHGFFA-EDTGVRVELAEEDDGEK--------------PVIGLRLRVEDPKKLKG-KYKENEAIEFSFELDKDAAEEV 285          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: nrbp1 (nuclear receptor binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-041001-146])

HSP 1 Score: 100.523 bits (249), Expect = 9.600e-23
Identity = 87/299 (29.10%), Postives = 133/299 (44.48%), Query Frame = 3
Query:  588 IAKSKCGRWVKFNIKIGE---GGYKFVYRGYDVEEAKNVAWCEF----KREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKG-IVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYG----QTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFD-EKYDESVDIYAFGMLMLEV-MTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHP 1442
            + +S CGRW K   ++ +    G    Y G D EE   V W E     +R +   +EK +++F     ++ + H++IV+  +   +         I + K  ++ I E M  G+LK  +KK   + H  +      RW  QIL AL Y+H    PPIIH +L  +  F+      +   E+  +K      A + H    +     L F+APE  D      +VDIY+FGM  LE+ +    P  +   + Q A +   G        + D   RE I  C+ P +  RPTA EL FHP
Sbjct:   29 LEESPCGRWQKRREEVSQRNVPGIDSAYLGMDTEEGVEVVWNEVQFSERRNYKAQEEKIKTVFNN---LIHLEHANIVKFHNYWAD---------IKESKARVIFITEYMSSGSLKQFLKKT-KKNHKTMNEKAWKRWCTQILSALGYLH-SFVPPIIHANLTCETIFMQHNGLIKIGSEWYQMKRRLAPGAINDHVKTFRAEQKDLHFLAPEYADLAGMTTAVDIYSFGMCALEMAVLEIQPNGDSTVVSQEAVQAAIGS-------LEDPLQREFIQRCLCPEAPGRPTARELLFHP 306          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: nrbp1 (nuclear receptor binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-041001-146])

HSP 1 Score: 97.8265 bits (242), Expect = 3.564e-21
Identity = 102/361 (28.25%), Postives = 150/361 (41.55%), Query Frame = 3
Query:  603 CGRWVKFNIKIGE---GGYKFVYRGYDVEEAKNVAWCEFK-REHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKG--IVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGL-ATHVHTSGRKTMLGTLGFMAPEIFD-EKYDESVDIYAFG-----MLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHP----IFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFD 1634
            CGRW K   ++ +    G    Y   D EE   V W E +  E  + K + + +    + ++++ H +IV+       +H Y    T I E    ++ I E M  G+LK  +KK   + H  +      RW  QIL ALRY+H    PPIIH +L  D  F+          +K+G     A H H    +     L F APE     +   SVDIY+FG     M +LE+  N     +C T+V   A +        I  + D   RE+I  C+   +  RPTA  L FH     +   K L     LN+ ++     V +      PN     +R    D R  ++  L    +LE D
Sbjct:   42 CGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSERKNFKAQEEKIKAVFDNLIQLEHPNIVK-------FHKY---WTDIKENKARVIFITEYMSSGSLKQFLKKT-KKNHKTMNEKAWKRWCTQILSALRYLHSSV-PPIIHGNLTCDTIFMQHNGL-----IKIGSVAPDAIHNHVKTYREEQKNLHFFAPEYGAVGEVTTSVDIYSFGICALEMAVLEIQGN----GDCSTLVSHEAIS------SAINSLEDPLQRELIQRCLCAGAGVRPTARSLLFHAALFEVHSLKLLAAHCFLNHQHLMAENAVEEMTKKIDPNGVLAEIRRVQGDGRQWRQTLLSQVSALELD 375          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: nrbp1 (nuclear receptor binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-041001-146])

HSP 1 Score: 95.9005 bits (237), Expect = 3.653e-21
Identity = 87/304 (28.62%), Postives = 132/304 (43.42%), Query Frame = 3
Query:  588 IAKSKCGRWVKFNIKIGE---GGYKFVYRGYDVEEAKNVAWCEF----KREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKG-IVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQT---------DDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFD-EKYDESVDIYAFGMLMLEV-MTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHP 1442
            + +S CGRW K   ++ +    G    Y G D EE   V W E     +R +   +EK +++F     ++ + H++IV+  +   +         I + K  ++ I E M  G+LK  +KK   + H  +      RW  QIL AL Y+H    PPIIH +L  +  F+                +L   +    +  HV T   +     L F+APE  D      +VDIY+FGM  LE+ +    P  +   + Q A +   G        + D   RE I  C+ P +  RPTA EL FHP
Sbjct:   28 LEESPCGRWQKRREEVSQRNVPGIDSAYLGMDTEEGVEVVWNEVQFSERRNYKAQEEKIKTVFNN---LIHLEHANIVKFHNYWAD---------IKESKARVIFITEYMSSGSLKQFLKKT-KKNHKTMNEKAWKRWCTQILSALGYLH-SFVPPIIHANLTCETIFMQHNGLIKIGSAVWHPNFLLYLLAPGAINDHVKTF--RAEQKDLHFLAPEYADLAGMTTAVDIYSFGMCALEMAVLEIQPNGDSTVVSQEAVQAAIGS-------LEDPLQREFIQRCLCPEAPGRPTARELLFHP 308          
BLAST of Protein kinase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 90.5077 bits (223), Expect = 8.549e-19
Identity = 97/367 (26.43%), Postives = 168/367 (45.78%), Query Frame = 3
Query:  633 IGEGGYKFVYRGYD----VEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHV-HTSGRK-TMLGTLGFMAPEIFDEKYDE---SVDIYAFGMLMLEVMTNRTPFDECD--TIVQ-VAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQ---PKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNL 1688
            +GEGG+   ++  D    +  AK VA    K E     + R+ +  E +I   M+H +IV+  D               D+  + I+ E+   G+L  ++K+       +L  P +  +  QI  A++YMH +    +IHRDLK  N F      D   N+K+GDFGLA  + + S RK T+ GT  ++APE+   K+      VDI++ G+++  ++  + PF   D  TI + +  +  S    K I       +R+I++  + P+   RP+  E+  +  F+   P  +P  V     N  D  E  ++ + N  +C + +L L       +Q    D   S++  +D  +   Q+ P L  +L
Sbjct:   88 LGEGGFARCFQIKDDSGEIFAAKTVAKASIKSE-----KTRKKLLSEIQIHKSMSHPNIVQFIDCFE------------DDSNVYILLEICPNGSLMELLKRR-----KVLTEPEVRFFTTQICGAIKYMHSRR---VIHRDLKLGNIFF-----DSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILS--LDPIE--RPSLTEIMDYVWFRGTFPPSIPSTVMSEAPNFEDIPE--EQSLVNFKDCMEKSLLLESMSSDKIQRQKRDYISSIKSSIDKLEEYHQNRPFLPHSL 418          
BLAST of Protein kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 89.7373 bits (221), Expect = 2.134e-18
Identity = 60/220 (27.27%), Postives = 108/220 (49.09%), Query Frame = 3
Query:  627 IKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSG--RKTMLGTLGFMAPEIFDEK-YDESVDIYAFGMLMLEVMTNRTPF 1277
            +KIG+G    VY  Y++    +VA    K+ +++ + K++ +  E  +M    H +IV   D            + + +  + +I E M  G+L +++       HCIL    I     + L  L ++H K    ++HRD+K+DN  L  + D     +K+ DFG    ++     R TM+GT  +MAPE+   K Y   VDI++ G++++E++    P+
Sbjct:  624 VKIGQGASGGVYTAYEIGTNVSVA---IKQMNLEKQPKKELIINEILVMKGSKHPNIVNFID------------SYVLKGDLWVIMEYMEGGSLTDVVT------HCILTEGQIGAVCRETLSGLEFLHSKG---VLHRDIKSDNILLSMEGD-----IKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 814          
BLAST of Protein kinase vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 88.5817 bits (218), Expect = 5.215e-18
Identity = 73/291 (25.09%), Postives = 131/291 (45.02%), Query Frame = 3
Query:  612 WVKFNIKIGEGGYKFVYRGYDVEEA-----KNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATH---VHTSGRKTMLGTLGFMAPEIFDEK--YDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVL---DKWLREIINSCIHPLSCFRPTAEELFFHPI 1445
            W+K  + IG+G +  VY   +V        K V   ++  ++       +++  E   +  ++H +IV+      + ++Y             +  E +  G++ ++I+      +     PLI     Q+L  L Y+H K    I+HRD+KADN  L     D+    K+ DFG++     ++++   TM GT+ +MAPE+ D K  Y   VDI++ G ++LE+   + P+   + +  +     S   P + E  L    +  R  +++C       RPTA EL  HP 
Sbjct: 1175 WMKGEM-IGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYS------------LFLEYVAGGSVGSLIRM-----YGRFDEPLIKHLTTQVLKGLAYLHSKG---ILHRDMKADNLLL-----DQDGICKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439          
BLAST of Protein kinase vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 82.8037 bits (203), Expect = 1.856e-16
Identity = 62/234 (26.50%), Postives = 111/234 (47.44%), Query Frame = 3
Query:  633 IGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGR--KTMLGTLGFMAPEIFDEKY--DESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLS 1322
            +GEG +  V   Y     + VA     ++ +   + +  + RE   +  + H HI++ +DV++             +  I+++ E  G      I++++ +      +F      + QI+ A+ Y H      I+HRDLK +N  L     DE+LNVK+ DFGL +++ T G   KT  G+  + APE+   K      VD+++ G+++  ++  R PFD  D  + V  K +S
Sbjct:   61 LGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKS------------KDEIIMVIEYAGNELFDYIVQRDKMSEQEARRF------FQQIISAVEYCHRH---KIVHRDLKPENLLL-----DEHLNVKIADFGL-SNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DESIPVLFKNIS 265          
BLAST of Protein kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 81.6481 bits (200), Expect = 6.057e-16
Identity = 58/200 (29.00%), Postives = 99/200 (49.50%), Query Frame = 3
Query:  876 IIQELMGEGTLKNIIKKNFLE--GHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHV--HTSGRKTMLGTLGFMAPEIFDEK-YDESVDIYAFGMLMLEVMTNRTPF---DECDTIVQVAAK-TLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIF 1448
            ++ E M  G+L +II+ +      H  L  P I     +    L+++H K    IIHRD+K+DN  L     D    VK+ DFG    +    S R TM+GT  +MAPE+  ++ YDE +D+++ G++ +E++    P+   D    +  +A   T   K P+ + + + ++L   +  C+     +R + EEL  H  F
Sbjct:  638 VVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLL-----DTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCL--CVD--VRYRASTEELLHHGFF 825          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO37413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU9])

HSP 1 Score: 99.3673 bits (246), Expect = 1.096e-22
Identity = 86/277 (31.05%), Postives = 134/277 (48.38%), Query Frame = 3
Query:  630 KIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKG--IVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPP-IIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVH--TSGRKTMLGTLGFMAPEIFDEK-YDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHP 1442
            +IG G Y    +    ++ K + W E     +   EK Q +  E  ++ ++ H HIVR +D             IID     I I+ E    G L  +IKK+  E     +  L+ +  +Q++ A++  H + D   ++HRDLK  N FL     D  +NVK+GDFGLA  +   TS  KT +GT  +M+PE  +++ Y+E  DI++ G LM E+     PF   D I ++ AK   G+    I       L ++INS +      RP+ +EL  +P
Sbjct:   14 RIGSGSYGICKKIRRKKDNKVLVWKELDYGQMSETEK-QMLVSEVNLLRELKHPHIVRYYD------------RIIDRTNTTIYIVMEFCENGDLGALIKKHKREKRYTAE-DLVWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANVFL-----DANMNVKLGDFGLARVLSHDTSFAKTFVGTPYYMSPEQVNKRSYNEKSDIWSLGCLMYELCALSPPFTAMDQI-RLEAKIKVGRF-HPIPSHYSSSLSQLINSMLQVNDEMRPSIDELLRNP 269          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 100.908 bits (250), Expect = 1.781e-21
Identity = 75/295 (25.42%), Postives = 135/295 (45.76%), Query Frame = 3
Query:  612 WVKFNIKIGEGGYKFVYRGYDVEEA-----KNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKK--NFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFG----LATHVHTSG--RKTMLGTLGFMAPEIF-DEKYDESVDIYAFGMLMLEVMTNRTPFD--ECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIF 1448
            W K  + +G G +   Y   DV        K V++C   +   D  +  Q++  E  I+ ++ H H+++C    R    +             I  E M  G++  ++ K   F E        ++ R+  QIL  + Y+H   +  ++HRD+K  N  +    D    ++++ DFG    LAT +  +G  +  +LGT+ FMAPE+   E Y  S D+++ G +++E+ T + P++  E    + +  K     GP  I   L+  +R+++  C+      RP A +L  HP+F
Sbjct:  577 WKKGEL-LGTGAFSSCYGARDVMTGSLMAVKQVSFCRNSKSEQD--KVCQTIMDEIAILARLKHPHLIKCLGATRHTGHFN------------IFLEWMAGGSISMLLSKYGPFEEA-------ILIRYLRQILQGVSYLH---ENQVVHRDIKGANILV----DSTGQDIRIADFGAAARLATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKIACAIGPPDIPEHLNPGVRDVVLRCLESKPEDRPAAVDLLQHPLF 842          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO36110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ9])

HSP 1 Score: 93.2041 bits (230), Expect = 1.573e-19
Identity = 85/291 (29.21%), Postives = 129/291 (44.33%), Query Frame = 3
Query:  594 KSKCGRWVKFNIKIGE---GGYKFVYRGYDVEEAKNVAWCEFK-REHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVI-IQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLAT-HVHTSGRKTMLGTLGFMAPEIFDEKY--DESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHP 1442
            +S CGRW K   ++ +    G    Y   D EE   V W E +  E  D K + +++ +  E +++++H +IV      R W        +  EK  VI I E M  G+LK  +KK     +  +   +  RW  QIL AL Y+H  CD PI+H +L  D  F+          +K+G     T H H    +     + F+APE     +  D +VD+YAFGM  LE+        + +  V   A T + +G   +E  L K   + IN C+      RP+  +L   P
Sbjct:   30 QSPCGRWEKRRQEVMQRDVPGIDHAYLAMDTEEGVEVVWNEVQFSERKDFKSQEETVKKVFENLIQLDHPNIV---SFHRFW------TDVQGEKARVIFITEYMTSGSLKQFLKKTRKNNYKTMNEKVWKRWCRQILSALSYLH-GCDVPIVHGNLSCDTIFIQHNG-----LIKIGSVAPDTIHNHVKTCREERRNMHFIAPEYGQPGHIVDCAVDVYAFGMCALEMAA--LELHDIEGPVPKEAITQAIQG---LESPLQK---DFINRCLAENPADRPSVRDLLLDP 297          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO41399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I8])

HSP 1 Score: 85.5001 bits (210), Expect = 1.227e-17
Identity = 74/293 (25.26%), Postives = 132/293 (45.05%), Query Frame = 3
Query:  630 KIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKT-MLGTLGFMAPE-IFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGK------GPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELN 1484
            K+G+G Y  VY+ +   + ++V   +  ++   +K   +++  E E++  + H HIV+  D   +W          DE  I +I E  G G L       F+     L   +  ++  Q+  AL+YM       + H DLK  N  L  + +     +K+ DFG A  +H +   + + G+  +MAPE I  + YD SVD+++ G+++ E +    PF +  T V++ AK  S +      GP+V         R+++ + +      R + E  F HP    + +P    L 
Sbjct:   22 KLGQGSYATVYKAFKKGDNRDVVAIKCIKKKTLSKAATENLLTEIELLRNLEHEHIVQLKDF--QW----------DENHIFLIMEYCGGGDL-----SRFIHSKRALPERMARKFLRQLACALQYMR---SYDVAHMDLKPQNLLLSSRHNP---VLKIADFGFAQKLHPNSEASNIRGSPLYMAPEMICCQSYDASVDLWSVGVILYETLFGEPPF-KSKTFVELEAKLRSSEPIKLPPGPRV-----SADCRDLLIALLQRDPKQRISFEAFFTHPFIDMEHMPSSTSLQ 285          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO33129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST31])

HSP 1 Score: 87.0409 bits (214), Expect = 1.953e-17
Identity = 76/295 (25.76%), Postives = 133/295 (45.08%), Query Frame = 3
Query:  666 GYDVEEAKNVAWCEFKREHVDTK----EKRQS----MFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNF-----LEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSG-------RKTMLGTLGFMAPEIFDEK---YDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLD----------KWLREIINSCIHPLSCFRPTAEELFFHPIFQ 1451
            GY        A CE K E V  K    EK  +    M +E   M + NH ++V  +             + +  + + I+  L+  G++ ++IK+       L    +L+  +I     ++L  L Y H      +IHRD+KA N  L   TD    +V++ DFG+++ +   G       RKT +GT  +MAPE+ +++   Y+   DI++FG+  +E+ T   P+ +   + +V   TL    P+ +E   D          K  +++++ C+      RP A EL  +P F+
Sbjct:   23 GYGATAVVQAAICESKNERVAIKRIDLEKCGASIDEMMKEIHAMSQCNHENVVNYY------------TSFVVRQELWIVMRLLNGGSMLDVIKQRIKQQPGLVDEGVLEEDIIATVLREVLKGLEYFHKNG---LIHRDVKAGNILL--ATDG---SVQLADFGVSSAISDYGDRTKPKMRKTFVGTPCWMAPEVMEQQVHGYNHKADIWSFGITAIELATGTAPYAKFPAM-KVLMLTLQNDPPR-METCADGSTRDYKKYSKVFKKMVSLCLQKEPANRPDANELLKNPFFK 295          
BLAST of Protein kinase vs. Ensembl Medaka
Match: wnk4b (WNK lysine deficient protein kinase 4 [Source:NCBI gene;Acc:101169493])

HSP 1 Score: 226.098 bits (575), Expect = 3.341e-59
Identity = 139/367 (37.87%), Postives = 198/367 (53.95%), Query Frame = 3
Query:  582 RAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQP-KGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLI 1679
            +A+A S  GR++KFNI+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR  D  +         T+   K I+++ ELM  GTLK  +K+ F E    +K  L+ RW  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDE+VD+YA GM +LE+ T+  P+ EC    Q+  K  SG  P     V+   L+EII  CI      R T ++L  HP FQ   G+ VE+    D +                 + + L LR  D + L      D  ++EF  ++YK    D+P+ +
Sbjct:  163 KAVATSPEGRYLKFNIEIGRGSFKTVYKGLDTETTVEVAWCELQTRKL-TKAERQRFSEEVEMLKGLQHPNIVRFHDSWKS--------TVKGHKCIILVTELMTSGTLKTYLKR-FKE----MKLKLLQRWSRQILKGLHFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKSASFAKSVIGTPEFMAPEMYEEKYDEAVDVYALGMCILEMATSEYPYSECQNAAQIYRKVTSGNKPDSFYKVIVPELKEIIEGCIRMNKDERYTIQDLLDHPFFQENNGVHVELAEEDDLVK----------------SGLKLWLRIDDIKKLHG-KYKDNNAIEFLFELYK----DVPEEV 489          
BLAST of Protein kinase vs. Ensembl Medaka
Match: wnk4b (WNK lysine deficient protein kinase 4 [Source:NCBI gene;Acc:101169493])

HSP 1 Score: 226.098 bits (575), Expect = 3.504e-59
Identity = 139/367 (37.87%), Postives = 198/367 (53.95%), Query Frame = 3
Query:  582 RAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQP-KGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLI 1679
            +A+A S  GR++KFNI+IG G +K VY+G D E    VAWCE +   + TK +RQ    E E++  + H +IVR  D  +         T+   K I+++ ELM  GTLK  +K+ F E    +K  L+ RW  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDE+VD+YA GM +LE+ T+  P+ EC    Q+  K  SG  P     V+   L+EII  CI      R T ++L  HP FQ   G+ VE+    D +                 + + L LR  D + L      D  ++EF  ++YK    D+P+ +
Sbjct:  163 KAVATSPEGRYLKFNIEIGRGSFKTVYKGLDTETTVEVAWCELQTRKL-TKAERQRFSEEVEMLKGLQHPNIVRFHDSWKS--------TVKGHKCIILVTELMTSGTLKTYLKR-FKE----MKLKLLQRWSRQILKGLHFLHTRT-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKSASFAKSVIGTPEFMAPEMYEEKYDEAVDVYALGMCILEMATSEYPYSECQNAAQIYRKVTSGNKPDSFYKVIVPELKEIIEGCIRMNKDERYTIQDLLDHPFFQENNGVHVELAEEDDLVK----------------SGLKLWLRIDDIKKLHG-KYKDNNAIEFLFELYK----DVPEEV 489          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ENSORLT00000027269.1 (pep primary_assembly:ASM223467v1:8:129429:156272:1 gene:ENSORLG00000026732.1 transcript:ENSORLT00000027269.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.164 bits (557), Expect = 3.541e-59
Identity = 135/363 (37.19%), Postives = 198/363 (54.55%), Query Frame = 3
Query:  585 AIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPD 1673
            A+A S  GR++KFNI+IG G +K VY+G D E    VAWCE +  H  ++ +RQ    E E++  + H +IVR FD  +          +   K  +++ ELM  GTLK  +++ F +    +K  L+ RW  Q+L  L ++H +  PPIIHRDLK DN F+ G +     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDE+VD+YAFGM MLE+ T+  P+ EC +  Q+  K  +G  P     V    L+EII  CI   S  R T ++L  H  FQ +   V VEL  ++   +                + L LR  DK  L+     D +++EF  ++YK    D+P+
Sbjct:   71 AVASSPDGRFLKFNIEIGRGSFKTVYKGLDTETTVEVAWCELQ-THRLSRAERQRFSEEVEMLKALQHPNIVRFFDSWK--------SALKGHKCTILVTELMTSGTLKMYLRR-FRQ----MKLKLLQRWSFQVLRGLHFLHSR-SPPIIHRDLKCDNIFITGPS----ASVKIGDLGLATLKKASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCMLEMATSEYPYHECHSAAQIYRKVTNGIKPDSFFKVEVPELKEIIEGCIRTRSSERFTVQDLLEHSFFQ-ENTGVHVELAEEDDGSK--------------AALKLWLRMDDKEKLRG-KYKDNDAIEFLYELYK----DVPE 394          
BLAST of Protein kinase vs. Ensembl Medaka
Match: wnk1b (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:101172041])

HSP 1 Score: 224.557 bits (571), Expect = 1.590e-58
Identity = 140/368 (38.04%), Postives = 201/368 (54.62%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDI 1667
            +EA+ +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   +   E+++  F+E   MLK + H +IVR +D       +E P     +K IV+I ELM  GTLK  +K+       ++K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R   + L  H  FQ +   V VEL  +   D  E+I            I L LR  D + L+     D E++EF  D+ +   +D+
Sbjct:  265 EEAETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYDS------WEGPCK--GKKCIVLITELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLHFLHTRA-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRTNKDERYAIKTLLNHAFFQEE-TGVRVELAEE---DDGEMI-----------AIKLWLRIEDVKKLKG-KYKDNEAIEFSFDLIRDVPEDV 596          
BLAST of Protein kinase vs. Ensembl Medaka
Match: wnk1b (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:101172041])

HSP 1 Score: 224.557 bits (571), Expect = 1.689e-58
Identity = 140/368 (38.04%), Postives = 201/368 (54.62%), Query Frame = 3
Query:  567 QEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLK-MNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDI 1667
            +EA+ +A+  S  GR++KF+I+IG G +K VY+G D E    VAWCE +   +   E+++  F+E   MLK + H +IVR +D       +E P     +K IV+I ELM  GTLK  +K+       ++K  ++  W  QIL  L ++H +  PPIIHRDLK DN F+ G T     +VK+GD GLAT    S  K+++GT  FMAPE+++EKYDESVD+YAFGM MLE+ T+  P+ EC    Q+  +  SG  P   + V    ++EII  CI      R   + L  H  FQ +   V VEL  +   D  E+I            I L LR  D + L+     D E++EF  D+ +   +D+
Sbjct:  265 EEAETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYDS------WEGPCK--GKKCIVLITELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLHFLHTRA-PPIIHRDLKCDNIFITGPTG----SVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRTNKDERYAIKTLLNHAFFQEE-TGVRVELAEE---DDGEMI-----------AIKLWLRIEDVKKLKG-KYKDNEAIEFSFDLIRDVPEDV 596          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000080382.1 (SMESG000080382.1)

HSP 1 Score: 2957.16 bits (7665), Expect = 0.000e+0
Identity = 1459/1467 (99.45%), Postives = 1462/1467 (99.66%), Query Frame = 3
Query:   57 MISENQNENDSKKSILKKSEGKPIKKVVSIFINDVGMTNNTISDNTEFEYNQKDPPMFVSEAIFPYTYELEQIKYCNRCTSPDHKFSMEEFLNNLDNKLDVAKVNDTEIVEEMINNGKARHVNCNTLYSNDVTSLHNATVSQDXXXXXXXXXXXXXXXXXXXXXXXYQIEQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLVANKTAKLTEGEMESGDDQDEGMNSFTIISQYKGMWTKAKRALDKEMVAYRDNSLKDANVSHVENNFHIDGKLSTNNELIQPEIESLENVILEKPLIENPTYVKAISQSPVEGSISYLNSFTDSEQMDNPNLIQGSVFNQDTLQITSVQGPSLTATTGSNTITMFDSRDLYKETTPVDIITMNKDSQCETDSQKNILNGSYNVKVQNIEFNTHSNLICVTFNVEIPDFSNSESGKWVLCFKCVINENTSIIDNLELNTSDDLAGKIDNDIQLALRETLLCILKMIQNDKKSVLINQNFIFYPIMEKMFLEPLTETNGCKASIRNTVATHDIIVPEDFCIEANTVKSNEHKTISVDHSNIDSNINLDSLFDQENTILLTKRFEDEKYIVKAFSIPCGSAVVINNNGTIQNIRKTTIISPKLDSNENIFVRELDKTDLSMDKAIHILTLLQEKIEELSTKNHNLTDLTSKIIYECKPNMEINKKPQIVDPIDKQKIIEQVLLQKSEIEKLQKQQIELISILSNQQIIVPPDIDQSVISANPNKLISNSEQDILNTQKINNKMFSHFSGQQFINVNPMSMNNDGRLFMQNNMYMTPEDLEYQNSNNFLLDNAIRNQMVHMKTPVNENIIYNSSSNVNKDFVSIDSSMRFKCKKDVPNIGDATRAYSDVSNPYTNDRLEYFDRNIYHQLHYLNNDQIPENDLHCKINPVSSVPNIQERIADFKTPETNLSQQMYSQKYPYFYQIPYQNRRGEQLINFRCPQSMQNYYDPSMFVIGSQYSNPEEQLGNMRKEQLLYDHNTVDDIKLTEINYKEKQLQPDPSLFSVNTNFAAPENPNNCSINQKSLEKPTETCINIQMNPLEEKIKDVFNNR 4457
            MISENQNENDSKKSILKKSEGKPIKKVVSIFINDVGMTNNTISDNTEFEYNQKDPPMFVSEAIFPYTYELEQIKYCNRCTSPDHKFSMEEFLNNLDNKLDVAKVNDTEIVEEMINNGKARHVNCNTLYSNDVTSLHNATVSQDKKKTKEERKKEREKKKEEEMLKKYQIEQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLVANKTAKLTEGEMESGDDQDEGMNSFTIISQYKGMWTKAKRALDKEMVAYRDNSLKDANVSHVENNFHIDGK STNNELIQPEIESLENVILEKPLIENPTYVKAISQSPVEGSISYLNSFTDSEQMDNPNLIQGSVFNQDTLQITSVQGPSLTATTGSNTITMFDSRDLYKETTPVD ITMNKDSQCETDSQK+ILNGSYNVKVQNIEFNTHSNLICVTFNVEIPDFSNSESGKWVLCFKCVINENTSIIDNLELNTSDDLAGKIDNDIQLALRETLLCILKMIQNDKKSVLINQNFIFYP MEKMFLEPLTETNGCKASIRNTVATHDII+PEDFCIEANTVKSNEHKTISVDHSNIDSNINLDSLFDQENTILLTKRFEDEKYIVKAF IPCGSAVVINNNGTIQNIRKTTIISPKLDSNENIFVRELDKTDLSMDKAIHILTLLQEKIEELSTKNHNLTDLTSKIIYECKPNMEINKKPQIVDPIDKQKIIEQVLLQKSEIEKLQKQQIELISILSNQQIIVPPDIDQSVISANPNKLISNSEQDILNTQKINNKMFSHFSGQQFINVNPMSMNNDGRLFMQNNMYMTPEDLEYQNSNNFLLDNAIRNQMVHMKTPVNENIIYNSSSNVNKDFVSIDSSMRFKCKK+VPNIGDATRAYSDVSNPY NDRLEYFDRNIYHQLHYLNNDQIPENDLHCKINPVSSVPNIQERIADFKTPETNLSQQMYSQKYPYFYQIPYQNRRGEQLINFRCPQSMQNYYDPSMFVIGSQYSNPEEQLGNMRKEQLLYDHNTVDDIKLTEINYKEKQLQPDPSLFSVNTNFAAPENPNNCSINQKSLEKPTETCINIQMNPLEEKIKDVFNNR
Sbjct:    1 MISENQNENDSKKSILKKSEGKPIKKVVSIFINDVGMTNNTISDNTEFEYNQKDPPMFVSEAIFPYTYELEQIKYCNRCTSPDHKFSMEEFLNNLDNKLDVAKVNDTEIVEEMINNGKARHVNCNTLYSNDVTSLHNATVSQDKKKTKEERKKEREKKKEEEMLKKYQIEQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLVANKTAKLTEGEMESGDDQDEGMNSFTIISQYKGMWTKAKRALDKEMVAYRDNSLKDANVSHVENNFHIDGKPSTNNELIQPEIESLENVILEKPLIENPTYVKAISQSPVEGSISYLNSFTDSEQMDNPNLIQGSVFNQDTLQITSVQGPSLTATTGSNTITMFDSRDLYKETTPVDFITMNKDSQCETDSQKDILNGSYNVKVQNIEFNTHSNLICVTFNVEIPDFSNSESGKWVLCFKCVINENTSIIDNLELNTSDDLAGKIDNDIQLALRETLLCILKMIQNDKKSVLINQNFIFYPRMEKMFLEPLTETNGCKASIRNTVATHDIIIPEDFCIEANTVKSNEHKTISVDHSNIDSNINLDSLFDQENTILLTKRFEDEKYIVKAFCIPCGSAVVINNNGTIQNIRKTTIISPKLDSNENIFVRELDKTDLSMDKAIHILTLLQEKIEELSTKNHNLTDLTSKIIYECKPNMEINKKPQIVDPIDKQKIIEQVLLQKSEIEKLQKQQIELISILSNQQIIVPPDIDQSVISANPNKLISNSEQDILNTQKINNKMFSHFSGQQFINVNPMSMNNDGRLFMQNNMYMTPEDLEYQNSNNFLLDNAIRNQMVHMKTPVNENIIYNSSSNVNKDFVSIDSSMRFKCKKEVPNIGDATRAYSDVSNPYINDRLEYFDRNIYHQLHYLNNDQIPENDLHCKINPVSSVPNIQERIADFKTPETNLSQQMYSQKYPYFYQIPYQNRRGEQLINFRCPQSMQNYYDPSMFVIGSQYSNPEEQLGNMRKEQLLYDHNTVDDIKLTEINYKEKQLQPDPSLFSVNTNFAAPENPNNCSINQKSLEKPTETCINIQMNPLEEKIKDVFNNR 1467          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000046166.1 (SMESG000046166.1)

HSP 1 Score: 531.561 bits (1368), Expect = 1.324e-165
Identity = 254/488 (52.05%), Postives = 343/488 (70.29%), Query Frame = 3
Query:  585 AIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKG-------LPVEVELNYDNISDRTEVIDRFIANI--PNC---TKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLVANKTAKLTEGEMESGDDQDEGMNSFTIISQYKGMWTKAKRALDKEMVAYR 2012
            AI +S CGRWVKF   +GEGGYK V++GYD E+ KNVAWCEFK  HVDTKEK+ ++ +E EIM+KM+H +IV C+DV  E+    +    I+ K I++IQEL+GEGTLK++IKKNF+ G  IL+F LI  W+HQI+DAL YMH K +PPIIHRDLKADNCFL  ++ D+YLNVKVGDFGLAT V    R TMLGT+GFMAPE++DEKYD  VDIYAFGMLMLEV+TNRTP+D+C+T++QVA  T+SG+ P +  +V D W RE+I+ CIHPL  +RPTA EL +HP+F P         LPVE+  N D  +DR  +I  FI NI   N    TK NLR+ FR+K++ +  GLD+ ESLEFDLD++K  D+D+P+LI NL+ EYE+ L       K  D  +++  L+K F S++LQM+ ++K LLG+RW  IL+ L++           ++  D  + +  F++++ YK  W KA + L+ E++ Y+
Sbjct:  132 AIGRSVCGRWVKFRQSLGEGGYKTVFKGYDSEKGKNVAWCEFKPHHVDTKEKQVNIMKEIEIMVKMDHPNIVICYDVFDEYIDLRNLNNPINIKSIILIQELLGEGTLKSVIKKNFINGELILEFSLILYWFHQIIDALAYMHEKLNPPIIHRDLKADNCFLESKSSDKYLNVKVGDFGLATQVSNKERNTMLGTVGFMAPEVYDEKYDIKVDIYAFGMLMLEVLTNRTPYDDCETVMQVAKHTMSGRLPDIFTLVSDPWTREMISCCIHPLPIYRPTAMELLYHPLFIPSYKYKSKNILPVEITPNSDKCTDRETIIKDFIENIVMDNSVFQTKFNLRMEFRNKKIQRSFGLDESESLEFDLDVFK--DEDVPELISNLKSEYEENLREELIANKSSDAKSVNTQLEKFFKSMELQMKFIMKMLLGKRWHFILEGLLSK----------QNDTDVKDDITGFSLLANYKKNWLKATKQLENEILNYQ 607          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000046166.1 (SMESG000046166.1)

HSP 1 Score: 530.406 bits (1365), Expect = 2.018e-165
Identity = 254/488 (52.05%), Postives = 343/488 (70.29%), Query Frame = 3
Query:  585 AIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKG-------LPVEVELNYDNISDRTEVIDRFIANI--PNC---TKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLVANKTAKLTEGEMESGDDQDEGMNSFTIISQYKGMWTKAKRALDKEMVAYR 2012
            AI +S CGRWVKF   +GEGGYK V++GYD E+ KNVAWCEFK  HVDTKEK+ ++ +E EIM+KM+H +IV C+DV  E+    +    I+ K I++IQEL+GEGTLK++IKKNF+ G  IL+F LI  W+HQI+DAL YMH K +PPIIHRDLKADNCFL  ++ D+YLNVKVGDFGLAT V    R TMLGT+GFMAPE++DEKYD  VDIYAFGMLMLEV+TNRTP+D+C+T++QVA  T+SG+ P +  +V D W RE+I+ CIHPL  +RPTA EL +HP+F P         LPVE+  N D  +DR  +I  FI NI   N    TK NLR+ FR+K++ +  GLD+ ESLEFDLD++K  D+D+P+LI NL+ EYE+ L       K  D  +++  L+K F S++LQM+ ++K LLG+RW  IL+ L++           ++  D  + +  F++++ YK  W KA + L+ E++ Y+
Sbjct:  118 AIGRSVCGRWVKFRQSLGEGGYKTVFKGYDSEKGKNVAWCEFKPHHVDTKEKQVNIMKEIEIMVKMDHPNIVICYDVFDEYIDLRNLNNPINIKSIILIQELLGEGTLKSVIKKNFINGELILEFSLILYWFHQIIDALAYMHEKLNPPIIHRDLKADNCFLESKSSDKYLNVKVGDFGLATQVSNKERNTMLGTVGFMAPEVYDEKYDIKVDIYAFGMLMLEVLTNRTPYDDCETVMQVAKHTMSGRLPDIFTLVSDPWTREMISCCIHPLPIYRPTAMELLYHPLFIPSYKYKSKNILPVEITPNSDKCTDRETIIKDFIENIVMDNSVFQTKFNLRMEFRNKKIQRSFGLDESESLEFDLDVFK--DEDVPELISNLKSEYEENLREELIANKSSDAKSVNTQLEKFFKSMELQMKFIMKMLLGKRWHFILEGLLSK----------QNDTDVKDDITGFSLLANYKKNWLKATKQLENEILNYQ 593          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000046166.1 (SMESG000046166.1)

HSP 1 Score: 530.791 bits (1366), Expect = 5.281e-165
Identity = 254/488 (52.05%), Postives = 343/488 (70.29%), Query Frame = 3
Query:  585 AIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKG-------LPVEVELNYDNISDRTEVIDRFIANI--PNC---TKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLVANKTAKLTEGEMESGDDQDEGMNSFTIISQYKGMWTKAKRALDKEMVAYR 2012
            AI +S CGRWVKF   +GEGGYK V++GYD E+ KNVAWCEFK  HVDTKEK+ ++ +E EIM+KM+H +IV C+DV  E+    +    I+ K I++IQEL+GEGTLK++IKKNF+ G  IL+F LI  W+HQI+DAL YMH K +PPIIHRDLKADNCFL  ++ D+YLNVKVGDFGLAT V    R TMLGT+GFMAPE++DEKYD  VDIYAFGMLMLEV+TNRTP+D+C+T++QVA  T+SG+ P +  +V D W RE+I+ CIHPL  +RPTA EL +HP+F P         LPVE+  N D  +DR  +I  FI NI   N    TK NLR+ FR+K++ +  GLD+ ESLEFDLD++K  D+D+P+LI NL+ EYE+ L       K  D  +++  L+K F S++LQM+ ++K LLG+RW  IL+ L++           ++  D  + +  F++++ YK  W KA + L+ E++ Y+
Sbjct:  166 AIGRSVCGRWVKFRQSLGEGGYKTVFKGYDSEKGKNVAWCEFKPHHVDTKEKQVNIMKEIEIMVKMDHPNIVICYDVFDEYIDLRNLNNPINIKSIILIQELLGEGTLKSVIKKNFINGELILEFSLILYWFHQIIDALAYMHEKLNPPIIHRDLKADNCFLESKSSDKYLNVKVGDFGLATQVSNKERNTMLGTVGFMAPEVYDEKYDIKVDIYAFGMLMLEVLTNRTPYDDCETVMQVAKHTMSGRLPDIFTLVSDPWTREMISCCIHPLPIYRPTAMELLYHPLFIPSYKYKSKNILPVEITPNSDKCTDRETIIKDFIENIVMDNSVFQTKFNLRMEFRNKKIQRSFGLDESESLEFDLDVFK--DEDVPELISNLKSEYEENLREELIANKSSDAKSVNTQLEKFFKSMELQMKFIMKMLLGKRWHFILEGLLSK----------QNDTDVKDDITGFSLLANYKKNWLKATKQLENEILNYQ 641          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000070879.1 (SMESG000070879.1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.455e-121
Identity = 231/555 (41.62%), Postives = 343/555 (61.80%), Query Frame = 3
Query:  555 YQIEQEAKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQ--TIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHV-HTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIP---NCTK------INLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIP--DLIQNLRLEYEDKLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLV-------------ANKTAKLTEGEMESGDDQDEGMNSFTIISQYKGMWTKAKRALDKEMVAYRDNSLKDANVSHVENNFHIDGKLSTNNELIQPEIESLENVILE 2138
            +Q+E++A+ R IA+SKC R++K++ KIGEGGYK VY+G+D +   +VAWCE KR+H D KEK+QSMF+E EIMLK++H ++V+CF+VL+ W +  D    T  + KG+VI+QELM EGTLK +IKKNF +G CIL   LIT+WW+QILD LRYMH +  PPIIHRDLK++NCFL  Q +D+ ++VK+GDFGLAT + H S R TM+GT+GFMAPE+++EKYD  VDIYAFG+LMLEVMTN+TP+D+C  + QV +K++    P VI  +    ++EII SC+HP+ C+RPTAEEL  HP+FQ    PV VE   D+        ++FIA +    N +K      ++L++  + + +  +      E++    DIYK+   ++   DL     LE E + S   +N            LDKL  SI+LQ+Q ++K ++G RWR I D+ +              N  A+ T       ++  +  N+    +    M+ K  + L+ E+ +Y     +++ + +  + F +   + TNNE    E +S+  + +E
Sbjct:  120 FQLEEKARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIKEIIMSCVHPIPCYRPTAEELCEHPLFQ--IAPVIVEPFSDD-------ANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNN-----------QLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEETNVNENDNNENPKLTNNLEEYNFNVSMYHKTTKVLNSEIESY----CQESQIKYFSDIFKLINSIKTNNE----EADSINKISIE 646          
The following BLAST results are available for this feature:
BLAST of Protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNK11.006e-5936.86WNK lysine deficient protein kinase 1 [Source:HGNC... [more]
WNK11.079e-5936.86WNK lysine deficient protein kinase 1 [Source:HGNC... [more]
WNK11.081e-5936.86WNK lysine deficient protein kinase 1 [Source:HGNC... [more]
WNK11.127e-5936.86WNK lysine deficient protein kinase 1 [Source:HGNC... [more]
WNK13.808e-5937.33WNK lysine deficient protein kinase 1 [Source:HGNC... [more]
back to top
BLAST of Protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnk-18.239e-5634.72Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-18.239e-5634.72Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-18.605e-5634.72Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-18.841e-5634.72Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-18.841e-5634.72Serine/threonine-protein kinase WNK [Source:UniPr... [more]
back to top
BLAST of Protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnk4.953e-5537.36gene:FBgn0037098 transcript:FBtr0346819[more]
Wnk4.953e-5537.36gene:FBgn0037098 transcript:FBtr0346817[more]
Wnk5.825e-5537.36gene:FBgn0037098 transcript:FBtr0347540[more]
Wnk6.003e-5537.36gene:FBgn0037098 transcript:FBtr0346818[more]
Madm5.677e-2127.57gene:FBgn0027497 transcript:FBtr0347493[more]
back to top
BLAST of Protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-151g10.36.149e-6140.00si:dkey-151g10.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
CU041388.29.029e-6140.00pep chromosome:GRCz11:CHR_ALT_CTG23_1_26:25152826:... [more]
si:dkey-151g10.31.339e-6033.95si:dkey-151g10.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
wnk1b4.816e-5937.84WNK lysine deficient protein kinase 1b [Source:ZFI... [more]
BX321885.14.856e-5937.84WNK lysine deficient protein kinase 1b [Source:NCB... [more]
back to top
BLAST of Protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNK32.980e-5937.33WNK lysine deficient protein kinase 3 [Source:HGNC... [more]
WNK33.590e-5937.33WNK lysine deficient protein kinase 3 [Source:HGNC... [more]
WNK16.234e-5235.71LIM domain transcription factor LMO4.1 [Source:Un... [more]
gna131.098e-4536.01guanine nucleotide binding protein (G protein), al... [more]
gna138.239e-4336.13guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnk33.418e-6036.71WNK lysine deficient protein kinase 3 [Source:MGI ... [more]
Wnk16.896e-6036.86WNK lysine deficient protein kinase 1 [Source:MGI ... [more]
Wnk17.392e-6036.86WNK lysine deficient protein kinase 1 [Source:MGI ... [more]
Wnk17.408e-6036.86WNK lysine deficient protein kinase 1 [Source:MGI ... [more]
Wnk14.775e-5937.33WNK lysine deficient protein kinase 1 [Source:MGI ... [more]
back to top
BLAST of Protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6R2V0|WNK1_PIG4.822e-5936.86Serine/threonine-protein kinase WNK1 OS=Sus scrofa... [more]
sp|P83741|WNK1_MOUSE4.823e-5936.86Serine/threonine-protein kinase WNK1 OS=Mus muscul... [more]
sp|Q9H4A3|WNK1_HUMAN4.831e-5936.86Serine/threonine-protein kinase WNK1 OS=Homo sapie... [more]
sp|Q9JIH7|WNK1_RAT2.607e-5837.33Serine/threonine-protein kinase WNK1 OS=Rattus nor... [more]
sp|Q80XP9|WNK3_MOUSE5.591e-5736.71Serine/threonine-protein kinase WNK3 OS=Mus muscul... [more]
back to top
BLAST of Protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M6430.000e+073.00Protein kinase domain-containing protein OS=Opisth... [more]
A0A4S2M6820.000e+071.71Protein kinase domain-containing protein OS=Opisth... [more]
A0A4E0RDF50.000e+071.57Serine:threonine protein kinase WNK1 OS=Fasciola h... [more]
G4VAJ80.000e+072.20Protein kinase OS=Schistosoma mansoni OX=6183 GN=S... [more]
A0A430QPZ30.000e+071.54WNK lysine deficient protein kinase OS=Schistosoma... [more]
back to top
BLAST of Protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnk4b2.961e-6238.34serine/threonine-protein kinase WNK4-like [Source:... [more]
ENSAMXT00000001896.26.315e-5938.56serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
ENSAMXT00000050296.16.795e-5938.56serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
ENSAMXT00000052131.18.231e-5938.56serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
ENSAMXT00000041214.18.908e-5938.56serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
back to top
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001965.13.230e-4235.62pep scaffold:Pmarinus_7.0:GL477178:11064:57293:1 g... [more]
ENSPMAT00000001973.12.995e-4135.62pep scaffold:Pmarinus_7.0:GL477178:11064:57290:1 g... [more]
nrbp19.600e-2329.10nuclear receptor binding protein 1 [Source:ZFIN;Ac... [more]
nrbp13.564e-2128.25nuclear receptor binding protein 1 [Source:ZFIN;Ac... [more]
nrbp13.653e-2128.62nuclear receptor binding protein 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC58.549e-1926.43Polo-like kinase; controls targeting and activatio... [more]
STE202.134e-1827.27Cdc42p-activated signal transducing kinase; involv... [more]
BCK15.215e-1825.09MAPKKK acting in the protein kinase C signaling pa... [more]
SNF11.856e-1626.50AMP-activated S/T protein kinase; forms a complex ... [more]
CLA46.057e-1629.00Cdc42p-activated signal transducing kinase; member... [more]
back to top
BLAST of Protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO374131.096e-2231.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361501.781e-2125.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361101.573e-1929.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413991.227e-1725.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331291.953e-1725.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnk4b3.341e-5937.87WNK lysine deficient protein kinase 4 [Source:NCBI... [more]
wnk4b3.504e-5937.87WNK lysine deficient protein kinase 4 [Source:NCBI... [more]
ENSORLT00000027269.13.541e-5937.19pep primary_assembly:ASM223467v1:8:129429:156272:1... [more]
wnk1b1.590e-5838.04serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
wnk1b1.689e-5838.04serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
back to top
BLAST of Protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080382.10.000e+099.45SMESG000080382.1[more]
SMESG000046166.11.324e-16552.05SMESG000046166.1[more]
SMESG000046166.12.018e-16552.05SMESG000046166.1[more]
SMESG000046166.15.281e-16552.05SMESG000046166.1[more]
SMESG000070879.11.455e-12141.62SMESG000070879.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004241 ID=SMED30004241|Name=Protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=4557bp
TTATGATAACCAAAAGTGTTTAATTTACATTTATTAATAATATAATTTAT
TGTAATATGATTTCTGAAAATCAAAATGAAAATGATAGCAAAAAATCAAT
TCTTAAGAAATCAGAAGGAAAACCTATTAAAAAGGTTGTATCGATTTTTA
TCAATGATGTGGGGATGACTAATAATACGATTTCTGATAATACTGAATTT
GAGTATAATCAAAAAGATCCTCCTATGTTTGTTTCTGAAGCTATTTTTCC
TTATACTTATGAATTAGAACAAATTAAATATTGTAATCGGTGTACTTCTC
CGGATCATAAATTTTCGATGGAAGAGTTTCTAAATAATCTTGATAATAAA
CTCGACGTTGCAAAAGTAAATGATACTGAAATAGTTGAAGAAATGATAAA
TAATGGTAAAGCTAGACATGTGAATTGTAATACGTTATATTCAAACGATG
TTACCTCTTTGCATAATGCTACTGTTAGTCAGGATAAAAAGAAAACAAAA
GAAGAAAGAAAAAAAGAGCGCGAAAAGAAAAAAGAAGAGGAAATGTTAAA
AAAATATCAAATTGAGCAAGAAGCAAAGCATAGAGCAATTGCGAAGTCAA
AATGTGGTCGATGGGTAAAGTTTAACATTAAAATTGGTGAAGGGGGGTAT
AAATTTGTTTATAGAGGTTATGATGTAGAAGAAGCCAAAAATGTCGCTTG
GTGTGAATTTAAAAGGGAACATGTAGATACTAAAGAAAAACGGCAATCGA
TGTTTAGAGAAACTGAAATTATGCTAAAAATGAATCATTCACATATAGTA
AGATGTTTTGATGTTTTAAGAGAATGGCATGTTTACGAAGACCCACAAAC
AATTATCGATGAAAAAGGAATTGTAATTATACAAGAATTAATGGGCGAAG
GTACTTTAAAAAATATTATCAAAAAAAATTTTTTGGAAGGTCATTGCATT
TTAAAATTTCCACTGATTACACGATGGTGGCATCAAATATTAGATGCACT
TCGCTATATGCATTTAAAATGTGACCCTCCTATAATTCACAGAGATTTAA
AGGCTGACAATTGTTTTCTATATGGTCAAACCGATGATGAATATCTTAAC
GTAAAAGTAGGCGATTTTGGATTAGCTACTCATGTTCATACAAGTGGCAG
AAAAACAATGCTAGGTACCCTTGGTTTTATGGCTCCAGAAATTTTTGATG
AGAAATATGATGAAAGTGTTGATATCTATGCATTTGGAATGTTGATGCTA
GAAGTAATGACTAATAGAACCCCTTTTGATGAATGTGATACAATTGTTCA
AGTAGCGGCAAAAACATTGAGTGGCAAAGGCCCAAAAGTCATTGAAATGG
TTTTGGATAAATGGCTACGAGAAATAATAAATTCCTGCATACATCCTCTT
TCTTGTTTCCGACCAACAGCCGAAGAATTATTTTTCCATCCAATTTTTCA
ACCTAAAGGGCTTCCTGTTGAAGTCGAGCTAAATTATGACAATATTTCAG
ACAGAACAGAAGTTATTGATCGTTTTATTGCCAATATTCCTAATTGCACT
AAAATTAATTTAAGATTGAGATTTAGAGATAAAAGAATGCTCCAGGAGTT
GGGATTAGATGACGGGGAGTCTTTAGAGTTCGACTTAGATATTTATAAAG
CCGAAGATCAAGACATTCCAGATCTCATTCAAAATTTAAGATTAGAATAC
GAAGACAAATTATCAAGAGTTTACGATAATCCAAAGATATTGGATAAAAG
TACAATTAGTGCTCACTTGGACAAACTTTTCTTGAGTATTAAATTGCAAA
TGCAGTGCTTGGTTAAACATCTCCTTGGAAGACGGTGGAGAGATATTTTA
GATTCATTGGTGGCTAATAAAACGGCAAAGTTGACAGAAGGAGAGATGGA
ATCCGGTGATGATCAGGATGAAGGTATGAATAGTTTCACTATAATTAGCC
AATACAAAGGAATGTGGACTAAAGCTAAACGAGCATTGGATAAGGAAATG
GTAGCCTATAGAGACAATTCTTTAAAAGATGCAAATGTTTCTCATGTCGA
GAATAATTTTCATATTGACGGAAAACTCTCAACTAACAATGAATTGATCC
AGCCTGAAATTGAATCCTTAGAAAATGTTATTTTAGAGAAACCTCTTATA
GAAAACCCTACTTATGTTAAAGCAATTTCACAATCACCTGTTGAAGGGTC
AATTAGTTATTTAAATTCTTTTACTGATTCTGAACAAATGGATAACCCCA
ATTTAATTCAAGGAAGTGTATTTAATCAAGATACTTTGCAAATAACATCA
GTTCAAGGACCATCTTTAACAGCAACAACCGGTTCTAACACAATTACAAT
GTTTGATAGTCGTGATTTATACAAAGAGACAACCCCAGTGGATATCATAA
CCATGAATAAAGATAGTCAATGTGAAACTGATAGTCAAAAAAATATTTTA
AATGGATCATATAATGTGAAAGTTCAAAATATAGAGTTTAATACTCACTC
TAATTTAATCTGCGTAACATTTAATGTTGAAATTCCTGATTTTTCTAATT
CTGAAAGTGGAAAATGGGTGTTATGTTTCAAATGTGTGATAAATGAAAAT
ACTTCTATTATTGATAATTTAGAGCTGAATACATCGGACGATTTAGCAGG
TAAAATTGATAATGATATTCAATTAGCTCTGCGGGAAACTCTTTTATGCA
TTTTGAAAATGATTCAAAATGATAAAAAAAGTGTTTTAATCAATCAAAAT
TTTATTTTCTACCCGATAATGGAAAAAATGTTTTTAGAACCACTGACAGA
AACAAATGGTTGTAAAGCGAGTATTCGAAATACTGTTGCAACCCATGATA
TTATTGTTCCCGAGGATTTTTGTATCGAAGCTAACACCGTAAAGTCGAAT
GAGCATAAAACTATTTCAGTGGATCATTCTAACATTGACAGTAATATCAA
TTTAGACTCATTGTTCGATCAAGAAAATACTATTTTGCTAACAAAGCGAT
TTGAAGATGAGAAATACATCGTGAAAGCATTTAGTATCCCCTGCGGAAGT
GCCGTTGTTATCAACAACAATGGCACTATTCAAAATATTAGAAAAACTAC
TATAATATCCCCAAAATTGGATTCTAATGAGAATATTTTTGTTCGAGAAT
TAGATAAGACGGATTTATCAATGGATAAGGCAATACATATTCTAACGTTA
TTACAGGAGAAAATTGAAGAATTATCAACTAAAAATCACAATCTAACCGA
TTTAACTTCAAAGATAATTTATGAATGTAAACCCAATATGGAAATCAACA
AAAAACCTCAAATAGTAGATCCGATCGATAAACAAAAAATAATTGAACAG
GTTTTGTTACAAAAATCGGAAATAGAAAAATTGCAGAAACAACAGATTGA
ACTGATTTCCATATTATCAAATCAGCAAATAATAGTCCCTCCGGATATAG
ATCAAAGTGTAATTTCAGCTAATCCAAATAAGTTAATATCAAATTCAGAA
CAAGATATTTTAAATACACAAAAAATAAATAATAAAATGTTTTCACACTT
TTCCGGTCAGCAATTTATCAATGTTAATCCGATGTCAATGAATAATGATG
GTAGATTATTTATGCAGAATAATATGTATATGACTCCAGAAGATTTAGAA
TATCAAAATTCTAATAATTTCTTATTGGATAATGCCATTCGTAACCAAAT
GGTGCACATGAAAACACCAGTCAACGAAAATATTATTTACAATTCTAGTT
CAAATGTCAACAAAGACTTTGTATCCATTGATAGCAGTATGCGCTTCAAA
TGCAAGAAAGATGTACCGAATATAGGCGATGCAACCAGAGCTTATAGTGA
CGTTTCAAATCCTTACACAAATGATAGATTGGAGTATTTTGACCGAAATA
TCTATCATCAATTGCATTATCTAAATAATGATCAAATCCCAGAAAATGAC
CTTCATTGTAAAATTAACCCGGTGTCGAGTGTTCCTAACATTCAAGAGCG
TATTGCAGACTTTAAAACCCCTGAAACTAATTTATCTCAACAAATGTATT
CACAGAAATATCCATATTTCTATCAAATTCCTTATCAAAACAGGAGAGGT
GAACAGCTTATCAATTTTAGATGTCCTCAGTCGATGCAGAATTACTATGA
TCCGTCAATGTTTGTCATAGGTTCCCAGTATTCAAATCCAGAGGAACAAC
TCGGAAATATGAGAAAAGAGCAACTATTGTATGATCACAATACAGTAGAC
GATATTAAGCTAACTGAAATTAATTACAAAGAAAAACAATTGCAACCGGA
TCCCAGCCTATTTTCTGTAAATACAAATTTTGCTGCACCAGAAAACCCTA
ACAATTGCAGTATTAACCAAAAATCATTAGAAAAACCGACTGAAACATGT
ATAAATATTCAAATGAACCCACTGGAAGAAAAAATAAAAGATGTATTTAA
CAATCGTTAACATTTTGTTGATTTCAAAAATATATTTTCTATGAATTTCA
TTCATTTATGTTTTAGTTTAAAAATATTGATAAATTGCCCATACGATTTC
TTTGTTG
back to top

protein sequence of SMED30004241-orf-1

>SMED30004241-orf-1 ID=SMED30004241-orf-1|Name=SMED30004241-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1468bp
MISENQNENDSKKSILKKSEGKPIKKVVSIFINDVGMTNNTISDNTEFEY
NQKDPPMFVSEAIFPYTYELEQIKYCNRCTSPDHKFSMEEFLNNLDNKLD
VAKVNDTEIVEEMINNGKARHVNCNTLYSNDVTSLHNATVSQDKKKTKEE
RKKEREKKKEEEMLKKYQIEQEAKHRAIAKSKCGRWVKFNIKIGEGGYKF
VYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRC
FDVLREWHVYEDPQTIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILK
FPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVK
VGDFGLATHVHTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEV
MTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSC
FRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPNCTKI
NLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYED
KLSRVYDNPKILDKSTISAHLDKLFLSIKLQMQCLVKHLLGRRWRDILDS
LVANKTAKLTEGEMESGDDQDEGMNSFTIISQYKGMWTKAKRALDKEMVA
YRDNSLKDANVSHVENNFHIDGKLSTNNELIQPEIESLENVILEKPLIEN
PTYVKAISQSPVEGSISYLNSFTDSEQMDNPNLIQGSVFNQDTLQITSVQ
GPSLTATTGSNTITMFDSRDLYKETTPVDIITMNKDSQCETDSQKNILNG
SYNVKVQNIEFNTHSNLICVTFNVEIPDFSNSESGKWVLCFKCVINENTS
IIDNLELNTSDDLAGKIDNDIQLALRETLLCILKMIQNDKKSVLINQNFI
FYPIMEKMFLEPLTETNGCKASIRNTVATHDIIVPEDFCIEANTVKSNEH
KTISVDHSNIDSNINLDSLFDQENTILLTKRFEDEKYIVKAFSIPCGSAV
VINNNGTIQNIRKTTIISPKLDSNENIFVRELDKTDLSMDKAIHILTLLQ
EKIEELSTKNHNLTDLTSKIIYECKPNMEINKKPQIVDPIDKQKIIEQVL
LQKSEIEKLQKQQIELISILSNQQIIVPPDIDQSVISANPNKLISNSEQD
ILNTQKINNKMFSHFSGQQFINVNPMSMNNDGRLFMQNNMYMTPEDLEYQ
NSNNFLLDNAIRNQMVHMKTPVNENIIYNSSSNVNKDFVSIDSSMRFKCK
KDVPNIGDATRAYSDVSNPYTNDRLEYFDRNIYHQLHYLNNDQIPENDLH
CKINPVSSVPNIQERIADFKTPETNLSQQMYSQKYPYFYQIPYQNRRGEQ
LINFRCPQSMQNYYDPSMFVIGSQYSNPEEQLGNMRKEQLLYDHNTVDDI
KLTEINYKEKQLQPDPSLFSVNTNFAAPENPNNCSINQKSLEKPTETCIN
IQMNPLEEKIKDVFNNR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 137..170
NoneNo IPR availableCOILSCoilCoilcoord: 1039..1066
NoneNo IPR availableCOILSCoilCoilcoord: 1092..1112
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 279..466
e-value: 2.2E-42
score: 146.6
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 175..277
e-value: 8.0E-21
score: 75.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 141..161
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 138..161
NoneNo IPR availablePANTHERPTHR13902SERINE/THREONINE-PROTEIN KINASE WNK WITH NO LYSINE -RELATEDcoord: 169..484
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 187..464
e-value: 6.8E-43
score: 158.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 191..464
e-value: 8.2E-46
score: 156.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 187..464
score: 37.347
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 326..338
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 192..710