SMED30004218

Overview
NameSMED30004218
Smed IDSMED30004218
Length (bp)1383
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004218

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30004218h1SMcG0022085 dd_Smed_v4_41293_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30004218h1SMcG0022085 DN314502.1smed_ncbi_20240424PMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30004218h1SMcG0022085 HO006595.1smed_ncbi_20240424PMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30004218 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001030:76852..78177 +6612
Homology
BLAST of SMED30004218 vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 230.72 bits (587), Expect = 1.503e-70
Identity = 141/395 (35.70%), Postives = 219/395 (55.44%), Query Frame = -2
Query:  141 ELLIDFTLAALEIKPANLIEFSANYFQNLLTERT------VDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHD------DKRGRRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV--------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELI-----LGNM 1247
            ELL  +T+  L  +P +L+EF+  YF  L   R          P+ S+     E    +   +  +SE  E +        R  RR ++ +E+++P  +   ++ + +H    KT  +   L+     I +FK L  +++ +V+ AM   IVKA++ +I QGD GD+FYVI+ G +D+ +  K N    +  Y+N+GSFG+LAL+YN+PR+ATI+A + G LW ++R TF+ I++     KR  + +FI SVPL  SL   ER+ I D I  K Y     II QG+     Y IESG+V + +        D GN   +I+  HKGQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+++++RN   YE  L ++      LGN+
Sbjct:   12 ELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHP---KTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILV-TKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNL 402          
BLAST of SMED30004218 vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 230.72 bits (587), Expect = 1.503e-70
Identity = 141/395 (35.70%), Postives = 219/395 (55.44%), Query Frame = -2
Query:  141 ELLIDFTLAALEIKPANLIEFSANYFQNLLTERT------VDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHD------DKRGRRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV--------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELI-----LGNM 1247
            ELL  +T+  L  +P +L+EF+  YF  L   R          P+ S+     E    +   +  +SE  E +        R  RR ++ +E+++P  +   ++ + +H    KT  +   L+     I +FK L  +++ +V+ AM   IVKA++ +I QGD GD+FYVI+ G +D+ +  K N    +  Y+N+GSFG+LAL+YN+PR+ATI+A + G LW ++R TF+ I++     KR  + +FI SVPL  SL   ER+ I D I  K Y     II QG+     Y IESG+V + +        D GN   +I+  HKGQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+++++RN   YE  L ++      LGN+
Sbjct:   12 ELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHP---KTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILV-TKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNL 402          
BLAST of SMED30004218 vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 213.386 bits (542), Expect = 3.510e-64
Identity = 135/387 (34.88%), Postives = 209/387 (54.01%), Query Frame = -2
Query:  141 ELLIDFTLAALEIKPANLIEFSANYFQNLLTERT------VDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHD------DKRGRRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELI-----LGNM 1247
            ELL  +T+  L  +P +L+EF+  YF  L   R          P+ S+     E    +   +  +SE  E +        R  RR ++ +E+++P  +   ++ + +H    KT  +   L+     I +FK L  +++ +V+ AM   IVKA++ +I QGD GD+FYVI+ G +D+ +  K N    +  Y+N+GSFG+LAL+YN+PR+ATI+A + G LW ++R TF+ I++     KR  + +FI SVPL  SL   ER+ I D I  K Y     II Q    K              D GN   +I+  HKGQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+++++RN   YE  L ++      LGN+
Sbjct:   12 ELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHP---KTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILV-TKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQTKSNK--------------DGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNL 380          
BLAST of SMED30004218 vs. Ensembl Human
Match: PRKAR2B (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 208.379 bits (529), Expect = 8.075e-62
Identity = 135/418 (32.30%), Postives = 215/418 (51.44%), Query Frame = -2
Query:  141 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVF--------DRKFESVLRKNRSSIDNSEHLEHDDK----------------------RGRRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV---------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 1274
            S+ +   + ELL  FT+  L  +PA+L+EF+  +F  L  E   +   ++ F        D    +        ++ +E     D                       R  RR ++ +E+++P  +   + ++ +H    KT  +   L+     I +FK L  +++ +V+ AM   +VK  + +I QGD GD+FYVI  G FD+++K        +  Y+N+GSFG+LAL+YN+PR+ATI A + G LW ++R TF+ I++     KR  Y +FI S+P   SL   ERL + D I  K Y+    II QGD     + +ESG+V + +         ++G V  +I+   +GQYFGEL+L+TNKPRAA+   +       ++  +FERLLGPC+E+++RN   YE  L  L   NM
Sbjct:    2 SIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQEN--ERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHP---KTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCD-GVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAV--EIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNM 411          
BLAST of SMED30004218 vs. Ensembl Human
Match: PRKAR2B (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 208.379 bits (529), Expect = 8.075e-62
Identity = 135/418 (32.30%), Postives = 215/418 (51.44%), Query Frame = -2
Query:  141 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVF--------DRKFESVLRKNRSSIDNSEHLEHDDK----------------------RGRRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV---------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 1274
            S+ +   + ELL  FT+  L  +PA+L+EF+  +F  L  E   +   ++ F        D    +        ++ +E     D                       R  RR ++ +E+++P  +   + ++ +H    KT  +   L+     I +FK L  +++ +V+ AM   +VK  + +I QGD GD+FYVI  G FD+++K        +  Y+N+GSFG+LAL+YN+PR+ATI A + G LW ++R TF+ I++     KR  Y +FI S+P   SL   ERL + D I  K Y+    II QGD     + +ESG+V + +         ++G V  +I+   +GQYFGEL+L+TNKPRAA+   +       ++  +FERLLGPC+E+++RN   YE  L  L   NM
Sbjct:    2 SIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQEN--ERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHP---KTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCD-GVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAV--EIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNM 411          
BLAST of SMED30004218 vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 155.992 bits (393), Expect = 4.347e-43
Identity = 105/346 (30.35%), Postives = 169/346 (48.84%), Query Frame = -2
Query:  177 KPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKG--QYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKY 1208
            KP N + F  ++F+ L  +R  +       D     V    RS              G RR  IS+E     D           +  + + E  + K L+     F  L +DE   +  AM  +   A + II+QG+ GD+FYVI  G  DV++ ++Y     + T N  GSFG+LAL+Y +PR+AT+IA+T   LW ++R T++ I++     KR  Y  F+S V +   L   ER ++ADA+    ++  + ++ QG  G   + I  G+  V     +      + H G   YFGE++L+ ++PRAAT++         L+R+ FER++GP  E+L+R+   Y
Sbjct:   37 KPDNPVLFLKDHFEKLNEQRAQEGGNPDAADDDDIIVEPPKRS--------------GGRRTGISAEPIKEDDTEYKKVVIPKDDATRRSLESAMRKNLL-----FAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEY-----VLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNY 358          
BLAST of SMED30004218 vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 154.836 bits (390), Expect = 6.118e-43
Identity = 95/296 (32.09%), Postives = 155/296 (52.36%), Query Frame = -2
Query:  177 LEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKG--QYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKY 1058
            +E   + G RR  IS+E     D           +  + + E  + K L+     F  L +DE   +  AM  +   A + II+QG+ GD+FYVI  G  DV++ ++Y     + T N  GSFG+LAL+Y +PR+AT+IA+T   LW ++R T++ I++     KR  Y  F+S V +   L   ER ++ADA+    ++  + ++ QG  G   + I  G+  V     +      + H G   YFGE++L+ ++PRAAT++         L+R+ FER++GP  E+L+R+   Y
Sbjct:   41 VEPPKRSGGRRTGISAEPIKEDDTEYKKVVIPKDDATRRSLESAMRKNLL-----FAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEY-----VLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNY 326          
BLAST of SMED30004218 vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 155.992 bits (393), Expect = 6.516e-43
Identity = 105/346 (30.35%), Postives = 169/346 (48.84%), Query Frame = -2
Query:  177 KPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKG--QYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKY 1208
            KP N + F  ++F+ L  +R  +       D     V    RS              G RR  IS+E     D           +  + + E  + K L+     F  L +DE   +  AM  +   A + II+QG+ GD+FYVI  G  DV++ ++Y     + T N  GSFG+LAL+Y +PR+AT+IA+T   LW ++R T++ I++     KR  Y  F+S V +   L   ER ++ADA+    ++  + ++ QG  G   + I  G+  V     +      + H G   YFGE++L+ ++PRAAT++         L+R+ FER++GP  E+L+R+   Y
Sbjct:   47 KPDNPVLFLKDHFEKLNEQRAQEGGNPDAADDDDIIVEPPKRS--------------GGRRTGISAEPIKEDDTEYKKVVIPKDDATRRSLESAMRKNLL-----FAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEY-----VLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNY 368          
BLAST of SMED30004218 vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 119.783 bits (299), Expect = 1.178e-28
Identity = 82/284 (28.87%), Postives = 142/284 (50.00%), Query Frame = -2
Query:  216 LEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGV--YVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTV-VGILERSSFERLLG 1058
            L  D  +  ++ A+S+E   P +         H N  KT    ++++  + +    K L  ++I E++  M  +  +A   +IQ+G+PGD  +V+  G   V   ++  AL  +         G+LA+LYN  R+A++ A T   LW ++R  F+ I       +    +NF++ V +F +L+ D    +AD +    YD    IIRQG+ G   + I SG+V V   ++     ++I +L++G +FGE +L+  + R A II     V V  L+R SF +L+G
Sbjct:  115 LPADGVQRAKKIAVSAE---PTNFENKPATLQHYN--KTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQV---SREGAL--LGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIG 388          
BLAST of SMED30004218 vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 119.783 bits (299), Expect = 1.178e-28
Identity = 82/284 (28.87%), Postives = 142/284 (50.00%), Query Frame = -2
Query:  216 LEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGV--YVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTV-VGILERSSFERLLG 1058
            L  D  +  ++ A+S+E   P +         H N  KT    ++++  + +    K L  ++I E++  M  +  +A   +IQ+G+PGD  +V+  G   V   ++  AL  +         G+LA+LYN  R+A++ A T   LW ++R  F+ I       +    +NF++ V +F +L+ D    +AD +    YD    IIRQG+ G   + I SG+V V   ++     ++I +L++G +FGE +L+  + R A II     V V  L+R SF +L+G
Sbjct:  115 LPADGVQRAKKIAVSAE---PTNFENKPATLQHYN--KTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQV---SREGAL--LGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIG 388          
BLAST of SMED30004218 vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0088437)

HSP 1 Score: 257.299 bits (656), Expect = 1.745e-81
Identity = 145/388 (37.37%), Postives = 233/388 (60.05%), Query Frame = -2
Query:  135 MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTV-VGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQN 1295
            MS    + + +  E++E+L+ F+++ L  +P ++I+++  YF  L +ER    P  S  D+  +  L  N    D    +        RR ++ +E++ P   +  +     +   KT  +   L   +  + +F++L  +++++V+ AM    V+  D II+QGD GD+FYVI+SG++ V+I +K     HINTYN+ G FG+LALLYN PR+AT+ A T+G+LW M+R+TF+ I++  A  KR  Y   ++SVP+  +L N ER+++ADA+  K+YD    II+QGD    MYFIE G V V +D  +   +IS L KGQYFGEL+L+T++PRAA++      V +  L+  +FERLLGPC+++++RN   YE  L + I G+  N
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSER----PSVSHTDQSTDDQLSVNSQDADAEPPV----MASSRRKSVFAEAYDPE--ADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDK-----HINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVK-IFGSKNN 372          
BLAST of SMED30004218 vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0088438)

HSP 1 Score: 257.299 bits (656), Expect = 1.745e-81
Identity = 145/388 (37.37%), Postives = 233/388 (60.05%), Query Frame = -2
Query:  135 MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTV-VGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQN 1295
            MS    + + +  E++E+L+ F+++ L  +P ++I+++  YF  L +ER    P  S  D+  +  L  N    D    +        RR ++ +E++ P   +  +     +   KT  +   L   +  + +F++L  +++++V+ AM    V+  D II+QGD GD+FYVI+SG++ V+I +K     HINTYN+ G FG+LALLYN PR+AT+ A T+G+LW M+R+TF+ I++  A  KR  Y   ++SVP+  +L N ER+++ADA+  K+YD    II+QGD    MYFIE G V V +D  +   +IS L KGQYFGEL+L+T++PRAA++      V +  L+  +FERLLGPC+++++RN   YE  L + I G+  N
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSER----PSVSHTDQSTDDQLSVNSQDADAEPPV----MASSRRKSVFAEAYDPE--ADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDK-----HINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVK-IFGSKNN 372          
BLAST of SMED30004218 vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0112901)

HSP 1 Score: 246.514 bits (628), Expect = 2.690e-77
Identity = 140/375 (37.33%), Postives = 225/375 (60.00%), Query Frame = -2
Query:  174 MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTV-VGILERSSFERLLGPCIEVLQRNALKYE 1295
            MS    + + +  E++E+L+ F+++ L  +P ++I+++  YF  L +ER    P  S  D+  +  L  N    D     E       RR ++ +E++ P   +  +     +   KT  +   L   +  + +F++L  +++++V+ AM    V+  D II+QGD GD+FYVI+SG++ V+I +K     HINTYN+ G FG+LALLYN PR+AT+ A T+G+LW M+R+TF+ I++  A  KR  Y   ++SVP+  +L N ER+++ADA+  K+YD    II+QGD    MYFIE G V V +D  +   +IS L KGQYFGEL+L+T++PRAA++      V +  L+  +FER++G   +VL+RN + YE
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSER----PSVSHTDQSTDDQLSVNSQDAD----AEPPVMASSRRKSVFAEAYDPE--ADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDK-----HINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDTEAFERIMGFLTDVLKRNIVIYE 360          
BLAST of SMED30004218 vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0112902)

HSP 1 Score: 243.817 bits (621), Expect = 2.583e-76
Identity = 144/391 (36.83%), Postives = 228/391 (58.31%), Query Frame = -2
Query:  132 MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTV-VGILERSSFERLLGPCIEVLQRNALKYEVSLQEL--ILGNMQNN 1295
            MS    + + +  E++E+L+ F+++ L  +P ++I+++  YF  L +ER    P  S  D+  +  L  N    D     E       RR ++ +E++ P   +  +     +   KT  +   L   +  + +F++L  +++++V+ AM    V+  D II+QGD GD+FYVI+SG++ V+I +K     HINTYN+ G FG+LALLYN PR+AT+ A T+G+LW M+R+TF+ I++  A  KR  Y   ++SVP+  +L N ER+++ADA+  K+YD    II+QGD    MYFIE G V V +D  +   +IS L KGQYFGEL+L+T++PRAA++      V +  L+   FERL+G C   +QR+   Y    Q+L    GN+  N
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSER----PSVSHTDQSTDDQLSVNSQDAD----AEPPVMASSRRKSVFAEAYDPE--ADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDK-----HINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVICFERLMGKCSGGIQRSISGYRYLEQDLREYFGNLPLN 376          
BLAST of SMED30004218 vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0302643)

HSP 1 Score: 175.637 bits (444), Expect = 3.279e-50
Identity = 117/367 (31.88%), Postives = 190/367 (51.77%), Query Frame = -2
Query:  177 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERT-VDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRG----RRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVY---VDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKY 1253
            I+ +L D  +     +P N ++F   YFQ L  E+  +D  +  +              S D+ E L    +      RRR  IS+E  +  D + +  K++     KT   +  L + I++  +F  L + E  ++  AM  +   A + IIQQGD GD+FYVI  G  DVF+ +     E + T +  GSFG+LAL+Y +PR+AT+ A+T   LW ++R +++ I++     KR  Y  F+S V + +SL   ERL +AD++   ++D    I++QG  G   Y I  G   V     + G    ++  L    YFGE++L+ ++PRAAT++         L+R+ FER+LGPC ++L+RN  +Y
Sbjct:   26 IQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQVKLDASRQVI--------------SPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEED-ATNYVKKVVPKDYKT---MNALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNS-----ELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSEQGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRNITQY 369          
BLAST of SMED30004218 vs. Ensembl Zebrafish
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 229.565 bits (584), Expect = 2.218e-70
Identity = 134/388 (34.54%), Postives = 212/388 (54.64%), Query Frame = -2
Query:  165 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVP--------KSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGR--RRFAISSESWSPYDISV-SNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDS-------GNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSL 1274
            S+ + + + ELL  +T+  L  +P +L+EF+  YF  L   R+ D          K  +FD +            ++ +         R  RR ++ +E+++P D    S  + +H  T +       L+     I +FK L  ++  EV+ AM  ++V+ +D +I QGD GD+FYVI+ G++D+ ++ K      +  YNN+GSFG+LAL+YN+PR+ATIIA+  G LW ++R TF+ +++     KR  Y  FI S+PL  SL   ER+ I D + +KT+     II QGD     Y +ESG+V + + S        N   +I+   +GQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC E+++RN   YE  L
Sbjct:    2 SIEIPVGLTELLQGYTVEVLRQRPPDLVEFAVQYFTRLRDTRSQDGSGAAAKTGGKGVMFDGEPMQTESNGDEDDEDDDSDFEPPPPSRFNRRVSVCAEAFNPDDDEEDSEPRVVHPKTDEQRCR---LQEACKDILLFKALDQEQFSEVLDAMFEVLVQPQDHVIDQGDDGDNFYVIERGVYDIVVQ-KDGVGCCVGQYNNKGSFGELALMYNTPRAATIIAKDEGALWGLDRATFRRLIVKNNAKKRRMYECFIESIPLLKSLELSERMKIVDVLGVKTFQDGERIIMQGDKADCFYIVESGEVKIMMKSKTKADRQDNAEVEIARCSRGQYFGELALVTNKPRAASAYAIGDVKCLVIDIQAFERLLGPCKEIMKRNIAHYEEQL 385          
BLAST of SMED30004218 vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 222.631 bits (566), Expect = 6.487e-68
Identity = 127/373 (34.05%), Postives = 201/373 (53.89%), Query Frame = -2
Query:  165 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRR----------FAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSL 1253
            + ELL  FT+  L  +PA+L+EF+  YF  L    T    +   F  +     R  ++     E ++ D + G             FA    +  P   +V           KT  + + L+     I +FK L  +++ +V+ AM   +V + + II Q D GD+FYVI+ G+F++ +K        + +Y+N+GSFG+LAL+YN+PR+ATIIA + G LW ++R TF+ I++     KR  Y  FI ++PL  SL   ER+ + D +  K Y+    II QGD+    Y +ESG V + +    V  +I+   +GQYFGEL+L+TNKPRAA+   ++     +++  +FERLLGPC+++++RN   YE  L
Sbjct:    9 LTELLQSFTVEVLRNQPADLLEFALQYFTRLKENET----RGGAFGNERNPATRAGKAVNFIEEAMQIDSENGEEEDDDEEFVDAAFAQLLLAGFPQCFAVC----AQVTYPKTDEQRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKAD-GTTRTVGSYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMKRSKVEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQL 372          
BLAST of SMED30004218 vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 216.853 bits (551), Expect = 1.512e-65
Identity = 128/381 (33.60%), Postives = 205/381 (53.81%), Query Frame = -2
Query:  165 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGR----------RRFAISSESWSPYDISVSNTKEMHSNTL-KTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV-------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSL 1253
            + ELL  FT+  L  +PA+L+EF+  YF  L    T    +   F  +     R  ++     E ++ D + G             FA S+     Y+      +     T  KT  + + L+     I +FK L  +++ +V+ AM   +V + + II Q D GD+FYVI+ G+F++ +K        + +Y+N+GSFG+LAL+YN+PR+ATIIA + G LW ++R TF+ I++     KR  Y  FI ++PL  SL   ER+ + D +  K Y+    II QGD+    Y +ESG V + +       D+ +   +I+   +GQYFGEL+L+TNKPRAA+   ++     +++  +FERLLGPC+++++RN   YE  L
Sbjct:    9 LTELLQSFTVEVLRNQPADLLEFALQYFTRLKENET----RGGAFGNERNPATRAGKAVNFIEEAMQIDSENGEEEDDDEEFVGNAFA-SALCAEAYNPDEDEEEREPRVTYPKTDEQRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKAD-GTTRTVGSYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMKRSKSKNDTEDEEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQL 383          
BLAST of SMED30004218 vs. Ensembl Zebrafish
Match: prkar2ab (protein kinase, cAMP-dependent, regulatory, type II, alpha, B [Source:ZFIN;Acc:ZDB-GENE-040426-2427])

HSP 1 Score: 216.853 bits (551), Expect = 3.320e-65
Identity = 135/411 (32.85%), Postives = 213/411 (51.82%), Query Frame = -2
Query:  165 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNL--------LTERTVDVPKSSVFDR-----------------------KFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTL--KTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEH-INTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQ-------ISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSL 1274
            S+P+   + ELL  FTL  L  +PA+L+EFS  YF  L               V +   FDR                       K E    +     D+         +  RR ++ +E ++P +      +      L  KT  + + L+     I +FKTL +D++ EV+ +M  ++VK  + II QGD GD+FYVI+ G++++ I+   + L+H +  Y+++GSFG+LAL+YN+PR+ATI A   G LW ++R TF  +++     KR  Y +FI  VPL  SL   ER+ I D + M+++     II+QGD     Y +ESG+V + + S     Q       ++   +GQYFGEL+L+T +PRAA++  +  T   +++  +FERLLG C ++L+RN   YE  L
Sbjct:    2 SVPVPAGLPELLRGFTLEVLRRQPADLLEFSVRYFTGLRDTRSSTRSASSRSPVTRGEAFDRDSAHTDSSVEEEEKPEEEEEEEEKPEEEDEEEDDFPDDFTFKAPPPSKCNRRVSVCAEPYNPDEDDDDGDEGSQLTVLHQKTDEQRQRLQDACKHILLFKTLEEDQLAEVLDSMFEVLVKPGECIINQGDDGDNFYVIERGVYEIVIQQ--DGLQHSVGRYDHKGSFGELALMYNTPRAATIRALQEGALWALDRATFHRLIVKNNAKKRRMYESFIECVPLLKSLQLSERMKIVDVLGMRSFSDGERIIQQGDSADCFYIVESGEVRIMIRSKTRACQLLQEEVEVARCSRGQYFGELALVTKRPRAASVYAVGDTRCLVIDVQAFERLLGSCKQILKRNITHYEQQL 410          
BLAST of SMED30004218 vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 210.69 bits (535), Expect = 2.018e-63
Identity = 126/374 (33.69%), Postives = 201/374 (53.74%), Query Frame = -2
Query:  165 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGR----------RRFAISSESWSPYDISVSNTKEMHSNTL-KTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSL 1253
            + ELL  FT+  L  +PA+L+EF+  YF  L    T    +   F  +  + +          E ++ D + G             FA S+     Y+      +     T  KT  + + L+     I +FK L  +++ +V+ AM   +V + + II Q D GD+FYVI+ G+F++ +K        + +Y+N+GSFG+LAL+YN+PR+ATIIA + G LW ++R TF+ I++     KR  Y  FI ++PL  SL   ER+ + D +  K Y+    II QGD+    Y +ESG V + +       +I+   +GQYFGEL+L+TNKPRAA+   ++     +++  +FERLLGPC+++++RN   YE  L
Sbjct:    9 LTELLQSFTVEVLRNQPADLLEFALQYFTRLKENET----RGGAFGNEPVNFIE---------EAMQIDSENGEEEDDDEEFVGNAFA-SALCAEAYNPDEDEEEREPRVTYPKTDEQRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKAD-GTTRTVGSYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMKRSK-EVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQL 366          
BLAST of SMED30004218 vs. Ensembl Xenopus
Match: ednrb2 (endothelin receptor B subtype 2 [Source:Xenbase;Acc:XB-GENE-1219159])

HSP 1 Score: 235.728 bits (600), Expect = 1.047e-72
Identity = 138/391 (35.29%), Postives = 215/391 (54.99%), Query Frame = -2
Query:  126 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRR-------FAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSG-------NVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQNNAP 1253
            + ELL  FT+  L  +P +L+EF+  YF  L   ++   P S   +  F    R  +  I   E ++ D + G          F + +E+++P  +   + TK ++    KT  +   L+     I +FK+L  +++ +V+ AM   +VK  + +I QGD GD+FYVI  G +D+F+K+    +  +  Y+N+GSFG+LAL+YN+PR+ATI+A + G +W ++R TF+ I++     K+  Y NFI S+P   SL   ERL + D I  KTY     II QGD     Y +ESG+V + + S        N   +I+   +GQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+E+++RN   YE  L  L   NM    P
Sbjct:    9 LTELLQSFTVEVLRKQPEDLLEFALQYFTQLKQSKSQGGPLSHGMELPF----RLTKGVIFAEEPMQTDSENGEEEEDDDEEDFVVCAEAYNPDEEDDDTETKVIYP---KTDDQRNRLQEACKDILLFKSLDQEQMSQVLDAMFEKLVKCGEHVIDQGDDGDNFYVIDRGTYDIFVKSD-GVVRCVGAYDNRGSFGELALMYNTPRAATIVATSVGSIWGLDRATFRRIIVKNNAKKKRMYENFIESLPFLKSLEFSERLKVVDVIGTKTYYDGEQIIAQGDGADSFYIVESGEVRINMKSKSKPDAETNEAVEIARYTRGQYFGELALVTNKPRAASAYAVGNVKCLVMDVQAFERLLGPCMEIMKRNIANYEEQLVALFGTNMDITDP 391          
BLAST of SMED30004218 vs. Ensembl Xenopus
Match: ednrb2 (endothelin receptor B subtype 2 [Source:Xenbase;Acc:XB-GENE-1219159])

HSP 1 Score: 233.417 bits (594), Expect = 1.287e-71
Identity = 139/403 (34.49%), Postives = 217/403 (53.85%), Query Frame = -2
Query:  126 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRG-------------------RRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSG-------NVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQNNAP 1253
            + ELL  FT+  L  +P +L+EF+  YF  L   ++   P S   +  F    R  +  I   E ++ D + G                    RR ++ +E+++P  +   + TK ++    KT  +   L+     I +FK+L  +++ +V+ AM   +VK  + +I QGD GD+FYVI  G +D+F+K+    +  +  Y+N+GSFG+LAL+YN+PR+ATI+A + G +W ++R TF+ I++     K+  Y NFI S+P   SL   ERL + D I  KTY     II QGD     Y +ESG+V + + S        N   +I+   +GQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+E+++RN   YE  L  L   NM    P
Sbjct:    9 LTELLQSFTVEVLRKQPEDLLEFALQYFTQLKQSKSQGGPLSHGMELPF----RLTKGVIFAEEPMQTDSENGEEEEDDDEEDFVAPVINRFSRRASVCAEAYNPDEEDDDTETKVIYP---KTDDQRNRLQEACKDILLFKSLDQEQMSQVLDAMFEKLVKCGEHVIDQGDDGDNFYVIDRGTYDIFVKSD-GVVRCVGAYDNRGSFGELALMYNTPRAATIVATSVGSIWGLDRATFRRIIVKNNAKKKRMYENFIESLPFLKSLEFSERLKVVDVIGTKTYYDGEQIIAQGDGADSFYIVESGEVRINMKSKSKPDAETNEAVEIARYTRGQYFGELALVTNKPRAASAYAVGNVKCLVMDVQAFERLLGPCMEIMKRNIANYEEQLVALFGTNMDITDP 403          
BLAST of SMED30004218 vs. Ensembl Xenopus
Match: ednrb2 (endothelin receptor B subtype 2 [Source:Xenbase;Acc:XB-GENE-1219159])

HSP 1 Score: 216.083 bits (549), Expect = 2.149e-65
Identity = 134/403 (33.25%), Postives = 203/403 (50.37%), Query Frame = -2
Query:  126 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRG-------------------RRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSG-------NVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQNNAP 1253
            + ELL  FT+  L  +P +L+EF+  YF  L   ++   P S   +  F    R  +  I   E ++ D + G                    RR ++ +E+++P  +   + TKE  S                               +V+ AM   +VK  + +I QGD GD+FYVI  G +D+F+K+    +  +  Y+N+GSFG+LAL+YN+PR+ATI+A + G +W ++R TF+ I++     K+  Y NFI S+P   SL   ERL + D I  KTY     II QGD     Y +ESG+V + + S        N   +I+   +GQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+E+++RN   YE  L  L   NM    P
Sbjct:    9 LTELLQSFTVEVLRKQPEDLLEFALQYFTQLKQSKSQGGPLSHGMELPF----RLTKGVIFAEEPMQTDSENGEEEEDDDEEDFVAPVINRFSRRASVCAEAYNPDEEDDDTETKEQMS-------------------------------QVLDAMFEKLVKCGEHVIDQGDDGDNFYVIDRGTYDIFVKSD-GVVRCVGAYDNRGSFGELALMYNTPRAATIVATSVGSIWGLDRATFRRIIVKNNAKKKRMYENFIESLPFLKSLEFSERLKVVDVIGTKTYYDGEQIIAQGDGADSFYIVESGEVRINMKSKSKPDAETNEAVEIARYTRGQYFGELALVTNKPRAASAYAVGNVKCLVMDVQAFERLLGPCMEIMKRNIANYEEQLVALFGTNMDITDP 375          
BLAST of SMED30004218 vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 213.772 bits (543), Expect = 4.662e-64
Identity = 134/395 (33.92%), Postives = 212/395 (53.67%), Query Frame = -2
Query:  126 ELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVD-------VPKSSVFDRKFESVLRKNRSSIDNSEHLEHDD-------KRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDS-------GNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQNNAP 1247
            +LL  +T+  L  KP +L+EF+  YF  L  ++  D        P + V +   E +  ++    +  E  + D         R  RR ++ +E+++P D    +T E      KT  +   L+     I +FK L  +++ +V+ AM  + VK ++ +I QGD GD+FYV++ G +D+F++    +   +  Y+N GSFG+LAL+YN+PR+ATI+A + G LW ++R TF+ I++     KR TY  FI SVP+   L   ER+ I D I  + Y     II QGD     + +ESG+V + + S        N   +I+    GQYFGEL+L+TNKPRAA+   +      I++  +FERLLGPC+++++RN   YE  L  L   +M    P
Sbjct:   11 DLLQGYTVEVLRQKPPDLVEFAIQYFTRLKEKQLQDGAGAGSLRPHARVVNFDGEPMQTESNGDEEEDEEDDDDSDFEPPVINRYSRRVSVCAEAYNP-DEEDEDT-EPRVVRPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQS-RCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAFERLLGPCMDIMKRNITHYEEQLVALFGSSMDLRDP 402          
BLAST of SMED30004218 vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 210.305 bits (534), Expect = 9.552e-63
Identity = 133/400 (33.25%), Postives = 211/400 (52.75%), Query Frame = -2
Query:  126 ELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDV-------PKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRR------------FAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDS-------GNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQNNAP 1247
            +LL  +T+  L  KP +L+EF+  YF  L  ++  D        P + V +   E +  ++    +  E  + D    R+R              + +E+++P D    +T E      KT  +   L+     I +FK L  +++ +V+ AM  + VK ++ +I QGD GD+FYV++ G +D+F++    +   +  Y+N GSFG+LAL+YN+PR+ATI+A + G LW ++R TF+ I++     KR TY  FI SVP+   L   ER+ I D I  + Y     II QGD     + +ESG+V + + S        N   +I+    GQYFGEL+L+TNKPRAA+   +      I++  +FERLLGPC+++++RN   YE  L  L   +M    P
Sbjct:   11 DLLQGYTVEVLRQKPPDLVEFAIQYFTRLKEKQLQDGAGAGSLRPHARVVNFDGEPMQTESNGDEEEDEEDDDDSDFERKRPHVLWAGLEFEKTGVCAEAYNP-DEEDEDT-EPRVVRPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQS-RCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAFERLLGPCMDIMKRNITHYEEQLVALFGSSMDLRDP 407          
BLAST of SMED30004218 vs. Ensembl Mouse
Match: Prkar2a (protein kinase, cAMP dependent regulatory, type II alpha [Source:MGI Symbol;Acc:MGI:108025])

HSP 1 Score: 235.728 bits (600), Expect = 1.170e-72
Identity = 139/390 (35.64%), Postives = 219/390 (56.15%), Query Frame = -2
Query:  141 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFES-------VLRKNRSSIDNSEHLEHD---DKRGRRRFAISSESWSPYDISVSN-TKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDS--------GNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 1253
            + ELL  +T+  L  +P +L++F+  YF  L   R  +     V    F +       V+ ++  S  +SE  + +     +  RR ++ +E+++P +    N  + +H    KT  +   L+     I +FK L  +++ +V+ AM   IVK ++ +I QGD GD+FYVI+ G +D+ +  K N    +  Y+N+GSFG+LAL+YN+PR+ATIIA + G LW ++R TF+ I++     KR  + +FI SVPLF SL   ER+ I D I  K Y     II QG+     Y IESG+V + + S        GN   +I+  HKGQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+++++RN   YE  L ++   N+
Sbjct:   10 LTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEEDGESDSDSEDADLEVPVPSKFTRRVSVCAETFNPDEEEEDNDPRVVHP---KTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILV-TKDNQTRSVGQYDNRGSFGELALMYNTPRAATIIATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQGEKADSFYIIESGEVSILIRSKTKSNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSNL 395          
BLAST of SMED30004218 vs. Ensembl Mouse
Match: Prkar2a (protein kinase, cAMP dependent regulatory, type II alpha [Source:MGI Symbol;Acc:MGI:108025])

HSP 1 Score: 217.624 bits (553), Expect = 5.201e-66
Identity = 134/382 (35.08%), Postives = 211/382 (55.24%), Query Frame = -2
Query:  141 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFES-------VLRKNRSSIDNSEHLEHD---DKRGRRRFAISSESWSPYDISVSN-TKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 1253
            + ELL  +T+  L  +P +L++F+  YF  L   R  +     V    F +       V+ ++  S  +SE  + +     +  RR ++ +E+++P +    N  + +H    KT  +   L+     I +FK L  +++ +V+ AM   IVK ++ +I QGD GD+FYVI+ G +D+ +  K N    +  Y+N+GSFG+LAL+YN+PR+ATIIA + G LW ++R TF+ I++     KR  + +FI SVPLF SL   ER+ I D I  K Y     II Q          +S K G     GN   +I+  HKGQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+++++RN   YE  L ++   N+
Sbjct:   10 LTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEEDGESDSDSEDADLEVPVPSKFTRRVSVCAETFNPDEEEEDNDPRVVHP---KTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILV-TKDNQTRSVGQYDNRGSFGELALMYNTPRAATIIATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQ---------TKSNKNG-----GNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSNL 373          
BLAST of SMED30004218 vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 209.92 bits (533), Expect = 1.188e-62
Identity = 139/416 (33.41%), Postives = 218/416 (52.40%), Query Frame = -2
Query:  141 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTE-------------RT---------VDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDD------KRGRRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV---------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 1274
            S+ +   + ELL  FT+  L  +PA+L+EF+  +F  L  E             RT           +P   V     E  +R +  + +  E  E          R  RR ++ +E+++P  +   + ++ +H    KT  +   L+     I +FK L  +++ +V+ AM   +VK  + +I QGD GD+FYVI  G FD+++K        +  Y+N+GSFG+LAL+YN+PR+ATI A + G LW ++R TF+ I++     KR  Y +FI S+P   SL   ERL + D I  K Y+    II QGD+    + +ESG+V + +         ++G V  +I+   +GQYFGEL+L+TNKPRAA+   +       ++  +FERLLGPC+E+++RN   YE  L  L   NM
Sbjct:    2 SIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGAARFGHEGRTWGDAGAAAGGGIPSKGV--NFAEEPMRSDSENGEEEEAAEAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHP---KTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCD-GVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAV--EIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNM 409          
BLAST of SMED30004218 vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 209.92 bits (533), Expect = 1.188e-62
Identity = 139/416 (33.41%), Postives = 218/416 (52.40%), Query Frame = -2
Query:  141 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTE-------------RT---------VDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDD------KRGRRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV---------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 1274
            S+ +   + ELL  FT+  L  +PA+L+EF+  +F  L  E             RT           +P   V     E  +R +  + +  E  E          R  RR ++ +E+++P  +   + ++ +H    KT  +   L+     I +FK L  +++ +V+ AM   +VK  + +I QGD GD+FYVI  G FD+++K        +  Y+N+GSFG+LAL+YN+PR+ATI A + G LW ++R TF+ I++     KR  Y +FI S+P   SL   ERL + D I  K Y+    II QGD+    + +ESG+V + +         ++G V  +I+   +GQYFGEL+L+TNKPRAA+   +       ++  +FERLLGPC+E+++RN   YE  L  L   NM
Sbjct:    2 SIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGAARFGHEGRTWGDAGAAAGGGIPSKGV--NFAEEPMRSDSENGEEEEAAEAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHP---KTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCD-GVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAV--EIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNM 409          
BLAST of SMED30004218 vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 194.512 bits (493), Expect = 9.715e-59
Identity = 103/252 (40.87%), Postives = 152/252 (60.32%), Query Frame = -2
Query:  141 IDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV---------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 869
            + +V+ AM   +VK  + +I QGD GD+FYVI  G FD+++K        +  Y+N+GSFG+LAL+YN+PR+ATI A + G LW ++R TF+ I++     KR  Y +FI S+P   SL   ERL + D I  K Y+    II QGD+    + +ESG+V + +         ++G V  +I+   +GQYFGEL+L+TNKPRAA+   +       ++  +FERLLGPC+E+++RN   YE  L  L   NM
Sbjct:    1 MSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCD-GVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAV--EIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNM 249          
BLAST of SMED30004218 vs. UniProt/SwissProt
Match: sp|P81900|KAPR2_DROME (cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2)

HSP 1 Score: 257.299 bits (656), Expect = 1.750e-80
Identity = 145/388 (37.37%), Postives = 233/388 (60.05%), Query Frame = -2
Query:  135 MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTV-VGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQN 1295
            MS    + + +  E++E+L+ F+++ L  +P ++I+++  YF  L +ER    P  S  D+  +  L  N    D    +        RR ++ +E++ P   +  +     +   KT  +   L   +  + +F++L  +++++V+ AM    V+  D II+QGD GD+FYVI+SG++ V+I +K     HINTYN+ G FG+LALLYN PR+AT+ A T+G+LW M+R+TF+ I++  A  KR  Y   ++SVP+  +L N ER+++ADA+  K+YD    II+QGD    MYFIE G V V +D  +   +IS L KGQYFGEL+L+T++PRAA++      V +  L+  +FERLLGPC+++++RN   YE  L + I G+  N
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSER----PSVSHTDQSTDDQLSVNSQDADAEPPV----MASSRRKSVFAEAYDPE--ADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDK-----HINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVK-IFGSKNN 372          
BLAST of SMED30004218 vs. UniProt/SwissProt
Match: sp|Q26619|KAPR_STRPU (cAMP-dependent protein kinase type II regulatory subunit OS=Strongylocentrotus purpuratus OX=7668 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 5.744e-72
Identity = 135/373 (36.19%), Postives = 217/373 (58.18%), Query Frame = -2
Query:  153 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTER-TVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV-----DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELI 1253
            + +LL DFT+A L  KP++L+EF+++YF  L     ++   +   F     +      S ID+ E  E    R  RR ++ +E + P   + ++T+++     K+  +   L   +  I +F+ L + ++ EVI AM        D +I QGD GD+FYVI  G +D+F+ +       +  Y + GSFG+LAL+YN+PR+ATI A T GILW ++R +F+ IV+  A  KR  Y   +  V +F SL   ER+++ADA+  +TY+    II QGD     YFIE+G+  + +     D+ +  K+++I ++GQYFGEL+L+TNKPRAA++  +E  V  +L+ ++FERLLGPC+++++RN   YE     L 
Sbjct:    9 LTDLLQDFTVAVLREKPSDLVEFASSYFAKLQENNISLGGKRGVTF-----TAPEDAESDIDD-EPPELPKNRYARRKSVCAEKYDPEADNDTDTQKLV--YPKSDEQRARLTEAVKNILLFRALDEKQMQEVIDAMFEKKTTPGDHVIDQGDDGDNFYVIDRGEYDIFVNDN-----KVGAYKDSGSFGELALMYNTPRAATIAATTDGILWALDRVSFRRIVLKNAAKKRRIYEELLEKVSIFKSLEPYERMNLADALVTRTYEDGDCIIAQGDGADGCYFIEAGQCRIAMKSERSDNPDEEKEVAIYNQGQYFGELALLTNKPRAASVYAVE-DVDCLLDVNAFERLLGPCMDIMKRNIEHYEQETSRLF 367          
BLAST of SMED30004218 vs. UniProt/SwissProt
Match: sp|P00515|KAP2_BOVIN (cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2A PE=1 SV=2)

HSP 1 Score: 231.491 bits (589), Expect = 3.434e-70
Identity = 135/389 (34.70%), Postives = 215/389 (55.27%), Query Frame = -2
Query:  141 ELLIDFTLAALEIKPANLIEFSANYFQNLLTERT-----VDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDD------KRGRRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV--------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 1247
            ELL  +T+  L  +P +L++F+ +YF  L   R+        P S   D  F+        ++ +SE  + +D       R  RR ++ +E+++P  +   ++ + +H  T +       L+     I +FK L  +++ +V+ AM    VK ++ +I QGD GD+FYVI+ G +D+ +  K N    +  Y+N GSFG+LAL+YN+PR+ATI+A + G LW ++R TF+ I++     KR  + +FI SVPL  SL   ER+ I D I  K Y     II QG+     Y IESG+V + +        D  N   +I+  HKGQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+++++RN   YE  L ++   +M
Sbjct:   12 ELLQGYTVEVLRQRPPDLVDFAVDYFTRLREARSRASTPPAAPPSGSQD--FDPGAGLVADAVADSESEDEEDLDVPIPGRFDRRVSVCAETYNPDEEEEDTDPRVIHPKTDQQRCR---LQEACKDILLFKNLDPEQLSQVLDAMFERTVKVDEHVIDQGDDGDNFYVIERGTYDILV-TKDNQTRSVGQYDNHGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKVYKDGERIITQGEKADSFYIIESGEVSILIKSKTKVNKDGENQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSM 394          
BLAST of SMED30004218 vs. UniProt/SwissProt
Match: sp|P13861|KAP2_HUMAN (cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2)

HSP 1 Score: 230.72 bits (587), Expect = 7.218e-70
Identity = 141/395 (35.70%), Postives = 219/395 (55.44%), Query Frame = -2
Query:  141 ELLIDFTLAALEIKPANLIEFSANYFQNLLTERT------VDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHD------DKRGRRRFAISSESWSP-YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV--------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELI-----LGNM 1247
            ELL  +T+  L  +P +L+EF+  YF  L   R          P+ S+     E    +   +  +SE  E +        R  RR ++ +E+++P  +   ++ + +H    KT  +   L+     I +FK L  +++ +V+ AM   IVKA++ +I QGD GD+FYVI+ G +D+ +  K N    +  Y+N+GSFG+LAL+YN+PR+ATI+A + G LW ++R TF+ I++     KR  + +FI SVPL  SL   ER+ I D I  K Y     II QG+     Y IESG+V + +        D GN   +I+  HKGQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+++++RN   YE  L ++      LGN+
Sbjct:   12 ELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHP---KTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILV-TKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNL 402          
BLAST of SMED30004218 vs. UniProt/SwissProt
Match: sp|P12368|KAP2_RAT (cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar2a PE=1 SV=4)

HSP 1 Score: 230.335 bits (586), Expect = 7.969e-70
Identity = 137/387 (35.40%), Postives = 217/387 (56.07%), Query Frame = -2
Query:  141 ELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVD-----VPKSSVFDRKFESV----LRKNRSSIDNSEHLEHD-DKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDS--------GNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 1247
            ELL  +T+  L  +P +L++F+  YF  L   R  +      P ++   ++   V          S  + E LE     +  RR ++ +E+++P +   ++ + +H    KT  +   L+     I +FK L  +++ +V+ AM   IVK ++ +I QGD GD+FYVI+ G +D+ +  K N    +  Y+N+GSFG+LAL+YN+PR+ATI+A + G LW ++R TF+ I++     KR  + +FI SVPLF SL   ER+ I D I  K Y     II QG+     Y IESG+V + + S        GN   +I+  HKGQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+++++RN   YE  L ++   N+
Sbjct:   12 ELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEEDGESESDSDDEDLEVPIPSKFTRRVSVCAETFNPDEEEDNDPRVVHP---KTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILV-TKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSDGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSKTKTNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSNL 394          
BLAST of SMED30004218 vs. TrEMBL
Match: A0A3S5CG55 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS11856 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.031e-78
Identity = 148/379 (39.05%), Postives = 228/379 (60.16%), Query Frame = -2
Query:  135 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTL---KTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALE-HINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV-DSGNVRK-QISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQN 1253
            +RELL DFT+A L   P +L+EF+  YF    T +     K+ V             S  +  E +    +RG RR  +++ES+ P        KE     +   KT  +   L+     I +F+ L DD++ +VI AM    V+  + +I  G+ GD+FYVI+ G+FD+ +K   N +E  +  Y ++GSFG+LAL+YN+PR+ATI+A+T+G+LW M R+TF++IV+ KA  KR  Y   +  VP+ +SL+N ER+ IADA+  + YD    II QG+ G  MYF+E G+V + +   G+  + +++ L KG YFGEL+L+T +PRAA++  + RT + +L+  SFERLLGPC+E+L+RN   YE  L++ I G+M+ 
Sbjct:   12 LRELLQDFTVAVLRDHPPDLVEFAIQYF----TMKKSQANKAPVG------------SDEEEEEPMPAPPRRGARRAGVAAESYDP-------EKEESVEKVVFPKTEEQRSRLQHATRDILLFRCLDDDQMKDVIDAMFERRVEVGEKVISLGEDGDNFYVIEKGLFDIIVK--VNGVETKVGQYEDKGSFGELALMYNTPRAATILAQTSGVLWAMTRETFRSIVLKKAFEKRRMYEELLDKVPMLESLSNYERMSIADALRTRIYDEGVRIIIQGEPGAEMYFVEEGQVRITMKKEGDANETELTRLEKGGYFGELALLTKQPRAASVYAVTRTKLAVLDVDSFERLLGPCVEILKRNISNYEEELKK-IFGSMEK 364          
BLAST of SMED30004218 vs. TrEMBL
Match: A0A2T7NFW1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_20558 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 3.192e-78
Identity = 151/365 (41.37%), Postives = 220/365 (60.27%), Query Frame = -2
Query:  171 ELLIDFTLAALEIKPANLIEFSANYFQNLL-TERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGR--RRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEH-INTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV--DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEV 1247
            ELL DFT+A L  KP  L++F+A+YF N+  + +T  VP   + D   E+           S  L+   K  R  RR ++S+E + P        K +H    KT  +   L + IS I +F++L  D++ +VI AM    V+A D++I++GD GD+FYVI SG++ V I +  N  E  ++T++N GSFG+LAL+YN PRSAT+ A  AG LW M+R +F+ IV+  A  KR  Y   +  VP+  +L   ER+ +ADA+H K +    VII QG+    MYFIE G V + +  DSG   + +S L KG+YFGEL+L+ NKPR+A +I   +  V  LER SFERLLGPC+E+++RN+  Y++
Sbjct:   11 ELLRDFTVAVLREKPERLVDFAADYFANMRNSSKTKAVPMYIIVDDDEEA-----GEPDPESLRLKSGAKSTRYARRTSVSAERYDPEADDEEEVKVVHP---KTDQQKSRLSQAISHILLFRSLDSDQVADVIDAMFEKRVQAGDIVIKKGDDGDNFYVIDSGVYSVVIDS--NGQEKTVHTFDNSGSFGELALMYNMPRSATVRAERAGSLWAMDRVSFRRIVLKAAFKKRRMYEELLEHVPMLKTLEAYERMSLADALHSKVFADGDVIIEQGEEADGMYFIEDGSVRITLRKDSG-AEETVSRLTKGKYFGELALIENKPRSANVIAEGKVKVAFLERESFERLLGPCLELMKRNSDVYKI 364          
BLAST of SMED30004218 vs. TrEMBL
Match: A0A3M7STD2 (cAMP-dependent kinase type II regulatory subunit isoform X2 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_041639 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 5.006e-78
Identity = 143/381 (37.53%), Postives = 227/381 (59.58%), Query Frame = -2
Query:  153 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGR-------------RRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICL-ERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELI 1253
            + +LL DFT+  L  +PA+L++F+A YF +LL +R  D  KS +   K  +      + +D  +    +D+ G              RR ++++E ++P + +      +H    KT  E   L + I  I IF++L   ++D+VI AM    V+  DVII+QGD GD+FYVI+SG +D+++ NK    + +  Y+ +GSFG+LAL+YN PR+ATI+A + G LW ++R TFK IV+  A  KR  Y   + ++P+F SL + ER+++ADA+  K++     II+Q +  + MYFIE G V +  +     K+I +  KG YFGEL+L+T KPRAA+   + + T   IL+  +FERLLGPC++++Q+N   YE  L++L 
Sbjct:    9 LTDLLQDFTVEVLRKRPADLLQFAAQYFDSLLEKRASDNAKSLL--SKLSTANHAETNHVDEDDVYTDEDEMGEMPELPKGRFAAGGRRHSVAAEKYNPEEDTSEEPAVVHP---KTDDERHYLLKTIGHIFIFRSLEKKQVDKVIDAMFGRHVQQGDVIIEQGDDGDNFYVIESGKYDIYV-NK----QKVGEYDQKGSFGELALMYNMPRAATIVAGSVGKLWALDRLTFKRIVLKSAFEKRKMYEQLLDNMPMFKSLNSYERMNVADALFSKSFSDGQSIIKQDEEAQCMYFIEHGMVRIVREQDGQSKEIKMCQKGDYFGELALLTKKPRAASAYAVGDDTKCAILDVDAFERLLGPCVKIMQKNIPDYEEQLRKLF 379          
BLAST of SMED30004218 vs. TrEMBL
Match: B4NX29 (Uncharacterized protein, isoform D OS=Drosophila yakuba OX=7245 GN=Dyak\GE21875 PE=4 SV=2)

HSP 1 Score: 257.299 bits (656), Expect = 5.186e-78
Identity = 145/388 (37.37%), Postives = 233/388 (60.05%), Query Frame = -2
Query:  135 MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTV-VGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQN 1295
            MS    + + +  E++E+L+ F+++ L  +P ++I+++  YF  L +ER    P  S  D+  +  L  N    D    +        RR ++ +E++ P   +  +     +   KT  +   L   +  + +F++L  +++++V+ AM    V+  D II+QGD GD+FYVI+SG++ V+I +K     HINTYN+ G FG+LALLYN PR+AT+ A T+G+LW M+R+TF+ I++  A  KR  Y   ++SVP+  +L N ER+++ADA+  K+YD    II+QGD    MYFIE G V V +D  +   +IS L KGQYFGEL+L+T++PRAA++      V +  L+  +FERLLGPC+++++RN   YE  L + I G+  N
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSER----PSVSHTDQSTDDQLSVNSQDADAEPPV----MASSRRKSVFAEAYDPE--ADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDK-----HINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVK-IFGSKNN 372          
BLAST of SMED30004218 vs. TrEMBL
Match: A0A0J9R972 (Uncharacterized protein, isoform C OS=Drosophila simulans OX=7240 GN=Dsim\GD10033 PE=4 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 5.186e-78
Identity = 145/388 (37.37%), Postives = 233/388 (60.05%), Query Frame = -2
Query:  135 MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTV-VGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQN 1295
            MS    + + +  E++E+L+ F+++ L  +P ++I+++  YF  L +ER    P  S  D+  +  L  N    D    +        RR ++ +E++ P   +  +     +   KT  +   L   +  + +F++L  +++++V+ AM    V+  D II+QGD GD+FYVI+SG++ V+I +K     HINTYN+ G FG+LALLYN PR+AT+ A T+G+LW M+R+TF+ I++  A  KR  Y   ++SVP+  +L N ER+++ADA+  K+YD    II+QGD    MYFIE G V V +D  +   +IS L KGQYFGEL+L+T++PRAA++      V +  L+  +FERLLGPC+++++RN   YE  L + I G+  N
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSER----PSVSHTDQSTDDQLSVNSQDADAEPPV----MASSRRKSVFAEAYDPE--ADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDK-----HINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVK-IFGSKNN 372          
BLAST of SMED30004218 vs. Ensembl Cavefish
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:103029925])

HSP 1 Score: 218.394 bits (555), Expect = 3.455e-66
Identity = 129/387 (33.33%), Postives = 210/387 (54.26%), Query Frame = -2
Query:  165 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSS--IDNSEHLEHDD---------------KRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV-------DSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSL 1253
            + ELL  FT+  L  +P +L+EF+  YF  L    +    +   F  +  S +R  ++   I+ +  ++ ++                R  RR ++ +E+++P +      KE      KT  +   L+     I +FK L  +++ +V+ AM    V + + II Q D GD+FYVI+ G FD+ +K+   +   + +Y+N+GSFG+LAL+YN+PR+ATI+A + G LW ++R TF+ I++     KR  Y  FI ++PL  SL   ER+ + D +  K Y     II QGD+    Y +ESG+V + +       DS      I+   +GQYFGEL+L+TNKPRAA+   +E     +++  +FERLLGPC+++++RN   YE  L
Sbjct:    9 LTELLQSFTVEVLRNQPRDLLEFALQYFTQLKENES----RGGAFGNEQNSAVRAGKAVNFIEEAMQIDSENEEDEDDDEEFVAPVINRFIRRASVCAEAFNPDEDD--EDKEPRVTHPKTDEQRHRLQEACKDILLFKNLDQEQMSQVLDAMFDKAVTSGEHIIDQDDDGDNFYVIERGTFDILVKSDGTS-RTVGSYDNRGSFGELALMYNTPRAATIVATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIETLPLLTSLEVSERMKVVDVLSSKVYSKGEQIIAQGDLADSFYIVESGEVRITMKRNRLKTDSEEEEVDIATCTRGQYFGELALVTNKPRAASAYAVENVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQL 388          
BLAST of SMED30004218 vs. Ensembl Cavefish
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 217.238 bits (552), Expect = 4.252e-66
Identity = 128/381 (33.60%), Postives = 207/381 (54.33%), Query Frame = -2
Query:  174 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDK------RGRRRFAISSESWSPYDISV-SNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDS-------GNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYE 1274
            S+ + + + ELL  +T+  L  +P +L+EF+  YF  L   R+ D   ++           K +  + + E ++ +             F + +E  +P D    S  + +H  T +       L+     I +FK L  ++  EV+ AM  +IV+ ++ +I QGD GD+FYVI+ G++D+ ++ K      +  Y+N+GSFG+LAL+YN+PR+ATIIA+  G LW ++R TF+ +++     KR  Y  FI SVPL  SL   ER+ I D + +K +     II QGD+    Y +ESG+V + + S        N   +I+   +GQYFGEL+L+TNKPRA +   +      +++  +FERLLGPC E+++RN   YE
Sbjct:    2 SIEIPVGLTELLQGYTVEVLRQRPPDLVEFAVQYFTRLRDTRSQDGSGAAA----------KGKGVMFDGEPMQTESNGDEDDEDDDSDFELCAEPLNPDDDDEDSEPRVVHPKTDEQRCR---LQEACKDILLFKALDQEQFSEVLDAMFEVIVQPQEHVIDQGDDGDNFYVIERGVYDIVVQ-KDGVGCCVGQYDNKGSFGELALMYNTPRAATIIAKQEGALWGLDRATFRRLIVKNNAKKRRMYECFIESVPLLKSLEISERMKIVDVLGVKIFHDGERIIMQGDMADCFYIVESGEVKIMMKSKTKADRQDNAEVEITRCTRGQYFGELALVTNKPRAGSAYAVGDIKCLVIDVQAFERLLGPCKEIMKRNIAHYE 368          
BLAST of SMED30004218 vs. Ensembl Cavefish
Match: prkar2ab (protein kinase, cAMP-dependent, regulatory, type II, alpha, B [Source:ZFIN;Acc:ZDB-GENE-040426-2427])

HSP 1 Score: 206.068 bits (523), Expect = 7.148e-62
Identity = 127/381 (33.33%), Postives = 206/381 (54.07%), Query Frame = -2
Query:  156 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFA------ISSESWSPYDISV--SNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQEL 1274
            S+ +   + +LL  +T+  L+ +P++L++F+  YF  L  +R+ DV     FD+             +  E  + ++K     F       + +E+++P D     S  K +H    KT  +   L+     I +FKTL  ++  EV+ AM  ++VK ++ II QGD GD+FYVI+ G++D+ +  K      +  Y+N+GSFG+LAL+YN+PR+ATIIA  +G LW ++R TF  +++     KR  Y  FI  VPL  SL   ER+ I D +  K++    +II+Q   G+                 N   +++   +GQYFGEL+L+TNKPRAA++  +  T   +++  +FERLLGPC E+++RN   Y+  L  L
Sbjct:    2 SVEIPAGLTDLLKGYTVEVLKQRPSDLLDFAVQYFTRLKEQRSADV----AFDKDTTPTESSEEDEEEEKEEEDEEEKEEDDDFPDDFTFKLCAEAYNPDDDDDDDSEPKVIHP---KTDQQRSRLQEACKDILLFKTL--EKFSEVLDAMFEVLVKPQEHIIDQGDDGDNFYVIERGVYDIVV-GKDGVSRCVGKYDNKGSFGELALMYNTPRAATIIATQSGALWALDRATFHRLIVRNNAKKRRMYEAFIECVPLLKSLELSERMKIVDVLGAKSFKNGELIIKQTKAGQR---------------DNAEVEVARCSRGQYFGELALVTNKPRAASVYAVGETKCLVIDVQAFERLLGPCKEIMKRNIASYKEQLVAL 357          
BLAST of SMED30004218 vs. Ensembl Cavefish
Match: prkar1ab (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103038385])

HSP 1 Score: 176.792 bits (447), Expect = 1.465e-50
Identity = 115/361 (31.86%), Postives = 188/361 (52.08%), Query Frame = -2
Query:  177 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRK--QISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKY 1253
            I++LL D  +     +P   + F   YF+ L  E      K  +  +K  S  R +    + S  +    K  RRR AIS+E ++  D + S  +++     KT   +  L + I +  +F  L D+E  ++  AM  +   A +++IQQGD GD+FYVI  G  DV++ N++       +    GSFG+LAL+Y +PR+AT+ A+T   LW ++R +++ I++     KR  Y  F+S V + +SL   ERL +ADA+    ++    I+ QG+ G   + I  G   V        +  ++  L    YFGE++L+ N+PRAAT++         L+R  FER+LGPC ++L+RN  +Y
Sbjct:   26 IQQLLKDCIVQLCTSRPERPMVFLREYFERLEKEEA----KQLLSQQKTSS--RSDSREDEVSPPMNPVVKGRRRRGAISAEVYTEED-AASYVRKVIPKDYKT---MAALAKAIEKNVLFSHLDDNERSDIFDAMFPVTYIAGEIVIQQGDEGDNFYVIDQGEMDVYVNNEW-----ATSIGEGGSFGELALIYGTPRAATVRAKTNAKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDSQKIVVQGEPGDEFFIILEGCAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQY 371          
BLAST of SMED30004218 vs. Ensembl Cavefish
Match: prkar1aa (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103047413])

HSP 1 Score: 175.252 bits (443), Expect = 5.239e-50
Identity = 117/371 (31.54%), Postives = 188/371 (50.67%), Query Frame = -2
Query:  177 DCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRK--QISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKY 1283
            +C+       I++LL D  +     +P   + F  +YF+ L  E      K  V  +K  S        I  S  +    K  RRR AIS+E ++  D + S  +++     KT   +  L + I +  +F  L D+E  ++  AM  +   A + +IQQGD GD+FYVI  G  DV++ N +     + +    GSFG+LAL+Y +PR+AT+ A+T   LW ++R +++ I++     KR  Y  F+S V + +SL   ERL +ADA+    ++    I+ QG  G   + I  G   V        +  ++  L    YFGE++L+ N+PRAAT++         L+R  FER+LGPC ++L+RN  +Y
Sbjct:   16 ECEQYVQKHSIQQLLKDCIVQLCTSRPERPMAFLRDYFERLEKEEA----KQMVGQQKSSSRSDSREDEI--SPPMNPVVKGRRRRGAISAEVYTEED-AASYVRKVIPKDYKT---MAALAKAIEKNVLFAHLDDNERSDIFDAMFPVNYIAGETVIQQGDEGDNFYVIDQGEMDVYVNNAW-----VTSIGEGGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALETVQFEDGQKIVVQGQPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARSPLKCVKLDRPRFERVLGPCSDILKRNIQQY 371          
BLAST of SMED30004218 vs. Ensembl Sea Lamprey
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 179.874 bits (455), Expect = 3.155e-54
Identity = 94/228 (41.23%), Postives = 137/228 (60.09%), Query Frame = -2
Query:  126 GIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDS-----------GNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM---QNNAP 767
            G+FD+F+K    A + +  Y+N+GSFG+LAL+YN+PR+ATI+A T G LW M+R TF+ I++  A  KR  Y  FI SVPL  SL   ER+ + D I  K+Y+    II QG      + +E+G+V + + S           G V  +I+   +GQYFGELSL+TNKPRAA+   +      ++    FERLLGPC+++++RN   YE  L  L   +M   +N++P
Sbjct:    2 GVFDIFVKID-GAPKKVGCYDNRGSFGELALMYNTPRAATIVATTEGSLWAMDRATFRRIILKNAAQKRKMYEAFIESVPLLKSLDASERMKVVDTITTKSYEDGEQIIAQGAKADCFFIVEAGEVRIMMKSKTQPPAETTKEGEV--EIARCTRGQYFGELSLVTNKPRAASAYAVGNVKCAVMGVQPFERLLGPCMDIMKRNITHYEEQLVALFGTSMDISENSSP 226          
BLAST of SMED30004218 vs. Ensembl Sea Lamprey
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 150.214 bits (378), Expect = 6.439e-42
Identity = 101/321 (31.46%), Postives = 163/321 (50.78%), Query Frame = -2
Query:  390 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLL--TERTVDVPKSSVFDRKFESVLRKNRSSIDN-SEHLEHDD----------------------KRGRRRFAISSESWSPYDISVSNT-KEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKV 1274
            S+ +   + ELL  FT+  L  +PA+L++F+A YF  +          P   + D   ++  R    S +N + H  + D                       R  RR ++ +E+++P +       + +H    KT  +   L+     I IFK L  +++ +V+ AM    V+  + +I QG  GD+FYVI+ G++D+++    +    +  YNN+GSFG+LAL+YN+ R+ATIIA + G LW ++R TF+ I++  A  KR  Y  FI +VPL  SL   ERL + D I  K++     II QG+     Y +ESG+V
Sbjct:    2 SVEVPAGLTELLQAFTVEVLRSRPADLLDFAAAYFAEMRQRARERCGAPAQQLADGFDDAHGRGVNFSEENVAGHSSNSDNNGDDDRDDDDDDESDFEAPVISRFTRRASVCAEAYNPDEEEEDTETRVIHP---KTDEQRNRLQEACKHILIFKNLDQEQMSQVLDAMFEKTVETGEHVIDQGADGDNFYVIERGMYDIYVTTN-DVSRCVGAYNNRGSFGELALMYNTSRAATIIATSEGALWGLDRLTFRRIIVKNAAKKRKMYECFIETVPLLKSLDFSERLKVVDVIASKSFQDSERIIAQGEKADCFYLVESGEV 318          

HSP 2 Score: 61.6178 bits (148), Expect = 9.948e-11
Identity = 34/103 (33.01%), Postives = 55/103 (53.40%), Query Frame = -2
Query:  219 LFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLL 527
            +F +L  ++   + DA+  KT +    +I QG  G + Y IE G   +YV + +V + +   +    FGEL+LM N  RAATII      +  L+R +F R++
Sbjct:  151 IFKNLDQEQMSQVLDAMFEKTVETGEHVIDQGADGDNFYVIERGMYDIYVTTNDVSRCVGAYNNRGSFGELALMYNTSRAATIIATSEGALWGLDRLTFRRII 253          
BLAST of SMED30004218 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001198.1 (pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 gene:ENSPMAG00000001068.1 transcript:ENSPMAT00000001198.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 6.993e-19
Identity = 58/217 (26.73%), Postives = 104/217 (47.93%), Query Frame = -2
Query:  279 EILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATI 929
            E+LKR+    ++   LGD         M+       + II +GD      V   G+ DV  +      E + T      FG+LA+LY+  R+AT+ A T   L Y++R  F+++++ ++ ++R   + F+ +     +L +++   + D +    +     I+ +G+VG   Y I  G+V V  +     + I +L  G +FGEL+L+ N  R AT 
Sbjct:   11 ELLKRMQPGQTVL--LGD--------CMSETTRARGETIIAEGDSSRRLKVDVEGLLDVSKQG-----ESLCTLQPGALFGELAILYDCTRTATVKALTDVRLLYLSRHAFRSVLMRESQLRRKLIIKFLKTAKTLKNLPDEQLSKMFDCMEESAFADGEAIVNEGEVGHIFYVILRGQVRVSQEVEGSPRLIRVLEPGDHFGELALIRNMRRTATC 212          
BLAST of SMED30004218 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001825.1 (pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gene:ENSPMAG00000001656.1 transcript:ENSPMAT00000001825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 3.312e-14
Identity = 37/136 (27.21%), Postives = 69/136 (50.74%), Query Frame = -2
Query:  540 KTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFI 947
            K      ++K  +++    + L D  +  ++  M       E  +I++G+ G+H YV+ +   D   + +   L H++       FG+LA+LYN  R+AT+ A TA  +W ++R TF+ IVI +   +   +V F+
Sbjct:  163 KNPCSQRLIKAALAKNEFLRRLEDGRVARMVECMYERAYSPEQAVIREGEAGNHLYVLAAASLDC--QQRGTCLGHMHPGT---VFGELAILYNCKRTATVKAVTAVRVWVLDRLTFQAIVIREEQARHQEHVRFL 293          

HSP 2 Score: 47.7506 bits (112), Expect = 2.363e-6
Identity = 22/88 (25.00%), Postives = 46/88 (52.27%), Query Frame = -2
Query:  228 IADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFE 491
            + + ++ + Y  +  +IR+G+ G H+Y + +  +    D       +  +H G  FGEL+++ N  R AT+  +    V +L+R +F+
Sbjct:  192 MVECMYERAYSPEQAVIREGEAGNHLYVLAAASL----DCQQRGTCLGHMHPGTVFGELAILYNCKRTATVKAVTAVRVWVLDRLTFQ 275          
BLAST of SMED30004218 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005026.1 (pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 gene:ENSPMAG00000004571.1 transcript:ENSPMAT00000005026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.804e-10
Identity = 26/72 (36.11%), Postives = 44/72 (61.11%), Query Frame = -2
Query:  522 YNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLF 737
            Y  +E + +    GSFG+LAL+Y +PR+AT+ A+T   LW ++R +++ I++     KR  Y  F+S V + 
Sbjct:   24 YVNVELVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSIL 95          
BLAST of SMED30004218 vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 179.874 bits (455), Expect = 2.657e-52
Identity = 101/286 (35.31%), Postives = 160/286 (55.94%), Query Frame = -2
Query:  189 GRRRFAISSESWSPY---DISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRN 1037
             +RR ++S E+  P    D +  + KE      K+  +++ L++ I    +F  L  D    VI  +    V     II+QGD GD+FYV++ G  D ++ +       +N+     SFG+LAL+YNSPR+AT++A +  +LW ++R TF+ I++  +  KR+ Y + + S+P+  SL   +R  +ADA+  K Y     IIR+GD G++ Y IE G V V      V   I+ L    YFGE++L+ + PR AT+   +RT V  L +S F+RLLGP ++VL+ N
Sbjct:  140 AQRRTSVSGETLQPNNFDDWTPDHYKE------KSEQQLQRLEKSIRNNFLFNKLDSDSKRLVINCLEEKSVPKGATIIKQGDQGDYFYVVEKGTVDFYVNDN-----KVNSSGPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLMYDDLLKSMPVLKSLTTYDRAKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSKKGQGV---INKLKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGFQRLLGPAVDVLKLN 411          
BLAST of SMED30004218 vs. Ensembl Nematostella
Match: EDO38262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH8])

HSP 1 Score: 219.164 bits (557), Expect = 5.517e-67
Identity = 130/377 (34.48%), Postives = 216/377 (57.29%), Query Frame = -2
Query:  156 IRELLIDFTLAALEIKPANLIEFSANYFQNL-LTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDK-------RGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGN---VRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQEL 1253
            + +LL DFT+  L  KP ++++F+ANYF  L L E+     K    ++        N    D++ + + DD+       R  RR ++ +E + P   S     E      KT  + + L   I  I +FK L  ++++EV+ AM     +A D II QGD GD+FYVI  G +D++++      + + +Y+N+GSFG+LAL+YN+PR+ATI++ + G++W ++R TF+ I++  A  KR  +   + +VPL   +   ER+++ADA+  + +     II+QGD    MYF+ESG V + + + +      +I+   KG YFGEL+L+T+  RAA++  +   V   L+  +FERLLGPC+++++RN   YE  LQ+L
Sbjct:    9 LSDLLQDFTVHVLREKPEDIVDFAANYFMKLKLKEKRSQKGKKKNKEKGVSFGPPGNDE--DDTYNEDEDDEMPEPPKNRYARRQSVCAEPFHP--DSEDEGDEQPIVYPKTDEQRQRLNDAIKNILLFKNLAKEQLNEVLDAMFERKTQAGDHIIDQGDDGDNFYVIDRGQYDIYVRID-GQEKMVGSYDNKGSFGELALMYNTPRAATIVSTSEGVIWGLDRMTFRRILLKAAAKKRKVHEALLETVPLLQEITEYERMNLADALVSRQFKDGECIIKQGDEADFMYFVESGTVSIRMHNKSDPTTEVEIAQCTKGGYFGELALITHNTRAASVYSVGDCVCASLDVHAFERLLGPCMDIMKRNIDGYEEQLQKL 380          
BLAST of SMED30004218 vs. Ensembl Nematostella
Match: EDO49534 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGJ3])

HSP 1 Score: 206.453 bits (524), Expect = 4.077e-62
Identity = 127/369 (34.42%), Postives = 195/369 (52.85%), Query Frame = -2
Query:  174 EIRELLIDFTLAALEIKPANLIEFSANYFQNLLTER----TVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVR---KQISILHKGQYFGELSLMTNKPRAATIICLERTV-VGILERSSFERLLGPCIEVLQRNALKYE 1256
            E+ +LL  F L     +P +L++F+A+YF  L T R    +   P +   D  + S      S        + + +   RR +++ E + P + +  + +  +    K+    + L+ +I  I IFK+ G D+I+ ++ AM   +V  E+ II+QGD GD+FY+I  G F+V  +    A E +      GSFG+LAL+YN PRSATI A T G+LW ++RK+F+ I++     KR  Y   +  +P+   L   ER  +ADA+    Y  +  IIRQ D    +YFIESG V + +     R   K IS    G+YFGEL+L+    R A++      V   +LE ++FERLLGPC  ++QRN   YE
Sbjct:    9 ELHKLLQSFILDVFTEQPDDLVDFAASYFSKLNTSRKPIHSSSTPSTQEEDDFYCSESLSLPSDRFKRPSYQQNHRLYLRRDSVAGEVYEPVNSNCVSAQRFYP---KSEDARKRLENVIGNIFIFKSCGKDQINMMLDAMYERVVYQEETIIRQGDAGDNFYIIDEGEFEVLFETN-GAQEKLGRLKGPGSFGELALMYNCPRSATIRACTPGVLWVLDRKSFRRILVDTTERKRRHYETLLERIPVLSQLTAYERTSLADALTTSVYRDEECIIRQDDPADCLYFIESGIVEISIRDSKDRSKVKVISTAGPGEYFGELALVNKTKRGASVHAKGGQVTCAVLEVNAFERLLGPCKGLMQRNMKTYE 373          
BLAST of SMED30004218 vs. Ensembl Nematostella
Match: EDO41163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S513])

HSP 1 Score: 200.29 bits (508), Expect = 5.066e-60
Identity = 125/369 (33.88%), Postives = 212/369 (57.45%), Query Frame = -2
Query:  147 LLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGR-RRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVF-IKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKH-MYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILG 1244
            LL +F +  ++  P +++EF+A+YF N+L +R  +   +S    K  +  +K     D+    E    +GR RR A+S+E ++P + +    K  H    K+  +   LK+ +  + +F+    +++D ++ +M    V  E++II+ GD GD+FYVI +G +DVF +     A   ++T+N  G FG+LAL++NS R+ATI+A+T G LW ++R TF  +V+  A  +R   +  + SV +   L  DE   ++DA++ K +     +IR+G+   + MYFIE GKV V V  G V K +       YFGEL+L+ N+PR+A++  +       L++  FERL+GPC E+++RNA +YE   ++L +G
Sbjct:   16 LLEEFVVKCIQENPEDIVEFAADYF-NML-KRFKEKKAAS----KQAAQSKKESEDKDDLAPAEQPIIKGRSRRAAVSAEPYNPNENADFKAK-FHP---KSEEQRNHLKKKLLELWLFEKFHREDLDVILDSMFEKKVSPEEIIIKVGDEGDNFYVINTGEYDVFALDTNTGASIKVHTFNGTGMFGELALMHNSLRNATIVAKTEGTLWALDRSTFVQVVVGGAQRRRERNIELLKSVSILKELKPDELDKVSDALYPKEFKDGEAVIREGNESAYCMYFIEKGKVRVTVKDGEVEKTVEF--DKNYFGELALVMNQPRSASVYAVGECKFASLKKDDFERLMGPCKEIMKRNAKEYEEQKKKLGIG 372          
BLAST of SMED30004218 vs. Ensembl Nematostella
Match: EDO48439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJW7])

HSP 1 Score: 167.162 bits (422), Expect = 1.810e-47
Identity = 115/352 (32.67%), Postives = 185/352 (52.56%), Query Frame = -2
Query:  177 KPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDK----RGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTY-DIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRK---QISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKY 1208
            KP N  +F   YF+ L                K E   R        +E  EH       + +RR A+S+   +  D + S  K++     KT   +  L + I++  +F  L ++E  ++  AM+++   A ++II+QGD GD+FY++ SG  DVF+ N    +  ++T    GSFG+LAL+Y +PR+ATI A+T   LW ++R T++ I++     KR  Y  F+  V + +SL   ERL +ADA+    + D D V++ QG+ G   + I  G   V +   +  +   ++S L    YFGE++L+ N+PRAAT+          L+R  FER+LGPCI++L+RN  +Y
Sbjct:   41 KPENPYKFFREYFEKL---------------EKKEETARLEAEPEQRAEVEEHPPPSKPFQRQRRGAVSAAPITE-DEATSYVKKVVPKDYKT---MAALSKAITKNILFSHLDENERSDIFDAMSLVKHGAGEIIIKQGDEGDNFYIVDSGEVDVFVNN----VGLVSTIGEGGSFGELALIYGTPRAATIKAKTDVKLWAIDRVTYRRILMGSQIRKRRMYEQFLEKVSILESLDKWERLTVADALEPTQFQDGDDVVV-QGEHGDEFFIIVEG-TAVVLQRRSANEDFIEVSRLGPSDYFGEIALVLNRPRAATVQARGTLKCVKLDRQRFERVLGPCIDILKRNIQQY 367          
BLAST of SMED30004218 vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 125.946 bits (315), Expect = 4.390e-31
Identity = 98/309 (31.72%), Postives = 155/309 (50.16%), Query Frame = -2
Query:  216 RKFESVLRKNRSSIDNSEHLEHDDK-RGR-RRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKV------GVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVG-ILERSSFERLLG 1115
            R+ ES L K RS +          + R R +R  IS+E  S   ++ S +K +  +  K +   E++K  I      K L   ++ EV+  M   + K ++ II++ +PG H YV++ G   V    +   L H+       +FG+LA+LYN  R+A++ A+T+G LW ++R+TF+TI++    ++   ++ F+ SV L   LA    L IAD I    Y+    IIRQG  G   + I+SG V       V+ D  +VR     L KG YFGE +L     R A  I  +  V   +L+R +F + +G
Sbjct:   15 RRLESELDKYRSVLQPPASAGPGGRSRARNQRQGISAEPQSAKQVADS-SKPLQRHP-KNSRSKELIKEAILDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEEGKCQV--TKEGTVLGHMGPGK---AFGELAILYNCTRTASVRAQTSGKLWAIDRQTFQTIMMKTGLMRTAEHMEFLRSVNLLKDLAESYLLKIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNVDITQRTNVHSDPVHVRN----LSKGAYFGEKALKGEDLRTANCIAGKGGVTCLVLDREAFVQFIG 312          
BLAST of SMED30004218 vs. Ensembl Medaka
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:101166375])

HSP 1 Score: 228.024 bits (580), Expect = 8.908e-70
Identity = 135/397 (34.01%), Postives = 211/397 (53.15%), Query Frame = -2
Query:  156 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGR----------------------RRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEH-INTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRK--------QISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQEL 1253
            + ELL  FT+  L  +P +L+EF+  YF  L    T    K + F     S  R  ++     E ++ D + G                       RR ++ +E+++P +      KE      KT  + + L+     I +FK L  +EI +V+ AM        + II Q D GD+FYVI+SG F++F+K   + +E  +  Y+N+GSFG+LAL+YN+PR+ATIIA + G LW ++R TF+ I++     KR  Y  FI ++PL  SL   ER+ + D +  + Y+    II QGD+    Y +ESG+V + +    + K        +I+   +GQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+++++RN   YE  LQ L
Sbjct:    9 LTELLQSFTVEVLRNQPRDLLEFALQYFTQLKDNET----KEAAFGNDQNSAPRSGKAVNFIDEAMQIDSENGEEEEDDDDDDDEEFIAPVINRFIRRASVCAEAFNPDEDE--EDKEPRVTYPKTDEQRQRLQEACRDILLFKNLDPEEISQVLDAMFEKFCTEGEHIIDQDDDGDNFYVIESGTFNIFVK--VDGIEKLVGCYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRRLYEAFIETLPLLTSLETSERMKVVDVLSTRVYNDSQQIIAQGDLADCFYIVESGQVRITMKRSRMTKKDQEEEEVEIATCTRGQYFGELALVTNKPRAASAYAVGSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLQSL 397          
BLAST of SMED30004218 vs. Ensembl Medaka
Match: prkar2aa (cAMP-dependent protein kinase type II-alpha regulatory subunit [Source:NCBI gene;Acc:101159349])

HSP 1 Score: 221.09 bits (562), Expect = 2.819e-67
Identity = 136/394 (34.52%), Postives = 216/394 (54.82%), Query Frame = -2
Query:  141 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVP-------KSSVFD-RKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISV-SNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDS-------GNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 1274
            S+ + + + ELL  +T+  L  +P++L+EF+  YF  L   R  D         K  +FD    ++    +    D+S+       R  RR ++ +E+++P D    +  + +H    KT  +   L+     I +FKTL  ++  +V+ AM  L V+ ++ +I QG  GD+FYVI+ GI+D+ +  K      +  YNN+GSFG+LAL+YN+PR+ATIIA   G LW ++R TF+ +++     KR  Y  FI SVPL  +L  +ER+ I D + MK +     II QG+  +  Y +ESG+V + + S        N   +I+   +GQYFGEL+L+TNKPRAA+   +      +++  +FERLLG C E+++RN   YE  L  L   +M
Sbjct:    2 SIEIPVGLTELLQGYTVEVLRQRPSDLVEFAVQYFTRLRDSRGQDGAGTGAKQGKGVMFDGEPMQTESNGDDEEDDDSDFEPPPPSRFNRRVSVCAEAFNPDDDDEDTEPRVVHP---KTDEQRCRLQEACRDILLFKTLDQEQFSQVLDAMFELKVQPQEHVIDQGHDGDNFYVIERGIYDIVVSGKC-----VGQYNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKRRMYETFIESVPLLKTLEPNERMKIVDVLGMKQFLDGERIIAQGEKAECFYIVESGEVKIMMKSKTKADHADNAEVEITRCSRGQYFGELALVTNKPRAASAYAVGDVKCLVIDVQAFERLLGSCKEIMKRNISHYEEQLVALFGSSM 387          
BLAST of SMED30004218 vs. Ensembl Medaka
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:101166375])

HSP 1 Score: 213.001 bits (541), Expect = 4.835e-64
Identity = 130/397 (32.75%), Postives = 209/397 (52.64%), Query Frame = -2
Query:  156 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGR----------------------RRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEH-INTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRK--------QISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQEL 1253
            + ELL  FT+  L  +P +L+EF+  YF  L    T    K + F     S  R  ++     E ++ D + G                       RR ++ +E+++P D    + +        ++ + ++   L     IF+    +EI +V+ AM        + II Q D GD+FYVI+SG F++F+K   + +E  +  Y+N+GSFG+LAL+YN+PR+ATIIA + G LW ++R TF+ I++     KR  Y  FI ++PL  SL   ER+ + D +  + Y+    II QGD+    Y +ESG+V + +    + K        +I+   +GQYFGEL+L+TNKPRAA+   +      +++  +FERLLGPC+++++RN   YE  LQ L
Sbjct:    9 LTELLQSFTVEVLRNQPRDLLEFALQYFTQLKDNET----KEAAFGNDQNSAPRSGKAVNFIDEAMQIDSENGEEEEDDDDDDDEEFIAPVINRFIRRASVCAEAFNP-DEDEEDKEPRRGFKFVSSPQPKMFDILF----IFQ----EEISQVLDAMFEKFCTEGEHIIDQDDDGDNFYVIESGTFNIFVK--VDGIEKLVGCYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRRLYEAFIETLPLLTSLETSERMKVVDVLSTRVYNDSQQIIAQGDLADCFYIVESGQVRITMKRSRMTKKDQEEEEVEIATCTRGQYFGELALVTNKPRAASAYAVGSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLQSL 390          
BLAST of SMED30004218 vs. Ensembl Medaka
Match: prkar2aa (cAMP-dependent protein kinase type II-alpha regulatory subunit [Source:NCBI gene;Acc:101159349])

HSP 1 Score: 202.216 bits (513), Expect = 2.676e-60
Identity = 130/387 (33.59%), Postives = 206/387 (53.23%), Query Frame = -2
Query:  141 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVP-------KSSVFD-RKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISV-SNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNM 1274
            S+ + + + ELL  +T+  L  +P++L+EF+  YF  L   R  D         K  +FD    ++    +    D+S+       R  RR ++ +E+++P D    +  + +H    KT  +   L+     I +FKTL  ++  +V+ AM  L V+ ++ +I QG  GD+FYVI+ GI+D+ +  K      +  YNN+GSFG+LAL+YN+PR+ATIIA   G LW ++R TF+ +++     KR  Y  FI SVPL  +L  +ER+ I D + MK +     II Q                 + D+  V  +I+   +GQYFGEL+L+TNKPRAA+   +      +++  +FERLLG C E+++RN   YE  L  L   +M
Sbjct:    2 SIEIPVGLTELLQGYTVEVLRQRPSDLVEFAVQYFTRLRDSRGQDGAGTGAKQGKGVMFDGEPMQTESNGDDEEDDDSDFEPPPPSRFNRRVSVCAEAFNPDDDDEDTEPRVVHP---KTDEQRCRLQEACRDILLFKTLDQEQFSQVLDAMFELKVQPQEHVIDQGHDGDNFYVIERGIYDIVVSGKC-----VGQYNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKRRMYETFIESVPLLKTLEPNERMKIVDVLGMKQFLDGERIIAQTKAD-------------HADNAEV--EITRCSRGQYFGELALVTNKPRAASAYAVGDVKCLVIDVQAFERLLGSCKEIMKRNISHYEEQLVALFGSSM 365          
BLAST of SMED30004218 vs. Ensembl Medaka
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:101155602])

HSP 1 Score: 176.407 bits (446), Expect = 2.313e-50
Identity = 116/372 (31.18%), Postives = 191/372 (51.34%), Query Frame = -2
Query:  177 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDD-----------KRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISI--LHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKY 1253
            ++E +++  +A    KP   ++F   +F+ L  E               + ++ + +S   NS+   HDD           K  RRR  +S+E ++  D +VS  +++     KT T    L + IS+  +F  L D+E  ++  AM  +   A + +IQQGD GD+FYVI  G  DV++       E +      GSFG+LAL+Y +PR+AT+ A+T   LW ++R +++ I++     KR  Y  F+S V + +SL   ERL +ADA+    ++    I+ QG+ G   + I  G   V     +  + + +  L    YFGE++L+ N+PRAAT++         L+R  FER+LGPC E+L+RN  +Y
Sbjct:   30 LKECIVNLCIA----KPERPMKFLREHFEKLEKEEC-------------KHIMARQKS---NSQSDSHDDEVSPPPPNPVVKARRRRGGVSAEVYTEED-AVSYVRKVIPKDYKTMT---ALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNG-----ELVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGIASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRY 372          
BLAST of SMED30004218 vs. Planmine SMEST
Match: SMESG000023337.1 (SMESG000023337.1)

HSP 1 Score: 801.586 bits (2069), Expect = 0.000e+0
Identity = 390/390 (100.00%), Postives = 390/390 (100.00%), Query Frame = -2
Query:  126 MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQNNAP 1295
            MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQNNAP
Sbjct:    1 MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQNNAP 390          
BLAST of SMED30004218 vs. Planmine SMEST
Match: SMESG000057377.1 (SMESG000057377.1)

HSP 1 Score: 262.307 bits (669), Expect = 1.509e-83
Identity = 147/374 (39.30%), Postives = 233/374 (62.30%), Query Frame = -2
Query:  156 SLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDI-SVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQEL 1274
            + PL      +L  FT A +E KP N I F++ YF  L   +++D   SS     F SV     S  D+ + L+      RR+ ++++E ++P D+ S+    E+H    K+  +   L+++  ++SIFK+L + ++  +I AM  + VK    II +GD GD+FY+I+SGI+D FI       + I TY+N+G+FG+LAL+YN+ R+A+IIA T+GI+W + R+ F+++V++KAH +R  Y   +  VP+   L++ ER +IADA+  K      +II +GD G HMYFI SGKV +Y  +   +  I+ L  G+YFGEL+L++N+PRAA +  LE TV+ +L+  SFERL+GPCIEV++RN   Y+ ++ +L
Sbjct:    4 NFPLPPHYVSILHQFTYAVMERKPTNYIHFASKYFTRLQNNQSLDRITSS-----FGSVSLSEASDNDSVDTLDSKQYANRRK-SVAAERFNPEDLNSLDIQMEVHE---KSEEQRSRLRKVCEKVSIFKSLSNADVTSIIDAMYEIKVKPGQEIIVEGDSGDNFYIIESGIYDAFITVN-GEKKKIKTYDNEGNFGELALMYNALRAASIIASTSGIIWAVTRQVFRSVVLVKAHRQREMYNKLLEQVPMLAPLSDFERANIADALTPKECISKELIIVEGDPGYHMYFIISGKVEIYRTTVEEKVVINELGPGKYFGELALLSNQPRAANVKALEDTVLAVLDVKSFERLMGPCIEVMKRNMDDYKKNVVDL 367          
BLAST of SMED30004218 vs. Planmine SMEST
Match: SMESG000017499.1 (SMESG000017499.1)

HSP 1 Score: 252.677 bits (644), Expect = 7.627e-80
Identity = 140/378 (37.04%), Postives = 230/378 (60.85%), Query Frame = -2
Query:  126 IRELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDS--GNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQNNAP 1253
            + ELL +F ++ L  KP NL+ ++  YF++L          SS  +    S    +    DN ++++   +RGRR+ ++++ES+ P      +   ++S   KT  +   L   I  I +F++L D++  +VI +M  ++V+++  +I QGD GD FYVI+ G+FD+F+         I  Y++ GSFG+LAL+YN+PR+ATII+ T GILW M+RKTF+ IV+  A  KR  Y   + SV L D L++ +R ++ADA+  +TY+   +I+ QG  G  M+FIE+G+V V  D+  G+  K+++ LHKG YFGE++L+  +PR A++  + +T V +L+  SFERLLGPCI ++++N  KY   L+E++   +    P
Sbjct:   12 LTELLQNFAISVLRHKPHNLVHYAFEYFKDL----------SSKHEEINNSGNHTHSEDSDNDDNIKKQVQRGRRQ-SVAAESFDPEKEDDEDLPVIYS---KTDAQRSRLVEAIKPIFLFRSLDDEQRGKVIDSMREVVVESDQKVIVQGDGGDDFYVIEKGMFDIFVNGS-----KIGNYSDTGSFGELALMYNTPRAATIISVTNGILWAMDRKTFRHIVLKNAFKKRQMYEGLLQSVDLLDELSSYDRTNVADALVSRTYEDSEMILEQGKPGMEMFFIENGEVRVIRDTNDGSPPKEVNRLHKGDYFGEVALLIKEPRLASVYAVGKTTVAVLDIKSFERLLGPCINLMKKNLPKYRNQLREILGSKVDEMVP 370          
BLAST of SMED30004218 vs. Planmine SMEST
Match: SMESG000023850.1 (SMESG000023850.1)

HSP 1 Score: 248.825 bits (634), Expect = 2.677e-78
Identity = 135/367 (36.78%), Postives = 225/367 (61.31%), Query Frame = -2
Query:  153 ELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSID--NSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAMNMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQELI 1247
            E+L+D T   L+ +P + +E+ +NYF  +  E+  +    S  + + +S +     S+D  +SE +E   K   RR ++++E        + +  ++++   KT  + + LK +  +I +F+ L DD+++ VI AM ++  K  + II QGD GD+FYVI SGIF+ +IK+  +  + I+ Y N+G FG+LAL+YN+ RSAT+ A TAG LW M+RKTF+++V+++ H ++  Y  F+   P+F  +   ER++IADA+  K YD   VII+QG  G+ M+FIE+G+V +         +I+ LH GQYFGEL+L++N+ R A+   +  T   +L+  +FERL+GPC+E+++RN   Y   L+ L 
Sbjct:   14 EMLVDLTFEVLKDQPDDFVEYVSNYFLKIYDEQGHNKVYKSPHNDQSDSFVNSLLDSLDSIDSEDIEVKPKANYRRKSVAAERIDM--DDIDDDDDIYAVIPKTDEQRQRLKEVCKQILLFQALDDDQLNHVINAMFLVEPKPGENIIVQGDDGDNFYVIDSGIFNCYIKDG-DKDKLIHVYENEGFFGELALMYNAVRSATVTAETAGTLWAMDRKTFRSLVVVQTHNRKQIYDTFLKQFPIFQEMTASERMNIADALVPKKYDDKEVIIKQGRPGQEMFFIENGEVLITKVHQGKEIEITRLHVGQYFGELALLSNQARQASAQAVGETRCAMLDVKTFERLMGPCLEIMKRNIEDYNTQLENLF 377          
BLAST of SMED30004218 vs. Planmine SMEST
Match: SMESG000019065.1 (SMESG000019065.1)

HSP 1 Score: 241.121 bits (614), Expect = 2.249e-75
Identity = 137/367 (37.33%), Postives = 223/367 (60.76%), Query Frame = -2
Query:  162 RELLIDFTLAALEIKPANLIEFSANYFQNLLTERTVDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSPYDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAM-NMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALE-HINTYNNQGSFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVNFISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESGKVGVYV-DSG-NVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGILERSSFERLLGPCIEVLQRNALKYEVSLQ 1250
            +ELL DFT+  L   P ++I+F  +YF+   +E+     +S+  D + E+         D  E L    +   RR  +++ES+ P      N + +     KT  +   L   +  I +F+ L ++++ +VI AM    +V+ E VIIQ G+ GD+FYVI+SG +D+ +K   N ++  +  Y+  GSFG+LAL+YN+PR+ATI     G++W M R+TF++IV+ KA  KR+ Y   + +VPL   L+  ER++IADA+  + Y+ ++ II+QG+ G  MYF+E G V V V ++G +   +++ +  G YFGEL+L+T  PRAA++ C+E+T + IL+  SFERLLGPC++++QR+   YE  L+
Sbjct:   13 KELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQL----QSAHLDSESEN--------DDQMEELPPMPRPQGRRRGVAAESFDPEKEDDPNQERIVYP--KTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQ-GEDGDNFYVIESGTYDIIVK--INGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLK 362          
The following BLAST results are available for this feature:
BLAST of SMED30004218 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKAR2A1.503e-7035.70protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2A1.503e-7035.70protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2A3.510e-6434.88protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2B8.075e-6232.30protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2B8.075e-6232.30protein kinase cAMP-dependent type II regulatory s... [more]
back to top
BLAST of SMED30004218 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-24.347e-4330.35cAMP-dependent protein kinase regulatory subunit ... [more]
kin-26.118e-4332.09cAMP-dependent protein kinase regulatory subunit ... [more]
kin-26.516e-4330.35cAMP-dependent protein kinase regulatory subunit ... [more]
egl-41.178e-2828.87cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-41.178e-2828.87cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of SMED30004218 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pka-R21.745e-8137.37gene:FBgn0022382 transcript:FBtr0088437[more]
Pka-R21.745e-8137.37gene:FBgn0022382 transcript:FBtr0088438[more]
Pka-R22.690e-7737.33gene:FBgn0022382 transcript:FBtr0112901[more]
Pka-R22.583e-7636.83gene:FBgn0022382 transcript:FBtr0112902[more]
Pka-R13.279e-5031.88gene:FBgn0259243 transcript:FBtr0302643[more]
back to top
BLAST of SMED30004218 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar2aa2.218e-7034.54protein kinase, cAMP-dependent, regulatory, type I... [more]
PRKAR2B6.487e-6834.05si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
PRKAR2B1.512e-6533.60si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
prkar2ab3.320e-6532.85protein kinase, cAMP-dependent, regulatory, type I... [more]
PRKAR2B2.018e-6333.69si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
back to top
BLAST of SMED30004218 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ednrb21.047e-7235.29endothelin receptor B subtype 2 [Source:Xenbase;Ac... [more]
ednrb21.287e-7134.49endothelin receptor B subtype 2 [Source:Xenbase;Ac... [more]
ednrb22.149e-6533.25endothelin receptor B subtype 2 [Source:Xenbase;Ac... [more]
fgf14.662e-6433.92fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
fgf19.552e-6333.25fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of SMED30004218 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkar2a1.170e-7235.64protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2a5.201e-6635.08protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2b1.188e-6233.41protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2b1.188e-6233.41protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2b9.715e-5940.87protein kinase, cAMP dependent regulatory, type II... [more]
back to top
BLAST of SMED30004218 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P81900|KAPR2_DROME1.750e-8037.37cAMP-dependent protein kinase type II regulatory s... [more]
sp|Q26619|KAPR_STRPU5.744e-7236.19cAMP-dependent protein kinase type II regulatory s... [more]
sp|P00515|KAP2_BOVIN3.434e-7034.70cAMP-dependent protein kinase type II-alpha regula... [more]
sp|P13861|KAP2_HUMAN7.218e-7035.70cAMP-dependent protein kinase type II-alpha regula... [more]
sp|P12368|KAP2_RAT7.969e-7035.40cAMP-dependent protein kinase type II-alpha regula... [more]
back to top
BLAST of SMED30004218 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S5CG551.031e-7839.05Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A2T7NFW13.192e-7841.37Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A3M7STD25.006e-7837.53cAMP-dependent kinase type II regulatory subunit i... [more]
B4NX295.186e-7837.37Uncharacterized protein, isoform D OS=Drosophila y... [more]
A0A0J9R9725.186e-7837.37Uncharacterized protein, isoform C OS=Drosophila s... [more]
back to top
BLAST of SMED30004218 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-272n13.73.455e-6633.33protein kinase cAMP-dependent type II regulatory s... [more]
prkar2aa4.252e-6633.60protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar2ab7.148e-6233.33protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar1ab1.465e-5031.86cAMP-dependent protein kinase type I-alpha regulat... [more]
prkar1aa5.239e-5031.54cAMP-dependent protein kinase type I-alpha regulat... [more]
back to top
BLAST of SMED30004218 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar2aa3.155e-5441.23protein kinase, cAMP-dependent, regulatory, type I... [more]
si:ch211-272n13.76.439e-4231.46protein kinase cAMP-dependent type II regulatory s... [more]
ENSPMAT00000001198.16.993e-1926.73pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 g... [more]
ENSPMAT00000001825.13.312e-1427.21pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gen... [more]
ENSPMAT00000005026.11.804e-1036.11pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 ge... [more]
back to top
BLAST of SMED30004218 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY12.657e-5235.31Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of SMED30004218 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO382625.517e-6734.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495344.077e-6234.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411635.066e-6033.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484391.810e-4732.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384074.390e-3131.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30004218 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-272n13.78.908e-7034.01protein kinase cAMP-dependent type II regulatory s... [more]
prkar2aa2.819e-6734.52cAMP-dependent protein kinase type II-alpha regula... [more]
si:ch211-272n13.74.835e-6432.75protein kinase cAMP-dependent type II regulatory s... [more]
prkar2aa2.676e-6033.59cAMP-dependent protein kinase type II-alpha regula... [more]
prkar1b2.313e-5031.18protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of SMED30004218 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023337.10.000e+0100.00SMESG000023337.1[more]
SMESG000057377.11.509e-8339.30SMESG000057377.1[more]
SMESG000017499.17.627e-8037.04SMESG000017499.1[more]
SMESG000023850.12.677e-7836.78SMESG000023850.1[more]
SMESG000019065.12.249e-7537.33SMESG000019065.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004218 ID=SMED30004218|Name=SMED30004218|organism=Schmidtea mediterranea sexual|type=transcript|length=1383bp
TTTTTATAATATAATATATATTTTTTACATAATTGATTTGACTATATTAT
ATTAAATTATATAATTTTACTTAATTATCAATTTTTCAGTTAAAATTTTA
AAAATTTTGATTATTTTAATTAAAGAGGAGCATTGTTTTGCATGTTCCCT
AGAATGAGTTCCTGTAAAGATACCTCATATTTCAATGCATTGCGCTGTAA
AACTTCTATACATGGTCCTAAGAGTCTTTCAAAGCTAGACCTCTCTAATA
TCCCAACAACAGTCCTTTCTAAACATATTATGGTTGCTGCTCGCGGTTTG
TTTGTCATTAAGGAAAGTTCACCAAAATATTGACCTTTGTGTAGAATTGA
AATCTGCTTTCTTACATTTCCCGAATCAACATAAACTCCTACTTTTCCGC
TTTCAATAAAGTACATGTGCTTTCCAACATCTCCTTGACGAATAATCACA
GAGTCAATGTCATATGTCTTCATGTGGATCGCATCAGCGATGTGAAGTCT
TTCATCGTTTGCCAGTGAATCGAACAATGGCACAGATGAAATAAAATTTA
CATACGTTATTCTCTTCACGTGAGCTTTCAAAATAACTATTGTTTTAAAT
GTTTTTCTATTCATGTACCACAGTATTCCAGCGGTTCGAGCAATAATTGT
CGCTGATCTTGGTGAGTTATACAGCAAAGCCAGGTCTCCAAACGAGCCTT
GATTGTTGTAAGTGTTAATATGTTCCAATGCGTTGTATTTATTCTTAATG
AAAACATCGAAGATCCCAGATTGTATTACATAAAAATGATCTCCTGGATC
GCCTTGCTGAATAATTACATCCTCAGCTTTAACAATCAGCATATTCATTG
CTAAAATAACCTCATCAATCTCATCATCACCTAATGTTTTGAAAATTGAA
ATTCTTGAAATTAGTCTTTTCAAAATTTCAATTTCTGTAGTTGTTTTCAA
AGTATTTGAATGCATTTCTTTAGTATTTGACACTGAAATATCGTACGGAC
TCCAACTTTCCGAAGAAATTGCAAAACGACGTCGACCTCGTTTATCATCA
TGTTCCAGATGCTCAGAGTTATCAATGCTGGATCTGTTTTTCCGAAGAAC
TGATTCAAATTTTCTATCAAAAACTGAAGATTTTGGTACATCCACCGTTC
TTTCAGTTAGCAAATTTTGAAAATAATTTGCTGAAAACTCTATTAAATTT
GCTGGTTTGATTTCCAAGGCTGCTAAAGTGAAATCTATCAAAAGTTCTCG
AATTTCTAAATCCAAAGGTAATGATTTGCAATCGATGAAAGACATCAATA
AATTTTGTATTTTATTTTTTGTTTTGTTTTGGTAGTAATAGTTTTATTTT
GGTGGTTGTAACAATAATAATAATGATAATAAT
back to top

protein sequence of SMED30004218-orf-1

>SMED30004218-orf-1 ID=SMED30004218-orf-1|Name=SMED30004218-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=392bp
MSFIDCKSLPLDLEIRELLIDFTLAALEIKPANLIEFSANYFQNLLTERT
VDVPKSSVFDRKFESVLRKNRSSIDNSEHLEHDDKRGRRRFAISSESWSP
YDISVSNTKEMHSNTLKTTTEIEILKRLISRISIFKTLGDDEIDEVILAM
NMLIVKAEDVIIQQGDPGDHFYVIQSGIFDVFIKNKYNALEHINTYNNQG
SFGDLALLYNSPRSATIIARTAGILWYMNRKTFKTIVILKAHVKRITYVN
FISSVPLFDSLANDERLHIADAIHMKTYDIDSVIIRQGDVGKHMYFIESG
KVGVYVDSGNVRKQISILHKGQYFGELSLMTNKPRAATIICLERTVVGIL
ERSSFERLLGPCIEVLQRNALKYEVSLQELILGNMQNNAPL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
Vocabulary: INTERPRO
TermDefinition
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like