Endoplasmic reticulum chaperone BiP

Overview
NameEndoplasmic reticulum chaperone BiP
Smed IDSMED30004217
Length (bp)1956
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endoplasmic reticulum chaperone BiP (SMED30004217) t-SNE clustered cells

Violin plots show distribution of expression levels for Endoplasmic reticulum chaperone BiP (SMED30004217) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004217

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30004217h1SMcG0004940 Contig54421newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004217h1SMcG0004940 Contig54421uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA5 (heat shock protein family A (Hsp70) member 5 [Source:HGNC Symbol;Acc:HGNC:5238])

HSP 1 Score: 211.846 bits (538), Expect = 3.138e-59
Identity = 172/613 (28.06%), Postives = 302/613 (49.27%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   K       + I     T     EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ +       S   G D +E +  TRAK++EL  +      K +   L++ +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M ND E   E+D++L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  A+I D +  KK  E  ++PI+   +
Sbjct:   29 TVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGG-QTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSE-DKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLY 635          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA6 (heat shock protein family A (Hsp70) member 6 [Source:HGNC Symbol;Acc:HGNC:5239])

HSP 1 Score: 176.407 bits (446), Expect = 1.288e-46
Identity = 154/612 (25.16%), Postives = 284/612 (46.41%), Query Frame = 1
Query:   97 ETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSSS---SVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
            E  +GI  G  Y  + +  +   E++ N  G   T   V F + ++ L+G  AK  ++      V D+ + L GR F +      MK +PFR   +    K  +  +  D T Y   EEI + + + +K +AE++L   V    +TVP  F++SQ  + K    +AGL +++   +  +A  +Y ++     + NVL+ D+   + ++ V+S D    EV  T   ++ G   F   L ++ +  +++     L   K  L   R   +  +  L++S       +S+  GVD      ITRA+++EL S+      + +   L++ +L ++ I  +VL+G S  IPK+QK +++FF   EL      DEA A G  +    L   K +++  ++L D+    + +E  G +   +I+R   +P K+++ FT   D+Q  + I V EG++ + + N  LG+ E    P   RG+    +   +++NG + VTATD  T    ++ I     R++ +  E  +   E    +D         +  +E   + ++G  LQ  S   ++    D + +++   E++ W      AE  + E+ K+  E   +PI 
Sbjct:    6 ELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTER-LVGDAAKSQAALNPHNTVFDA-KRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFY--PEEISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDF--YTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNATIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGS-LQEESLRDKIPEE-DRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIF 609          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 171.014 bits (432), Expect = 9.492e-45
Identity = 155/618 (25.08%), Postives = 291/618 (47.09%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF         K  ++ K    + Y   EE+ + + T +K  AE++L   V +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  +   K  +   R   +  +  L++S       +S+  G+D      ITRA+++EL ++    T+  +EK L    ++ +L +S I  IVL+G S  IPK+QK +++FF   EL      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +  E  +   E    +D +       +  +E  A+ ++  + ++     ++      KIL +  NEII W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTVFDA-KRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYP--EEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDF--YTSITRARFEELNADLFRGTLDPVEKAL----RDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATV-EDEKLQGKINDEDKQKIL-DKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 171.014 bits (432), Expect = 9.492e-45
Identity = 155/618 (25.08%), Postives = 291/618 (47.09%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF         K  ++ K    + Y   EE+ + + T +K  AE++L   V +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  +   K  +   R   +  +  L++S       +S+  G+D      ITRA+++EL ++    T+  +EK L    ++ +L +S I  IVL+G S  IPK+QK +++FF   EL      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +  E  +   E    +D +       +  +E  A+ ++  + ++     ++      KIL +  NEII W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTVFDA-KRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYP--EEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDF--YTSITRARFEELNADLFRGTLDPVEKAL----RDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATV-EDEKLQGKINDEDKQKIL-DKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 171.014 bits (432), Expect = 9.492e-45
Identity = 155/618 (25.08%), Postives = 291/618 (47.09%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF         K  ++ K    + Y   EE+ + + T +K  AE++L   V +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  +   K  +   R   +  +  L++S       +S+  G+D      ITRA+++EL ++    T+  +EK L    ++ +L +S I  IVL+G S  IPK+QK +++FF   EL      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +  E  +   E    +D +       +  +E  A+ ++  + ++     ++      KIL +  NEII W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTVFDA-KRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYP--EEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDF--YTSITRARFEELNADLFRGTLDPVEKAL----RDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATV-EDEKLQGKINDEDKQKIL-DKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 207.223 bits (526), Expect = 5.993e-58
Identity = 168/614 (27.36%), Postives = 308/614 (50.16%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGF--DEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            TIIGI  G  Y  + +      E+I N  G   T   V F  D+ D+ LIG  AK     +    + D+ + L GR +++      +K +PF+   K+      +K+ +++     T EE+   +   +K  AES+L  +V +  +TVP  F+++Q  + K    +AGL +V+   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + +Y + LY+K + +   K+K+ +  L+REV+  +  L+T + T+    S+  G D +E +  TRAK++EL  +      K +   L++ +LK+ D+ +IVL+G S  IPK+Q+ I+ FF   E       DEA A G    G     ++    +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R++ ++   M ND E   E D++++   + R E+E  AY ++  I        ++    D K ++E+V E I W    + A   +L+  KK  E+ ++PI+   +
Sbjct:   34 TIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDR-LIGDAAKNQLTINPENTIFDA-KRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDN--KQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETL--TRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDED-DKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLY 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 207.223 bits (526), Expect = 5.993e-58
Identity = 168/614 (27.36%), Postives = 308/614 (50.16%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGF--DEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            TIIGI  G  Y  + +      E+I N  G   T   V F  D+ D+ LIG  AK     +    + D+ + L GR +++      +K +PF+   K+      +K+ +++     T EE+   +   +K  AES+L  +V +  +TVP  F+++Q  + K    +AGL +V+   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + +Y + LY+K + +   K+K+ +  L+REV+  +  L+T + T+    S+  G D +E +  TRAK++EL  +      K +   L++ +LK+ D+ +IVL+G S  IPK+Q+ I+ FF   E       DEA A G    G     ++    +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R++ ++   M ND E   E D++++   + R E+E  AY ++  I        ++    D K ++E+V E I W    + A   +L+  KK  E+ ++PI+   +
Sbjct:   34 TIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDR-LIGDAAKNQLTINPENTIFDA-KRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDN--KQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETL--TRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDED-DKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLY 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 207.223 bits (526), Expect = 5.993e-58
Identity = 168/614 (27.36%), Postives = 308/614 (50.16%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGF--DEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            TIIGI  G  Y  + +      E+I N  G   T   V F  D+ D+ LIG  AK     +    + D+ + L GR +++      +K +PF+   K+      +K+ +++     T EE+   +   +K  AES+L  +V +  +TVP  F+++Q  + K    +AGL +V+   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + +Y + LY+K + +   K+K+ +  L+REV+  +  L+T + T+    S+  G D +E +  TRAK++EL  +      K +   L++ +LK+ D+ +IVL+G S  IPK+Q+ I+ FF   E       DEA A G    G     ++    +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R++ ++   M ND E   E D++++   + R E+E  AY ++  I        ++    D K ++E+V E I W    + A   +L+  KK  E+ ++PI+   +
Sbjct:   34 TIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDR-LIGDAAKNQLTINPENTIFDA-KRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDN--KQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETL--TRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDED-DKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLY 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 207.223 bits (526), Expect = 5.993e-58
Identity = 168/614 (27.36%), Postives = 308/614 (50.16%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGF--DEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            TIIGI  G  Y  + +      E+I N  G   T   V F  D+ D+ LIG  AK     +    + D+ + L GR +++      +K +PF+   K+      +K+ +++     T EE+   +   +K  AES+L  +V +  +TVP  F+++Q  + K    +AGL +V+   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + +Y + LY+K + +   K+K+ +  L+REV+  +  L+T + T+    S+  G D +E +  TRAK++EL  +      K +   L++ +LK+ D+ +IVL+G S  IPK+Q+ I+ FF   E       DEA A G    G     ++    +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R++ ++   M ND E   E D++++   + R E+E  AY ++  I        ++    D K ++E+V E I W    + A   +L+  KK  E+ ++PI+   +
Sbjct:   34 TIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDR-LIGDAAKNQLTINPENTIFDA-KRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDN--KQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETL--TRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDED-DKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLY 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 207.223 bits (526), Expect = 5.993e-58
Identity = 168/614 (27.36%), Postives = 308/614 (50.16%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGF--DEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            TIIGI  G  Y  + +      E+I N  G   T   V F  D+ D+ LIG  AK     +    + D+ + L GR +++      +K +PF+   K+      +K+ +++     T EE+   +   +K  AES+L  +V +  +TVP  F+++Q  + K    +AGL +V+   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + +Y + LY+K + +   K+K+ +  L+REV+  +  L+T + T+    S+  G D +E +  TRAK++EL  +      K +   L++ +LK+ D+ +IVL+G S  IPK+Q+ I+ FF   E       DEA A G    G     ++    +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R++ ++   M ND E   E D++++   + R E+E  AY ++  I        ++    D K ++E+V E I W    + A   +L+  KK  E+ ++PI+   +
Sbjct:   34 TIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDR-LIGDAAKNQLTINPENTIFDA-KRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDN--KQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETL--TRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDED-DKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLY 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073610)

HSP 1 Score: 185.652 bits (470), Expect = 4.570e-50
Identity = 159/614 (25.90%), Postives = 303/614 (49.35%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKF-SRALEDYLLCLYQKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    ++    V D+ + L GR + +      +K +PF+   KN      +   T+        EEI   +   +K +AE++L  KV    +TVP  F+++Q  + K    +AGL++++   +  +A  +Y +++ E + NVLV D+   + ++ +++ D    EV+ T+  ++ G   F  R ++ ++    +K  +   K+ + +  L+REV+  +  L+ S+       S   G D +E +  TRAK++EL  +      K +   L++ ++ + D+ +IVL+G S  IPK+Q+ +++FF   E       DEA A G   + G+  G+ D  + +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   +++NG + V+A D  T  ++++VI     R+  ++ + M  D E   ++D++L+   + R E+E  AY ++  I        ++ S  +   L+ +++E I+W  +   A+  + +  KK  EA ++P++   + 
Sbjct:   30 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDA-KRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVD--TSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETL--TRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQD-TDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKL-SDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLYQ 636          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0345166)

HSP 1 Score: 185.652 bits (470), Expect = 4.570e-50
Identity = 159/614 (25.90%), Postives = 303/614 (49.35%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKF-SRALEDYLLCLYQKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    ++    V D+ + L GR + +      +K +PF+   KN      +   T+        EEI   +   +K +AE++L  KV    +TVP  F+++Q  + K    +AGL++++   +  +A  +Y +++ E + NVLV D+   + ++ +++ D    EV+ T+  ++ G   F  R ++ ++    +K  +   K+ + +  L+REV+  +  L+ S+       S   G D +E +  TRAK++EL  +      K +   L++ ++ + D+ +IVL+G S  IPK+Q+ +++FF   E       DEA A G   + G+  G+ D  + +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   +++NG + V+A D  T  ++++VI     R+  ++ + M  D E   ++D++L+   + R E+E  AY ++  I        ++ S  +   L+ +++E I+W  +   A+  + +  KK  EA ++P++   + 
Sbjct:   30 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDA-KRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVD--TSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETL--TRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQD-TDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKL-SDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLYQ 636          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073609)

HSP 1 Score: 185.652 bits (470), Expect = 4.570e-50
Identity = 159/614 (25.90%), Postives = 303/614 (49.35%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKF-SRALEDYLLCLYQKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    ++    V D+ + L GR + +      +K +PF+   KN      +   T+        EEI   +   +K +AE++L  KV    +TVP  F+++Q  + K    +AGL++++   +  +A  +Y +++ E + NVLV D+   + ++ +++ D    EV+ T+  ++ G   F  R ++ ++    +K  +   K+ + +  L+REV+  +  L+ S+       S   G D +E +  TRAK++EL  +      K +   L++ ++ + D+ +IVL+G S  IPK+Q+ +++FF   E       DEA A G   + G+  G+ D  + +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   +++NG + V+A D  T  ++++VI     R+  ++ + M  D E   ++D++L+   + R E+E  AY ++  I        ++ S  +   L+ +++E I+W  +   A+  + +  KK  EA ++P++   + 
Sbjct:   30 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDA-KRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVD--TSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETL--TRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQD-TDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKL-SDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLYQ 636          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073611)

HSP 1 Score: 185.652 bits (470), Expect = 4.570e-50
Identity = 159/614 (25.90%), Postives = 303/614 (49.35%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKF-SRALEDYLLCLYQKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    ++    V D+ + L GR + +      +K +PF+   KN      +   T+        EEI   +   +K +AE++L  KV    +TVP  F+++Q  + K    +AGL++++   +  +A  +Y +++ E + NVLV D+   + ++ +++ D    EV+ T+  ++ G   F  R ++ ++    +K  +   K+ + +  L+REV+  +  L+ S+       S   G D +E +  TRAK++EL  +      K +   L++ ++ + D+ +IVL+G S  IPK+Q+ +++FF   E       DEA A G   + G+  G+ D  + +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   +++NG + V+A D  T  ++++VI     R+  ++ + M  D E   ++D++L+   + R E+E  AY ++  I        ++ S  +   L+ +++E I+W  +   A+  + +  KK  EA ++P++   + 
Sbjct:   30 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDA-KRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVD--TSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETL--TRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQD-TDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKL-SDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLYQ 636          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073608)

HSP 1 Score: 185.652 bits (470), Expect = 4.570e-50
Identity = 159/614 (25.90%), Postives = 303/614 (49.35%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKF-SRALEDYLLCLYQKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    ++    V D+ + L GR + +      +K +PF+   KN      +   T+        EEI   +   +K +AE++L  KV    +TVP  F+++Q  + K    +AGL++++   +  +A  +Y +++ E + NVLV D+   + ++ +++ D    EV+ T+  ++ G   F  R ++ ++    +K  +   K+ + +  L+REV+  +  L+ S+       S   G D +E +  TRAK++EL  +      K +   L++ ++ + D+ +IVL+G S  IPK+Q+ +++FF   E       DEA A G   + G+  G+ D  + +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   +++NG + V+A D  T  ++++VI     R+  ++ + M  D E   ++D++L+   + R E+E  AY ++  I        ++ S  +   L+ +++E I+W  +   A+  + +  KK  EA ++P++   + 
Sbjct:   30 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDA-KRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVD--TSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETL--TRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQD-TDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKL-SDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLYQ 636          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 204.912 bits (520), Expect = 5.854e-57
Identity = 168/617 (27.23%), Postives = 308/617 (49.92%), Query Frame = 1
Query:   88 ETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTF-DEIVS--MKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            E+  T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+ D  V   +K +PF+   K       + I +  M ++   EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L+  +       S   G D +E +  TRAK++EL  +      K +   L++ +LK+ DI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G+++  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  ++   M N+ E   ++D++L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  A++ + +  KK  E  ++PI+   +
Sbjct:   23 ESVGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTTEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWGDSSVQQDIKYFPFKVIEKKNKPHIQLDIGSGQMKTFAP-EEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKRDGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSAQHQARIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLEDSDLKKPDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEETGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNEAERFADEDKKLKERIDSRNELESYAYSLKNQIGDKEKLGGKLSSE-DKEAIEKAVEEKIEWLEAHQDADLEEFQAKKKELEEVVQPIVSKLY 633          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hsc70 (heat shock cognate 70 [Source:ZFIN;Acc:ZDB-GENE-040426-1221])

HSP 1 Score: 168.703 bits (426), Expect = 3.797e-44
Identity = 149/615 (24.23%), Postives = 290/615 (47.15%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKD--DQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERI---NVKENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + S  V D+ + L GR FD+ V    MK +PF+        K  ++ K    T +   EE+ + + T +K  +E++L   V +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  +   K  +   R   +  +  L++S       +S+  G D      ITRA+++EL ++      + +   L++ ++ ++ I  IVL+G S  IPK+QK +++FF   +L      DEA A G          D  + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R+   +++      D++  E + + E     +  +E +A+ ++  +  +   +Q   SP D K + +  NE+I W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPSNTVFDA-KRLIGRRFDDPVVQSDMKHWPFKVISDGSKPKMEVEYKGEIKTFFP--EEVSSMVLTKMKEISEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGADF--YTSITRARFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILTGDTSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEADQYRAEDEVQRE-KVTAKNTLESLAFNMKSTVEDDK--LQDKISPEDKKTITDKCNEVISWLDKNQTAEKDEYEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hsc70 (heat shock cognate 70 [Source:ZFIN;Acc:ZDB-GENE-040426-1221])

HSP 1 Score: 168.703 bits (426), Expect = 3.797e-44
Identity = 149/615 (24.23%), Postives = 290/615 (47.15%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKD--DQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERI---NVKENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + S  V D+ + L GR FD+ V    MK +PF+        K  ++ K    T +   EE+ + + T +K  +E++L   V +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  +   K  +   R   +  +  L++S       +S+  G D      ITRA+++EL ++      + +   L++ ++ ++ I  IVL+G S  IPK+QK +++FF   +L      DEA A G          D  + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R+   +++      D++  E + + E     +  +E +A+ ++  +  +   +Q   SP D K + +  NE+I W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPSNTVFDA-KRLIGRRFDDPVVQSDMKHWPFKVISDGSKPKMEVEYKGEIKTFFP--EEVSSMVLTKMKEISEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGADF--YTSITRARFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILTGDTSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEADQYRAEDEVQRE-KVTAKNTLESLAFNMKSTVEDDK--LQDKISPEDKKTITDKCNEVISWLDKNQTAEKDEYEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 163.31 bits (412), Expect = 3.009e-42
Identity = 152/618 (24.60%), Postives = 292/618 (47.25%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF     N   K  ++ K    + Y   EEI + + T +K  AE++L   V +  +TVP  F++SQ  + K    ++GL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  + + K  +   R   +  +  L++S       +S+  G+D      ITRA+++EL ++    T+  +EK L    ++ ++ ++ I  IVL+G S  IPK+QK ++++F   EL      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +  E  +   E    +D         +  +E  A+ ++  + ++     ++      KIL +  NE+I W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTVFDA-KRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYP--EEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDF--YTSITRARFEELNADLFRGTLDPVEKAL----RDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTV-EDEKLKGKISDEDKQKIL-DKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 163.31 bits (412), Expect = 3.009e-42
Identity = 152/618 (24.60%), Postives = 292/618 (47.25%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF     N   K  ++ K    + Y   EEI + + T +K  AE++L   V +  +TVP  F++SQ  + K    ++GL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  + + K  +   R   +  +  L++S       +S+  G+D      ITRA+++EL ++    T+  +EK L    ++ ++ ++ I  IVL+G S  IPK+QK ++++F   EL      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +  E  +   E    +D         +  +E  A+ ++  + ++     ++      KIL +  NE+I W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTVFDA-KRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYP--EEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDF--YTSITRARFEELNADLFRGTLDPVEKAL----RDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTV-EDEKLKGKISDEDKQKIL-DKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 207.223 bits (526), Expect = 1.583e-57
Identity = 170/625 (27.20%), Postives = 305/625 (48.80%), Query Frame = 1
Query:   52 VTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
             ++FA   +   E   T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   +       + I   D       EEI   +   +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ + +     S   G D +E +  TRAK++EL  +      K +   L + +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M  D E   E+D++L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  ++I + +  KK  E  ++PI+
Sbjct:   15 ASVFAADDDDKREDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDI--GDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSE-DKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIV 632          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 207.223 bits (526), Expect = 1.641e-57
Identity = 174/639 (27.23%), Postives = 312/639 (48.83%), Query Frame = 1
Query:   25 YLNLLKFSFV-----TIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
            ++N L F+ V     ++FA   +   E   T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   +       + I   D       EEI   +   +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ + +     S   G D +E +  TRAK++EL  +      K +   L + +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M  D E   E+D++L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  ++I + +  KK  E  ++PI+
Sbjct:    3 HMNFL-FALVLLVSASVFAADDDDKREDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDI--GDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSE-DKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIV 633          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 206.838 bits (525), Expect = 1.840e-57
Identity = 170/625 (27.20%), Postives = 305/625 (48.80%), Query Frame = 1
Query:   52 VTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
             ++FA   +   E   T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   +       + I   D       EEI   +   +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ + +     S   G D +E +  TRAK++EL  +      K +   L + +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M  D E   E+D++L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  ++I + +  KK  E  ++PI+
Sbjct:   15 ASVFAADDDDKREDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDI--GDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSE-DKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIV 632          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 206.453 bits (524), Expect = 2.612e-57
Identity = 170/625 (27.20%), Postives = 305/625 (48.80%), Query Frame = 1
Query:   52 VTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
             ++FA   +   E   T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   +       + I   D       EEI   +   +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ + +     S   G D +E +  TRAK++EL  +      K +   L + +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M  D E   E+D++L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  ++I + +  KK  E  ++PI+
Sbjct:   15 ASVFAADDDDKREDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDI--GDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSE-DKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIV 632          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 188.734 bits (478), Expect = 2.688e-51
Identity = 157/569 (27.59%), Postives = 277/569 (48.68%), Query Frame = 1
Query:   52 VTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHI 1722
             ++FA   +   E   T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   +       + I   D       EEI   +   +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ + +     S   G D +E +  TRAK++EL  +      K +   L + +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M  D E   E+D++L+     R E+E  AY ++  I
Sbjct:   15 ASVFAADDDDKREDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDI--GDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQI 577          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa5 (heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95835])

HSP 1 Score: 211.846 bits (538), Expect = 2.083e-59
Identity = 172/613 (28.06%), Postives = 302/613 (49.27%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   K       + I     T     EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ +       S   G D +E +  TRAK++EL  +      K +   L++ +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M ND E   E+D++L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  A+I D +  KK  E  ++PI+   +
Sbjct:   30 TVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGG-QTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSE-DKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLY 636          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa5 (heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95835])

HSP 1 Score: 211.846 bits (538), Expect = 2.083e-59
Identity = 172/613 (28.06%), Postives = 302/613 (49.27%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   K       + I     T     EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ +       S   G D +E +  TRAK++EL  +      K +   L++ +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M ND E   E+D++L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  A+I D +  KK  E  ++PI+   +
Sbjct:   30 TVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGG-QTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSE-DKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLY 636          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 171.014 bits (432), Expect = 6.392e-45
Identity = 155/618 (25.08%), Postives = 291/618 (47.09%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF         K  ++ K    + Y   EE+ + + T +K  AE++L   V +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  +   K  +   R   +  +  L++S       +S+  G+D      ITRA+++EL ++    T+  +EK L    ++ +L +S I  IVL+G S  IPK+QK +++FF   EL      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +  E  +   E    +D +       +  +E  A+ ++  + ++     ++      KIL +  NEII W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTVFDA-KRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYP--EEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDF--YTSITRARFEELNADLFRGTLDPVEKAL----RDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATV-EDEKLQGKINDEDKQKIL-DKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 164.851 bits (416), Expect = 7.791e-43
Identity = 154/620 (24.84%), Postives = 288/620 (46.45%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE---TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFG-KDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERIN-------VKENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            IGI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK   + +    I   + L GR F++      MK +PFR   +    K  ++ K  +M ++   EEI + + T +K  AE++L  KV S  +TVP  F++SQ  + K    + GL +++   +  +A  +Y +++      + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   +  +L   +++  +  +   K  +   R   +  +  L++S       +S+  GVD      ITRA+++EL ++      + +   L++ +L +  I +IVL+G S  IPK+QK +++FF   EL      DEA A G   +  +  G K + +  ++L D+    + IE  G +   +I+R   +P K+++ FT   D+Q  +++ V EG++ + + N  LG+ +    P   RG+    +   +++NG + VTA D  T  + ++ I     R++       V+E      E    +DR   +A K    +E   Y I+   +++     ++      KIL +   E+I W  +   AE  + E+ +K  E    PI+   + 
Sbjct:    8 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYK-GEMKTFFP-EEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDF--YTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDR---VAAK--NAVESYTYNIK-QTVEDEKLRGKISEQDKNKIL-DKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 164.851 bits (416), Expect = 7.791e-43
Identity = 154/620 (24.84%), Postives = 288/620 (46.45%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE---TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFG-KDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERIN-------VKENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            IGI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK   + +    I   + L GR F++      MK +PFR   +    K  ++ K  +M ++   EEI + + T +K  AE++L  KV S  +TVP  F++SQ  + K    + GL +++   +  +A  +Y +++      + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   +  +L   +++  +  +   K  +   R   +  +  L++S       +S+  GVD      ITRA+++EL ++      + +   L++ +L +  I +IVL+G S  IPK+QK +++FF   EL      DEA A G   +  +  G K + +  ++L D+    + IE  G +   +I+R   +P K+++ FT   D+Q  +++ V EG++ + + N  LG+ +    P   RG+    +   +++NG + VTA D  T  + ++ I     R++       V+E      E    +DR   +A K    +E   Y I+   +++     ++      KIL +   E+I W  +   AE  + E+ +K  E    PI+   + 
Sbjct:    8 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYK-GEMKTFFP-EEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDF--YTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDR---VAAK--NAVESYTYNIK-QTVEDEKLRGKISEQDKNKIL-DKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|P06761|BIP_RAT (Endoplasmic reticulum chaperone BiP OS=Rattus norvegicus OX=10116 GN=Hspa5 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.078e-59
Identity = 173/613 (28.22%), Postives = 303/613 (49.43%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   K       + I     T     EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ +       S   G D +E +  TRAK++EL  +      K +   L++ +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M ND E   E+D++L+     R E+E  AY ++  I        ++ SP D + ++++V E IEW   +  A+I D +  KK  E  ++PI+   +
Sbjct:   29 TVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGG-QTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKL-SPEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLY 635          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q24895|BIP_ECHMU (Endoplasmic reticulum chaperone BiP OS=Echinococcus multilocularis OX=6211 GN=GRP78 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 3.003e-59
Identity = 167/641 (26.05%), Postives = 323/641 (50.39%), Query Frame = 1
Query:   16 MAVYLNLLKFSFVTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKM-TETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            ++ Y+       +T+    S  G E   T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK   +S+    +   + L GR +D+      +K+YPF+   KN      +++ + +       EE+   + + +K  AE++L ++V    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T   ++ G   F + L DY + LY+K   +   K+ + +  L+REV+  +  L+T + T    +++  G D +E  P+TRA+++EL ++      K ++  +++  LK+ DI  IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G +D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N FLG+ +    P   RGL    +   ++ NG + V+A D  T  +  +VI K   R+  +  E  + + E  +++D++++   ++R ++E +AY I+  +        ++ S  ++K ++++ +E I+W      AE +D +  K   E+ ++PI+   + 
Sbjct:    3 LSTYVGTFLLCILTLSHCKS--GKEEYGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFSGDGERLIGDAAKNQLTSNPKNTLFDAKRLIGRDYDDKDVQGDIKRYPFKVINKNNKPYMKVQVGSEE--KGFAPEEVSAMVLSKMKEIAEAYLGTEVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVLRIINEPTAAAIAYGLDKKDTEKNILVFDLGGGTFDVSLLTIDNGVFEVVATSGDTHLGGEDFDQRLIDYFVKLYKKKEGKDITKDDRAVQKLRREVEKAKRTLSTEHSTMIEIDNLFEGKDFSE--PLTRARFEELNNDLFRSTLKPVMKVMEDSGLKKEDIDDIVLVGGSTRIPKIQQLVKEFFNVKEPSRGINPDEAVAYGAAVQAGVISGVEDTGDIVLL-DVCPLTMGIETVGGVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHFLGKFDLTGIPPAPRGLPQIEVTFEIDVNGILRVSAEDKGTGKKSNIVINKETNRLTPEEIERMIQDAEKFSDQDKQVKERVEVRNDLESLAYSIKNQVKDKEKMGGKL-SDDEIKTIEDAADEAIKWMENNPQAETSDYKKQKANLESVVQPIVSKLYE 635          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q90593|BIP_CHICK (Endoplasmic reticulum chaperone BiP OS=Gallus gallus OX=9031 GN=HSPA5 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 4.145e-59
Identity = 171/613 (27.90%), Postives = 303/613 (49.43%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   K       + +     T     EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ +       S   G D +E +  TRAK++EL  +      K +   L++ +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M ND E   E+D++L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  A+I D ++ KK  E  ++PI+   +
Sbjct:   27 TVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKYLPFKVVEKKAKPHIQVDVGGG-QTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDARNELESYAYSLKNQIGDKEKLGGKLSSE-DKETIEKAVEEKIEWLESHQDADIEDFKSKKKELEEVVQPIVSKLY 633          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q24798|BIP_ECHGR (Endoplasmic reticulum chaperone BiP OS=Echinococcus granulosus OX=6210 GN=GRP78 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 4.600e-59
Identity = 168/641 (26.21%), Postives = 322/641 (50.23%), Query Frame = 1
Query:   16 MAVYLNLLKFSFVTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTF---DEIVSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKM-TETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            ++ Y+ +     +T+    S  G E   T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK   +S+    +   + L GR +   D    +K+YPF+   KN      +++ + +       EE+   + + +K  AE++L ++V    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y + + + + N+LV D+   + ++ +++ D    EV+ T   ++ G   F + L DY + LY+K   +   K+ + +  L+REV+  +  L+T + T    +++  G D +E  P+TRA+++EL ++      K ++  +++  LK+ DI  IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G +D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N FLG+ +    P   RGL    +   ++ NG + V+A D  T  +  +VI K   RI  +  E  + + E  +++D++++   ++R ++E +AY I+  +        ++ S  ++K ++++ +E I+W      AE +D +  K   E+ ++PI+   + 
Sbjct:    3 LSTYVGIFLLCILTLSRCKS--GKEEYGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFSGDGERLIGDAAKNQLTSNPKNTLFDAKRLIGRDYHDKDVQGDIKRYPFKVINKNNKPYMKVQVGSEE--KGFAPEEVSAMVLSKMKEIAEAYLGTEVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVLRIINEPTAAAIAYGLEKKDTEKNILVFDLGGGTFDVSLLTIDNGVFEVVATSGDTHLGGEDFDQRLIDYFVKLYKKKEGKDITKDDRAVQKLRREVEKAKRTLSTEHSTMIEIDNLFEGKDFSE--PLTRARFEELNNDLFRSTLKPVMKVMEDSGLKKEDIDDIVLVGGSTRIPKIQQLVKEFFNGKEPIRGINPDEAVAYGAAVQAGVISGVEDTGDIVLL-DVCPLTMGIETVGGVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHFLGKFDLTGIPPAPRGLPQIEVTFEIDVNGILRVSAEDKGTGKKSNIVINKETNRITPEEIERMIQDAEKFSDQDKQVKERVEVRNDLESLAYSIKNQVKDKEKMGGKL-SDDEIKTIEDAADEAIKWMENNPQAETSDYKKQKANLESVVQPIVSKLYE 635          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q0VCX2|BIP_BOVIN (Endoplasmic reticulum chaperone BiP OS=Bos taurus OX=9913 GN=HSPA5 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.358e-58
Identity = 171/613 (27.90%), Postives = 302/613 (49.27%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+++      +K  PF+   K       + +     T     EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ +       S   G D +E +  TRAK++EL  +      K +   L++ +LK+SDI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G  D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  +E   M ND E   E+D++L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  A+I D +  KK  E  ++PI+   +
Sbjct:   30 TVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDVGGG-QTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSE-DKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLY 636          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A0R3TVW3 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11970 PE=3 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 1.328e-60
Identity = 174/645 (26.98%), Postives = 326/645 (50.54%), Query Frame = 1
Query:   16 MAVYLNLLKFSFVTIFAIVSNVGCETSET----IIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKM-TETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            M V+ N+L    VT  +I++   CE+ +T    +IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK   +S+    +   + L GRTFD+      MK+YPF+   K       ++    D       EE+   +   +K  AE++L + V    +TVP  F+++Q  + K    +AGL I++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + L DY   LY+K   +  +K+ + +  L+REV+  +  L+T + T    +S   G D +E +  TRA+++EL ++      K + + +K+ +LK+ DI  IVL+G S  IPK+Q+ ++ FF   EL      DEA A G   + G+  G +D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D Q  + I V EG++ + + N FLG+ +    P   RG+    +   ++ NG + V+A D  T  ++++VI K   R++ +  E  + + E  +++D++++   + R E E +AY ++  +        ++    D+  ++++  + I+W   +  AE ++ +  KK+ ++ ++PI+   + 
Sbjct:    1 MGVWTNVL----VTFLSILALSRCESGKTDYGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTNTGERLIGDAAKNQLTSNPRNTLFDAKRLIGRTFDDKDVQEDMKRYPFKVIKKGDKPYMEVQ--VGDEVKAFAPEEVSAMVLGKMKEVAEAYLGTPVTHAVVTVPAYFNDAQRQATKDAGAIAGLTILRIINEPTAAAIAYGLDKKESEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRLIDYFAKLYKKKEGKDIMKDVRAVQKLRREVEKAKRTLSTEHSTVIEIDSFIDGKDFSETL--TRARFEELNNDLFRSTIKPVENVMKDSDLKKEDIHDIVLVGGSTRIPKVQELVKEFFNGKELSRGINPDEAVAYGAAVQAGVISGVEDTGDIVLL-DVCPLTLGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADDQPTVTIQVYEGERPLTKDNHFLGKFDLTGIPPAPRGIPQIEVTFEIDVNGLLQVSAEDKGTGKREKIVINKETNRLSPEEIEKMIQDAEKFSDQDKQVKERVEARNEFESLAYSVKNQVKDKKKLGDKLTEE-DINTIEKAAEDAIKWMEDHPQAETSEYKEEKKKLDSIVQPIISKLYQ 635          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A183TPZ0 (Glucose-regulated protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS18537 PE=3 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.036e-59
Identity = 171/612 (27.94%), Postives = 307/612 (50.16%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            T++GI  G  Y  + +      E+I N  G   T   V F   ++ LIG  AK   +S+    +   + L GR F +      +K+YPF+   KN+     + +   +M ++   EEI   +  ++K  AE++L +KV    +TVP  F+++Q  S K    ++GL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T   ++ G   F   + DY L LY+K T +   K+ + +  L+REV+  +  L+T +      +    G D +E +  TRA ++EL S    E  K +   + + +LK+SDI +IVL+G S  IPK+Q+ +++FF   E       DEA A G        G  +    +VL D+    + IE  G +   +I R  ++P KK++ F+   D+Q  + I V EG++L+ + N FLG+ +    P   RG+    +   V+ NG + VTA D  T  +  +VI K   R+N +E   M ND E  +E+D  ++   + R E+E +A+ ++  +        ++ S  D + ++++  E I+W  K   AE  + ++ KK+ E  ++PI+   + 
Sbjct:   31 TVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFSTENERLIGDAAKNQLTSNPENTLFDAKRLIGREFSDPEVQADIKRYPFKVIEKNRKPYLEVNV-GGEMKAFAP-EEISAMVLGHMKQIAEAYLGTKVTHAVITVPAYFNDAQRQSTKDAGVISGLNVLRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLMTIDNGVFEVLATSGDTHLGGEDFDHRVIDYFLKLYKKKTGKDASKDTRAVQKLRREVEKAKRTLSTEHSVTVEVDDFFEGNDFSETL--TRALFEELNSALFRETIKPVQKVMDDSDLKKSDIDEIVLVGGSTRIPKIQQLVKDFFDGKEPSRGINPDEAVAYGAAVQAGIIGGAENTGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKAQVFSTAADNQPTVTIQVYEGERLMTKDNHFLGKFDLTGIPPAPRGVPQIEVTFEVDVNGILRVTAEDKGTGKKSNIVINKETNRLNAEEIERMINDAEKFSEQDNRVKERVEARNELEGLAFSLKTQLNDKEKLAGKL-SDSDKESVEKAAQEAIDWLEKNPQAEAQECKDQKKKLEEVVQPIMSKLYQ 637          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A0R3U5K9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2014 PE=3 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 6.372e-59
Identity = 170/636 (26.73%), Postives = 322/636 (50.63%), Query Frame = 1
Query:   43 FSFVTIFAIVSNV----GCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKM-TETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            F F  +F +V +     G E   T+IGI  G  Y  + +      E+I N  G   T   V F      LIG  AK   +S+    +   + L GR FD+      +K+YPF+   KN       ++  N    +   EE+   +   +K  AE++L +KV    +TVP  F+++Q  + K   ++AGL +++   +  +A  +Y +++ +++ N+LV+D+   + ++ +++ D    EV+ T   ++ G   F + L +Y + LY+K   +   ++ + +  L+REV+  +  L+T + T    +S   G D +E   +TRA+++EL ++      K +   + +  LK+ DI  IVL+G S  IPK+Q+ ++ +F   E       DEA A G   + G+  G +D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N FLG+ +    P   RG+    +   ++ NG + V+A D  T  + ++VI K   R++ +E   M +D E  +++D++++   + R E+E  AY ++  +    S   ++    ++KI++ + +E I+W      AE+++ +  KK+ E  ++PI++  + 
Sbjct:    5 FVFTVLFCVVVSCKEESGKEDYGTVIGIDLGTTYSCVGVFKSGRVEIIANDQGNRITPSYVAFTSDGDRLIGDAAKNQLTSNPRNTLFDAKRLIGRDFDDKDVQSDIKRYPFKVINKNNKPYMQAEVGDNQKKDFAP-EEVSAMVLGKMKEIAEAYLGTKVTHAVVTVPAYFNDAQRQATKDAGSIAGLTVLRIINEPTAAAIAYGLDKKDDEKNILVVDLGGGTFDVSLLTIDNGVFEVVATSGDTHLGGEDFDQRLIEYFIKLYKKKEGKDISQDHRAVQKLRREVEKAKRTLSTEHSTVIEIDSFFEGKDFSET--LTRARFEELNNDLFRSTLKPVEKVMSDSGLKKEDIDDIVLVGGSTRIPKIQQLVKEYFNGKEPSRGINPDEAVAYGAAVQAGVISGVEDTGDIVLL-DVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGKKNKIVINKETNRLSPEEIERMIHDAEKFSDQDKQVKERVEARNELESFAYSVKNQVKDKESVGGKLGDE-EVKIIEGAADEAIQWMENNPQAEVSEYKEQKKKIEEVVQPIIRKLYE 635          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A5K3FET8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 9.236e-59
Identity = 170/636 (26.73%), Postives = 322/636 (50.63%), Query Frame = 1
Query:   43 FSFVTIFAIVSNV----GCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKM-TETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            F F  +F +V +     G E   T+IGI  G  Y  + +      E+I N  G   T   V F      LIG  AK   +S+    +   + L GR FD+      +K+YPF+   KN       ++  N    +   EE+   +   +K  AE++L +KV    +TVP  F+++Q  + K   ++AGL +++   +  +A  +Y +++ +++ N+LV+D+   + ++ +++ D    EV+ T   ++ G   F + L +Y + LY+K   +   ++ + +  L+REV+  +  L+T + T    +S   G D +E   +TRA+++EL ++      K +   + +  LK+ DI  IVL+G S  IPK+Q+ ++ +F   E       DEA A G   + G+  G +D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N FLG+ +    P   RG+    +   ++ NG + V+A D  T  + ++VI K   R++ +E   M +D E  +++D++++   + R E+E  AY ++  +    S   ++    ++KI++ + +E I+W      AE+++ +  KK+ E  ++PI++  + 
Sbjct:   36 FVFTVLFCVVVSCKEESGKEDYGTVIGIDLGTTYSCVGVFKSGRVEIIANDQGNRITPSYVAFTSDGDRLIGDAAKNQLTSNPRNTLFDAKRLIGRDFDDKDVQSDIKRYPFKVINKNNKPYMQAEVGDNQKKDFAP-EEVSAMVLGKMKEIAEAYLGTKVTHAVVTVPAYFNDAQRQATKDAGSIAGLTVLRIINEPTAAAIAYGLDKKDDEKNILVVDLGGGTFDVSLLTIDNGVFEVVATSGDTHLGGEDFDQRLIEYFIKLYKKKEGKDISQDHRAVQKLRREVEKAKRTLSTEHSTVIEIDSFFEGKDFSET--LTRARFEELNNDLFRSTLKPVEKVMSDSGLKKEDIDDIVLVGGSTRIPKIQQLVKEYFNGKEPSRGINPDEAVAYGAAVQAGVISGVEDTGDIVLL-DVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGKKNKIVINKETNRLSPEEIERMIHDAEKFSDQDKQVKERVEARNELESFAYSVKNQVKDKESVGGKLGDE-EVKIIEGAADEAIQWMENNPQAEVSEYKEQKKKIEEVVQPIIRKLYE 666          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A0R3W319 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4273 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 5.502e-58
Identity = 168/637 (26.37%), Postives = 326/637 (51.18%), Query Frame = 1
Query:   46 SFVTIF--AIVSNVGCETSE----TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKM-TETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            ++V+IF   I++   C++ +    T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK   +S+    +   + L GR +D+      +K+YPF+   KN      +++ T +       EE+   + + +K  AE++L + V    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T   ++ G   F + L DY + LY+K   +   K+ + +  L+REV+  +  L+T + T    +++  G D +E  P+TRA+++EL ++      K ++  +++  LK+ DI  IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G +D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N FLG+ +    P   RGL    +   ++ NG + V+A D  T  +  +VI K   R++ +  E  + + E  +++D++++   ++R ++E +AY I+  +        ++ S  ++K ++ + +E I+W      AE +D +  K + E+ ++PI+   + 
Sbjct:    5 AYVSIFLLCILTLSHCKSGKEDYGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFSGDGERLIGDAAKNQLTSNPKNTLFDAKRLIGRDYDDKDVQSDIKRYPFKVINKNNKPYMQVQVGTEE--KGFAPEEVSAMVLSKMKEIAEAYLGTAVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVLRIINEPTAAAIAYGLDKKDTEKNILVFDLGGGTFDVSLLTIDNGVFEVVATSGDTHLGGEDFDQRLIDYFVKLYKKKEGKDITKDDRAVQKLRREVEKAKRTLSTEHSTMIEIDNLFEGKDFSE--PLTRARFEELNNDLFRSTLKPVMKVMEDSGLKKEDIDDIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVISGVEDTGDIVLL-DVCPLTMGIETVGGVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPPAPRGLPQIEVTFEIDVNGILRVSAEDKGTGKKSNIVINKETNRLSPEEIERMIQDAEKFSDQDKQVKERVEVRNDLESLAYSIKNQVKDKEKMGGKL-SEDEIKTIENAADEAIKWMENNPQAETSDYKEQKAKLESVVQPIVSKLYE 635          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hspa5 (heat shock protein family A (Hsp70) member 5 [Source:NCBI gene;Acc:103030781])

HSP 1 Score: 205.682 bits (522), Expect = 2.786e-57
Identity = 170/641 (26.52%), Postives = 315/641 (49.14%), Query Frame = 1
Query:   43 FSFVTIFAIVSNVGC---------ETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
               + +F +V  VGC         E   T++GI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GRT+ +      +K +PF+   K       + I    + ++   EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L++ +       S   G D +E +  TRAK++EL  +      K +   L++ +LK+S+I +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G++D  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  ++   M ND E   ++D++L+     R E+E  AY ++  +        ++ S  D + ++++V E IEW   +  A++ + +  KK  E  ++PI+   +
Sbjct:    1 MKILCLFMLV--VGCVYADDDDKKENVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRTWGDSSVQQDVKYFPFKVLEKKSKPHIQVDIGAGQLKTFAP-EEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKDGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSEINEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEDTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNDAERFADEDKKLKERIDSRNELESYAYSLKNQVGDKEKLGGKL-SDEDKEAIEKAVEEKIEWLESHQDADLEEFQAKKKELEEVVQPIISKLY 633          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hsc70 (heat shock cognate 71 kDa protein-like [Source:NCBI gene;Acc:103045816])

HSP 1 Score: 167.933 bits (424), Expect = 7.024e-44
Identity = 153/619 (24.72%), Postives = 296/619 (47.82%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERI---NVKENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF+        K  ++ K    T Y   EE+ + + T +K  +E++L   V +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  +   K  +   R   +  +  L++S       +S+  GVD      ITRA+++EL S+    T+  +EK L    ++ +L ++ I  IVL+G S  IPK+QK +++FF   +L      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R+   +++      D++  E + + E     +  +E +A+ ++  + ++     ++ S  D K + +  NE+I W  +   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPNNTVFDA-KRLIGRRFDDAVVQSDMKHWPFKVVSDGGKPKMEVEYKGEIKTFYP--EEVSSMVLTKMKEISEAYLGKPVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDF--YTSITRARFEELNSDLFRGTLDPVEKAL----RDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEADQYRAEDEAQREKVTS-KNTLESLAFNMKSTV-EDEKLKDKI-SAEDKKTIVDKCNEVIAWLDRNQTAEKEEYEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hspa8b (heat shock cognate 70 kDa protein-like [Source:NCBI gene;Acc:103047344])

HSP 1 Score: 165.236 bits (417), Expect = 5.390e-43
Identity = 155/618 (25.08%), Postives = 292/618 (47.25%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF     +   K  ++ K    T     EEI + +   +K  AE++L   V +  +TVP  F++SQ  + K    ++GL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  + + K  +   R   +  +  L++S       +S+  GVD      ITRA+++EL ++    T+  +EK+L    ++ +L +S I  IVL+G S  IPK+QK +++FF   EL      DEA A G  +    L   K + +  ++L D+    + IE  G +  ++I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +E   M  D E    +D         +  +E  A+ ++  + ++     ++      KIL +  NE+I W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTVFDA-KRLIGRRFDDAVVQSDMKHWPFTVINDSTRPKVQVEYKGE--TKAFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDF--YTSITRARFEELNADLFRGTLDPVEKSL----RDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTILIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDVQRDKVAAKNGLESYAFNMKSTV-EDEKLKGKISDEDKQKIL-DKCNEVISWLDKNQTAEKDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hspa8 (heat shock cognate 71 kDa protein [Source:NCBI gene;Acc:103043364])

HSP 1 Score: 163.31 bits (412), Expect = 2.860e-42
Identity = 150/617 (24.31%), Postives = 289/617 (46.84%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK   + +    I   + L GR FD+ V    MK +PF     +   K  +  K    + Y   EEI + +   +K  AE++L   V +  +TVP  F++SQ  + K    ++GL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  + + K  +   R   +  +  L++S       +S+  GVD      ITRA+++EL ++    T+  +EK+L    ++ ++ ++ I  IVL+G S  IPK+QK +++FF   EL      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +  E  +   E    +D         +  +E  A+ ++  + ++     ++      KI+ +  NE+I W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTIFDAKRLIGRRFDDGVVQSDMKHWPFTVINDSTRPKVQVDYKGEAKSFYP--EEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDF--YTSITRARFEELNADLFRGTLDPVEKSL----RDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAADKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTV-EDEKLKGKISDEDKQKIM-DKCNEVISWLDKNQTAERDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: ENSAMXT00000037064.1 (heat shock 70 kDa protein [Source:NCBI gene;Acc:111193176])

HSP 1 Score: 162.155 bits (409), Expect = 5.447e-42
Identity = 154/612 (25.16%), Postives = 288/612 (47.06%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEE-DINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSIGVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGK-DDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE---NSMPNDEHMNEKDRELE-IAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPI---DLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
            IGI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF+        K  ++ K    T     EEI + +   +K  AE++L  KV +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++ ++ + +VL+ D+   + ++ +++ +    EV  T   ++ G   F   L ++ +  +++  +  +   K  L   R   +  +  L++S       +S+   V     ITRA+++E+ S+      + +   L++ ++ +S I +IVL+G S  IPK+QK +++FF   +L      DEA A G   +  +  G     +  ++L D+    + IE  G +   +I+R   +P K+++ F+   D+Q  ++I V EG++ + + N  LG+ +    P   RG+    +   +++NG + V+A D  T  Q ++ I     R++ +E        D++  E D + E IA K    +E  A+ ++     NS   + +K  I   D K + E  N+ I W      A+  + E+  K  E    PI+
Sbjct:    9 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPNNTVFDA-KRLIGRKFDDPVVQSDMKHWPFQVVSDGGKPKVQVEYKGEQKT--FNPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKKGERHVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLHEGVDFYTSITRARFEEMCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMATLIKRNTTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKEEIERMVQEADQYKAEDDLQREKIAAK--NSLESFAFNMK-----NSVEDENLKGKISEDDKKKVIEKCNQAISWLENNQLADKEEFEHQLKELEKVCNPII 609          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 198.364 bits (503), Expect = 2.961e-55
Identity = 164/617 (26.58%), Postives = 305/617 (49.43%), Query Frame = 1
Query:   88 ETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTF-DEIVS--MKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            E   T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GR++ D  V   +K +PF    K       +++   +  ++   EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L+T +       S   G D +E +  TRAK++EL  +      K +   +++ +LK++DI +IVL+G S  IPK+Q+ ++  F   E       DEA A G   + G+  G+D+  + V+L D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   ++ NG + V+A D  T  + ++ I     R+  +E   M +D E   + D+ ++   + R E+E  AY ++  I        ++ S  D + ++++V + I W   +  A+  D +  KK  E  ++PI+   +
Sbjct:   30 ENMGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRSWTDPTVQHDIKFWPFTVLEKKGKPHIQVEVIAGESKTFAP-EEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDHGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDDFSETL--TRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLSGEDNTGDLVLL-DVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKNKITITNDQNRLTPEEIERMVSDAERFADDDKRVKERVEARNELESYAYSLKNQIGDKEKLGGKL-SDEDRETVEKAVEDKIAWLEGHQEADTDDFKAQKKELEEVVQPIVSKLY 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 136.732 bits (343), Expect = 5.419e-34
Identity = 127/547 (23.22%), Postives = 258/547 (47.17%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSS--SSVMVIDSLEYLAGRTFDEI-VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXREV-KYLQAHLTTSYLTEFRWNSIGVDVAEV----IPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKS--FERINVKENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEI 1710
             +IGI  G     +++ + + ++++ N+ G   T  +V F    + L+G  AK  +  +      + + L GR FD+  V        +KI    N          M S     +I  ++   +K +AE+F+ + V +  +TVP  F++SQ  + K    ++GL +++   +  +A  +Y +++ ++ + + V D+   + ++ ++   +   EV  T+  +  G   F  AL  Y++  +++ +   L      L   RE  +  +  L++S  T+     + +D +      + +TR++++ ++ + I +        L++ E+ +SDI  ++L+G    +PK+Q+ ++  F     ++ N  DEA AIG    G     D  +  V+L D+    + IE  G +   +I R   +P KKS+ F+   D Q ++ I V +G++ +A  N  LGQ      P   RG+    +   +++NG + V+A D  T  ++++VI+ S    +  + EN + N E   E+DR  +   +   + E I ++I
Sbjct:   54 AVIGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDSDVQKDMNNLSYKIVRASNGDAWVEAHGKMYSP---SQIGAFVLLKMKETAENFMGTSVKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKADDKV-IAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDNALLKYIVKEFKRESGVDLTKDSMALQRVREAAEKAKCELSSSLQTDINLPYLTMDSSGPKHLNMKLTRSQFENIVGDLIRKTIAPCQKALQDGEVAKSDIGDVILVGGMTRMPKVQQTVQEVFGRAPSKAVN-PDEAVAIGAAIQGGVLAGD--VTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAGDNKNLGQFTLVGVPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDEI-ENMVKNAEKYAEEDRRRKDRVEAVNQAEGIVHDI 592          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa14 (heat shock protein 14 [Source:NCBI gene;Acc:565232])

HSP 1 Score: 95.1301 bits (235), Expect = 6.208e-21
Identity = 115/506 (22.73%), Postives = 218/506 (43.08%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKV--LIGKEAKYSSSSVMVIDSLEYLAGRTFDEIVSMKQYPFRFXXXXXXXXXXXXXXTNDMT--SYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE--TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXREVKYLQAH-LTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG-IGKIGLQFGKDD--------QINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTF----LGQI---EFRRPPTGLRGL-TLFNIEIAVESNGYIFVTATD 1545
            +G+H G     +++     +++I N  G+  T  +V F + +K+  L  K+ +  +++  V+     L  R  D++V  ++Y                   N+ T   ++T  E+ T I   +K +A   + +      +T P +F+  Q+  ++  A  AG  +++   +  +A+ ++ I +  +     VLV  +         +  +     V+G+      G  +F+ AL +YL   +QK     L+     +        +  H L+T  ++    +S+  G+D      ITRA++D L S    +  + +   L +I L  SD  ++VL G S  IPKLQ+ ++  F   EL      DE  A+G   + G+  G+D          I    L DIL K+   E       V+   G  LP ++   F     +   ++++V EG   VA+ ++F    L Q+   + ++   GLR + T+F +    + +G + +T TD
Sbjct:    4 VGVHLGSTCACVAIYKDGRADVIANDAGDRVTPAMVAFRDSEKIVGLAAKQGRIRNATTTVVGVKRILGHRFEDDVV--QKYISSSSCPVIEKDGCPVFSINNGTVKKHITRHEVATLILQKMKETALFAVGADAKDAVITTPLNFTTQQVDELRQAAESAGFNVLRILSEPAAALLAFGIGQESSHSKCKVLVYKLGGTCAYATAIEVNSGLYRVLGSVSDDTVGGEEFTEALAEYLATEFQKFHRQDLRGNSRAMMKLHTNAEMAKHVLSTMAISNCFVDSLHDGLDFE--CNITRARFDSLCSVLFQQSLQPIHDLLAQINLTTSDFQKVVLCGGSARIPKLQQLLQEQFVGSELMCSIPVDEVIALGAAAEAGILLGRDAVRFEPEALSIECASL-DILVKEQD-EAGQDCYTVVFPVGTPLPARRQHTFQAP-GTLPSVLVDVYEG---VAKGSSFEGVHLAQLVLKDLQQQDNGLRDISTVFTM----KRDGSLLITCTD 495          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa13 (heat shock protein 70 family, member 13 [Source:ZFIN;Acc:ZDB-GENE-070410-58])

HSP 1 Score: 47.3654 bits (111), Expect = 8.461e-6
Identity = 34/128 (26.56%), Postives = 64/128 (50.00%), Query Frame = 1
Query:  421 LTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNY-GSRKFSRALEDYL 801
            +T E +   +   L+  AE  L   V    L VP +F E Q  S    A +AGL +++   +  +A  +Y ++E E   +VLV+D+   +T++ +++  Q G         +N+ G + F++ L ++L
Sbjct:  145 VTPEWVGAQMLDQLRLLAEERLGLPVRYAVLAVPAEFDERQRNSTIKAATMAGLEVLRVVNEPTAAALAYGLHEEESVSSVLVVDLGGGTTDVSLLT-KQGGMFFTRAMAGNNHLGGQDFTQRLVEHL 271          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 167.162 bits (422), Expect = 1.399e-44
Identity = 152/609 (24.96%), Postives = 291/609 (47.78%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSSS---SVMVIDSLEYLAGRTFDE---IVSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINET-EEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIG--LQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPNDEHMNEKDRELEIA-YKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
            +GI  G  Y  ++    +  E+I N  G   T   V F + ++ LIG  AK  ++      V D+ + L GR FD+       K +PF+   ++      ++ K    T   T EEI + + + +K +AE++L + V    +TVP  F++SQ  + K    +AG+ +++   +  +A  +Y +++    + NVL+ D+   + ++ ++S D+   EV  T   ++ G   F   L ++L   +++ T+  + N +  L   R   +  +  L++S  T    +S+  G+D      +TRA+++EL ++      + +   LK+ +L +S I +IVL+G S  IPK+QK + +FF   E       DEA A G       L   +  +   ++L D+    + IE  G +   +I R   +P KKS+ F+   D+Q  ++I V EG++   + N  LG+ E    P   RG+   ++   +++NG + V+A +  T    ++ I     R++  + + M ++      D E E    + + ++E  A+ ++ + +  +SF ++V    D K L+ +  E I+W      A   + ++ +K  E    PI+
Sbjct:    5 VGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQAAINPHNTVFDA-KRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEYKGE--TKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMDF--YTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIDVTFDIDANGILNVSALEKGTGKSNKITITNDKGRLSKDDIDRMVSEAEKYRADDEREAERVQAKNQLESYAFTLK-NTINEASFKEKVGED-DAKRLETASQETIDWLDASQAASTDEYKDRQKELEGIANPIM 605          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 165.622 bits (418), Expect = 4.914e-44
Identity = 153/609 (25.12%), Postives = 286/609 (46.96%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSSS---SVMVIDSLEYLAGRTFDE---IVSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIG--LQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
            +GI  G  Y  ++    +  E+I N  G   T   V F + ++ LIG  AK  ++      V D+ + L GR FD+       K YPF+   K       ++ K    T   T EEI + I T +K +AE+FL ++V    +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++ ++++ NVL+ D+   + ++ ++S D+   EV  T   ++ G   F   L ++L   +++  +  L   +  L   R   +  +  L++S  T    +S+  G+D      ITRA+++EL ++      + +   L + +L +S I +IVL+G S  IPK+QK + +FF   E       DEA A G       L   +      ++L D+    + IE  G +   +I R   +P KKS+ F+   D+Q  ++I V EG++   + N  LG+ E    P   RG+    +   +++NG + V+A +  T    ++ I     R++ +  +  +   E    +D +     + + ++E  A+ ++  + +N +F ++V    D + L+ +  + I W      A   + +  +K  E    PI+
Sbjct:    5 VGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQAAMNPHNTVFDA-KRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGE--TKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDF--YTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQLESYAFTLKNSVSEN-NFKEKVGEE-DARKLEAAAQDAINWLDASQAASTEEYKERQKELEGVANPIM 605          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 160.999 bits (406), Expect = 2.504e-42
Identity = 149/606 (24.59%), Postives = 292/606 (48.18%), Query Frame = 1
Query:   85 CETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTE-TXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE--NSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEA 1872
             E   T+IGI  G  Y  +++     +E++ N  G   T   V F + D+ LIG  AK   +++    I  ++ L G  +++      +K  PF    K+      + +K        T EEI   I   +K  AE +L +KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++++++  ++V D+   + ++ ++S +    EV  T   ++ G   F   +   L+  ++K        N K +  LKRE +  +  L++   T    +S   G+D++E +  TRAK++EL  +   +  K +   L++  L++ D+  IVL+G S  IPK+Q+ + ++F   +       DEA A G          ++ +  +VL D+    + IE  G +   +I+R   +P KKS+ F+   D+Q  ++I V EG++ +++ N  LG+ E    P   RG+    +  A+++NG + V+ATD  T   + + I     R+  +E    +   E    +D  ++   + R ++E+ A+ ++  +  N    ++++   D + L ++ N+++EW        IA  E+  ++FE+
Sbjct:   46 VENYGTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTD-DERLIGDAAKNQVAANPQNTIFDIKRLIGLKYNDRSVQKDIKHLPFNVVNKDGKPAVEVSVKGE--KKVFTPEEISGMILGKMKQIAEDYLGTKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLDKSDKEHQIIVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFDYKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETL--TRAKFEELNLDLFKKTLKPVEKVLQDSGLEKKDVDDIVLVGGSTRIPKVQQLLESYFDGKKASKGINPDEAVAYGAAVQAGVLSGEEGVEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIKVYEGERAMSKDNNLLGKFELTGIPPAPRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLTQEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQV--NGDLGEKLEEE-DKETLLDAANDVLEWLDDNFETAIA--EDFDEKFES 641          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 155.606 bits (392), Expect = 1.113e-40
Identity = 148/616 (24.03%), Postives = 285/616 (46.27%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSSS---SVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDD--QINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKEN-----SMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  ++    +  ++I N  G   T   VGF + ++ LIG  AK  ++   +  V D+ + L GR F++      MK +PF+    +   +  ++ K    T   T E+I + +   +K +AES+L +KV    +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++  ++ +VL+ D+   + ++ ++S +    EV  T   ++ G   F   L ++ +  +++  +  L   +  L   R   +  +  L++S  T    +S+  G+D      ITRA+++EL ++        +   L++ +L +S + +IVL+G S  IPK+QK + ++F   E       DEA A G          D+  +   ++L D+    + IE  G +   +I R   +P KKS+ F+   D+Q  ++I V EG++   + N  LG+ E    P   RG+    +   V+SNG + V+A +  T    ++ I     R++ KE+     +        ++     IA K   ++E IAY ++  I +    +++     D   + +   E I W    + A   + ++  K  +    PI+   + 
Sbjct:    5 VGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFTDTER-LIGDAAKNQAAMNPANTVFDA-KRLIGRNFNDPEVQGDMKHFPFKLIDVDGKPQIQVEFKGE--TKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDF--YTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLS-KEDIEKMVAEAEKFKEEDEKESQRIASK--NQLESIAYSLKNTISEAGDKLEQA----DKDAVTKKAEETIAWLDSNTTATKEEFDDQLKELQEVANPIMSKLYQ 607          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 154.836 bits (390), Expect = 2.132e-40
Identity = 148/616 (24.03%), Postives = 284/616 (46.10%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSSS---SVMVIDSLEYLAGRTFDEI---VSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDD--QINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKEN-----SMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  ++    +  ++I N  G   T   V F + ++ LIG  AK  ++   S  V D+ + L GR F++      MK +PF+    +   +  ++ K    T   T E+I + +   +K +AES+L +KV    +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++  ++ +VL+ D+   + ++ ++S +    EV  T   ++ G   F   L ++ +  +++  +  L   +  L   R   +  +  L++S  T    +S+  G+D      ITRA+++EL ++        +   L++ +L +S + +IVL+G S  IPK+QK + ++F   E       DEA A G          D+  +   ++L D+    + IE  G +   +I R   +P KKS+ F+   D+Q  ++I V EG++   + N  LG+ E    P   RG+    +   V+SNG + V+A +  T    ++ I     R++ KE+     +        ++     IA K   ++E IAY ++  I +    +++     D   + +   E I W    + A   + ++  K  +    PI+   + 
Sbjct:    5 VGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTER-LIGDAAKNQAAMNPSNTVFDA-KRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGE--TKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDF--YTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLS-KEDIEKMVAEAEKFKEEDEKESQRIASK--NQLESIAYSLKNTISEAGDKLEQA----DKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQ 607          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 202.986 bits (515), Expect = 1.295e-56
Identity = 166/608 (27.30%), Postives = 301/608 (49.51%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSR-ALEDYLLCLYQKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
            T+IGI  G  Y  + +      E+I N  G   T   V F E  + LIG  AK    ++    V D+ + L GR++D+      +K +PF+   KNK     +K    D       EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F +  +E ++    +K  +   K+ + +  L+REV+  +  L+T +       S   G D +E++  TRA+++EL ++      K +   L++ +LK+S+I +IVL+G S  IPK+Q+ +++FF   E       DEA A G        G ++    VVL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   ++ NG + V+A D  T  ++++ I     R+  ++   M ND E   ++D++ +   + R E+E  AY ++  +        ++ S  D K + E+V + I W  K   A + D +  KK  E  ++PI+
Sbjct:   34 TVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDA-KRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVK--VKDEIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVEIESFFEGEDFSEML--TRARFEELNAKLFKSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVKDFFEGKEPSRGINPDEAVAYGAAVQAGVLGGEEDTGEVVLLDVNPLTLGIETVGGVMTKLISRNTVIPTKKSQVFSTAADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKL-SEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKKELEDVVQPIV 635          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 167.162 bits (422), Expect = 3.648e-44
Identity = 149/590 (25.25%), Postives = 273/590 (46.27%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINET-EEDINVLVIDIAEDSTNLVVVSCDQNGQ-EVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYA 1830
            IGI  G  Y  + +      E+I N  G   T   VGF + ++ L+G  AK     +    + D+ + L GR +D+      MK +PF+    N   K  ++ K    T     EEI + +   +K +AE++L  KV S  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y ++++   + NVL+ D+   + ++ +++ D     EV  T   ++ G   F   L ++ +  +++  +  +      +   R   +  +  L++S       +S+  G+D      I+RA++++L S+        +   L + +  +SDI ++VL+G S  +PK+QK +  +F    L      DEA A G  +    L   K D++  V+L D+    + IE  G +   +IER   +P K ++ FT   D+Q  + I V EG++ + + N  LG+ +    P   RG+    +   +++NG + V+A D  T     + I     R++ +E + M ND E    +D         R  +E  A+ ++  I + S  ++   S  D   +K  V E++ W  K S A
Sbjct:    7 IGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTER-LVGDAAKNQVALNPENTIFDA-KRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKT--FAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGIDF--YTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIERNARIPTKATQTFTTYSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPS--LEGKLSQSDKDTVKNKVEEVLNWLEKNSLA 588          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 163.31 bits (412), Expect = 9.971e-43
Identity = 160/625 (25.60%), Postives = 293/625 (46.88%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLY-QKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKE--IELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVI--------RKSFERINVKENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPI---DLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     +    V D+ + L GR FD+ V    M  +PF    + +  K  ++ K  +  S+   EEI + + T +K +AE++L +KV    +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++    + NVL+ D+   + ++ V++ +    EV  T   ++ G   F   + D+ +  + QK  +    NK+ +  L+   +  +  L++S       +S+  G+D      ITRA+++EL  +   +  + +   +++  I   +  I  IVL+G S  IPK+QK ++  F   EL      DEA A G  +    L   KDD +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ +   N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I        ++  ER+ V E S   +E   ++DR      + +  +E  AY ++  +  +     +VK  I   D K + +   E+++W      AE  + E  +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTER-LIGDAAKNQVAMNPENTVFDA-KRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFK-GEKKSFFP-EEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDF--YTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPLSMGIETAGGVMSVLIKRNSTIPTKQTQTFTTYSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERM-VNEASKYKEEDEKQRDR-----IQTKNSLESYAYSMKSTVEDD-----KVKDKISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQ 614          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 150.599 bits (379), Expect = 1.774e-38
Identity = 150/623 (24.08%), Postives = 286/623 (45.91%), Query Frame = 1
Query:   91 TSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLY-QKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDE----LISETIFELEKTLISFLKEIELK-RSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            T    IGI  G  Y  + +      E+I N  G   T   V F + ++ L+G  AK   + +    I   + L GR FD+      MK + F    +    K  ++ K    T +   EEI + +   +K +AE++L  KV    +TVP  F++SQ  + K    ++GL +++   +  +A  +Y +++   ++ NVL+ D+   + ++ V+S +    EV  TH  ++ G   F   + D+ +  + QK  +    NK+ +  L+   +  +  L++S       +S+  G+D      ITRA+++E    L  +T+  +EK +    K+ +L+ +  I +IV++G S  IPK+Q  ++NFF   EL      DEA A G  +    L   K +    ++L D+    + +E  G +    I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+   ++   V+SNG + V+A D  T  + ++ I     R++ +  E  +   E     D  +    + +  +E  A+ ++   +++     ++      K++       ++W      AE  +++  +K  E    PI+   + 
Sbjct:    2 TKAPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEER-LVGDAAKNQVAMNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFA--EEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSLYDGIDF--YTSITRARFEEMNAHLFKKTLEPVEKAI----KDSKLESKEKIDEIVMVGGSTRIPKIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKRNTTIPTKQTQTFTTYSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMK-STMEDEKVKDKLSEDEREKVISR-CKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 613          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO47723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN7])

HSP 1 Score: 137.502 bits (345), Expect = 4.306e-34
Identity = 118/506 (23.32%), Postives = 241/506 (47.63%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSS--SSVMVIDSLEYLAGRTFD--EIVS-MKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXREV-KYLQAHLTTSYLTEFRWNSIGVDVAEV----IPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKS 1587
             + GI  G     +++ D ++ ++I N+ G   T  +V F    + L+G  A+  +  +    + + +   GR FD  EI   +K   ++    +  +  +            +  ++  ++   +K +AES+L + V +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++TE+ I + V D+   + ++ ++   +   EV  T+  +  G   F   L  +L+  ++K +   L      L   RE  +  +  L++S  T+     I VD +      + ++R+K++ L+++ I          L++ E+ + +I  ++L+G    +PK+Q+ +++ F     ++ N  DEA AIG    G     D  +  V+L D+    + IE  G +   +I R   +P KKS+ F+   D Q ++ I V +G++ +A  N  LGQ +    P   RG+    +   +++NG + V+A D  T  ++++VI+ S
Sbjct:   13 AVCGIDLGTTNSCVAVMDGKTPKVIENAEGSRTTPSVVAFTPEGERLVGAPARRQAITNPQNTLYATKRYIGRRFDAPEIKKDLKNVSYKIVRASNGDAWFEVAG-----KVYSPSQVGAFVLMKMKETAESYLGTNVNNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDKTEDKI-IAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLSKDSMALQRLREAAEKAKIELSSSVQTDINLPYITVDASGPKHLNMKLSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIFGRVPSKAVN-PDEAVAIGAAIQGGVLAGD--VKDVLLLDVTPLSLGIETLGGVFTKLITRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVIQSS 509          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hspa5 (heat shock protein family A (Hsp70) member 5 [Source:NCBI gene;Acc:101157378])

HSP 1 Score: 207.994 bits (528), Expect = 4.496e-58
Identity = 170/609 (27.91%), Postives = 301/609 (49.43%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
            T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GR++ +      +K +PF+   K       I I    M ++   EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L+  +       S   G D +E +  TRAK++EL  +      K +   L++ +LK+S+I +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G++D    VVL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  ++   M ND E   ++D+ L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  AE  D +  KK  E  ++PI+
Sbjct:   27 TVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRSWGDSSVQQDIKYFPFKVIEKKSKPHIQIDIGGGQMKTFAP-EEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKDGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSAQHQARIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSEIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEED-TGDVVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNDAERFADEDKRLKERIDARNELESYAYSLKNQIGDKEKLGGKL-SDDDKETIEKAVEEKIEWMESHQDAETEDFQAKKKELEEVVQPII 629          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hspa5 (heat shock protein family A (Hsp70) member 5 [Source:NCBI gene;Acc:101157378])

HSP 1 Score: 207.994 bits (528), Expect = 4.496e-58
Identity = 170/609 (27.91%), Postives = 301/609 (49.43%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK---YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMT-ETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIG-KIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPIL 1890
            T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK    S+    V D+ + L GR++ +      +K +PF+   K       I I    M ++   EEI   + T +K +AE++L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++ + + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + ++ + LY+K T +   K+ + +  L+REV+  +  L+  +       S   G D +E +  TRAK++EL  +      K +   L++ +LK+S+I +IVL+G S  IPK+Q+ ++ FF   E       DEA A G   + G+  G++D    VVL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N  LG  +    P   RG+    +   ++ NG + VTA D  T  + ++ I     R+  ++   M ND E   ++D+ L+     R E+E  AY ++  I        ++ S  D + ++++V E IEW   +  AE  D +  KK  E  ++PI+
Sbjct:   27 TVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTSNPENTVFDA-KRLIGRSWGDSSVQQDIKYFPFKVIEKKSKPHIQIDIGGGQMKTFAP-EEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKDGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSAQHQARIEIESFFEGEDFSETL--TRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSEIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEED-TGDVVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNDAERFADEDKRLKERIDARNELESYAYSLKNQIGDKEKLGGKL-SDDDKETIEKAVEEKIEWMESHQDAETEDFQAKKKELEEVVQPII 629          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 170.244 bits (430), Expect = 1.116e-44
Identity = 155/618 (25.08%), Postives = 293/618 (47.41%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF+    +   K  ++ K    T Y   EEI + + T +K  +E++L   V +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  + ++ N K  +   R   +  +  L++S       +S+  G D      ITRA+++EL ++    TI  +EK L    ++ ++ +S I  +VL+G S  IPK+QK +++ F   +L      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +  E  +   E    +D         +  +E +A+ ++  +  +   +Q   S  D K + +  NEII W  K   AE  + E+ +K  E    PI+   + 
Sbjct:    7 VGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPANTVFDA-KRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYP--EEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDF--YTSITRARFEELNADLFRGTIEPVEKAL----RDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTV--DDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 170.244 bits (430), Expect = 1.118e-44
Identity = 155/618 (25.08%), Postives = 293/618 (47.41%), Query Frame = 1
Query:  106 IGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF+    +   K  ++ K    T Y   EEI + + T +K  +E++L   V +  +TVP  F++SQ  + K    +AGL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  + ++ N K  +   R   +  +  L++S       +S+  G D      ITRA+++EL ++    TI  +EK L    ++ ++ +S I  +VL+G S  IPK+QK +++ F   +L      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +  E  +   E    +D         +  +E +A+ ++  +  +   +Q   S  D K + +  NEII W  K   AE  + E+ +K  E    PI+   + 
Sbjct:   24 LGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPANTVFDA-KRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYP--EEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDF--YTSITRARFEELNADLFRGTIEPVEKAL----RDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTV--DDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 629          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 166.392 bits (420), Expect = 3.762e-43
Identity = 157/646 (24.30%), Postives = 298/646 (46.13%), Query Frame = 1
Query:   16 MAVYLNLLKFSFVTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYS---SSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINE-TEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXR-EVKYLQAHLTTSYLTEFRWNSIGVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIG--IGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            +A  L  L+F            G  +    +GI  G  Y  + +      E+I N  G   T   V F + ++ LIG  AK     + +  V D+ + L GR FD+ V    MK +PF     N   K  ++ K    + Y   EEI + + T +K  AE++L   V +  +TVP  F++SQ  + K    ++GL +++   +  +A  +Y +++    + NVL+ D+   + ++ +++ +    EV  T   ++ G   F   + ++ +  +++  +  + + K  +   R   +  +  L++S       +S+   V     ITRA+++EL ++    T+  +EK+L    ++ ++ +  I  IVL+G S  IPK+QK +++FF   EL      DEA A G  +    L   K + +  ++L D+    + IE  G +  V+I+R   +P K+++ FT   D+Q  ++I V EG++ + + N  LG+ E    P   RG+    +   +++NG + V+A D  T  + ++ I     R++ +  E  +   E    +D         +  +E  A+ ++  + ++     ++      KIL +  NE+I W  K   AE  + E+ +K  E    PI+   + 
Sbjct:   27 VAFALRCLRFPNTHFRPPTICFGSMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTNTVFDA-KRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYP--EEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSL----RDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTV-EDEKLAGKISDEDKQKIL-DKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 662          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000060655.1 (SMESG000060655.1)

HSP 1 Score: 1207.97 bits (3124), Expect = 0.000e+0
Identity = 629/631 (99.68%), Postives = 630/631 (99.84%), Query Frame = 1
Query:   16 MAVYLNLLKFSFVTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSSSSVMVIDSLEYLAGRTFDEIVSMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLYQKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSIGVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFHF 1908
            MAVYLNLLKFSFVTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSSSSVMVIDSLEYLAGRTFDEIVSMKQYPFRFKIKNKYNKPYIKIKTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLL LYQKMTETKLKNKKNILHLKREVKYLQAHLTTSYLTEFRWNSIGVDVAEV+PITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFHF
Sbjct:    1 MAVYLNLLKFSFVTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSSSSVMVIDSLEYLAGRTFDEIVSMKQYPFRFKIKNKYNKPYIKIKTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLSLYQKMTETKLKNKKNILHLKREVKYLQAHLTTSYLTEFRWNSIGVDVAEVVPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFHF 631          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000068215.1 (SMESG000068215.1)

HSP 1 Score: 197.208 bits (500), Expect = 2.672e-54
Identity = 164/588 (27.89%), Postives = 294/588 (50.00%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLY-QKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKEN--SMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYA 1830
            T+IGI  G  Y  + +      E+I N  G   T   V F +  + LIG  AK   +S+    I  ++   GR FD+      +K YPF   + NK NKP++++K  +       EEI   +   +K  AES+L  +V    +TVP  F+++Q  + K    ++GL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + DY + LY +K  +   K+ + +  L+REV+  +  L+ S+       S   G D +E +  TRA+++EL  +      K +   L++ +LK+ D+++IVL+G S  IPK+Q+ ++  F   E       DEA A G        G  ++   +VL D+    + IE  G++   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N FLG+ +    P   RG+    +   ++ NG + V+A D  T  + ++VI K   R++  EN   M ND E   E D++L+   + + E+E  AY ++  +   +    ++ S  + KI+ ++  E I W  K   A
Sbjct:   36 TVIGIDLGTTYSCVGVFKSGRVEIIANDQGNRITPSYVAFTQESERLIGDAAKNQLTSNPENTIFDVKRFIGRGFDDETVKQDIKNYPF--LVINKNNKPHVQVKVGEENRIFAPEEISAMVLGKMKEIAESYLGKRVTHAVVTVPAYFNDAQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDYFIKLYRKKHGKDVRKDNRAVQKLRREVEKAKRSLSNSHSARIDIESFYDGDDFSETL--TRARFEELNMDLFKNTMKPVEKVLQDSDLKKEDVSEIVLVGGSTRIPKIQQLVKELFDGKEPSRGINPDEAVAFGAAVQAGVIGGAEETGDLVLLDVCPLTLGIETVGAVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIVINKDQNRLS-PENIEKMINDAEKFAESDKKLKDKVEAKNELEGYAYSLKTQVNDKTKLGGKL-SADEQKIILDAAQETISWLEKNPQA 617          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000068215.1 (SMESG000068215.1)

HSP 1 Score: 197.208 bits (500), Expect = 2.766e-54
Identity = 164/588 (27.89%), Postives = 294/588 (50.00%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYLLCLY-QKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKEN--SMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYA 1830
            T+IGI  G  Y  + +      E+I N  G   T   V F +  + LIG  AK   +S+    I  ++   GR FD+      +K YPF   + NK NKP++++K  +       EEI   +   +K  AES+L  +V    +TVP  F+++Q  + K    ++GL +++   +  +A  +Y +++ E + N+LV D+   + ++ +++ D    EV+ T+  ++ G   F + + DY + LY +K  +   K+ + +  L+REV+  +  L+ S+       S   G D +E +  TRA+++EL  +      K +   L++ +LK+ D+++IVL+G S  IPK+Q+ ++  F   E       DEA A G        G  ++   +VL D+    + IE  G++   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N FLG+ +    P   RG+    +   ++ NG + V+A D  T  + ++VI K   R++  EN   M ND E   E D++L+   + + E+E  AY ++  +   +    ++ S  + KI+ ++  E I W  K   A
Sbjct:   37 TVIGIDLGTTYSCVGVFKSGRVEIIANDQGNRITPSYVAFTQESERLIGDAAKNQLTSNPENTIFDVKRFIGRGFDDETVKQDIKNYPF--LVINKNNKPHVQVKVGEENRIFAPEEISAMVLGKMKEIAESYLGKRVTHAVVTVPAYFNDAQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDYFIKLYRKKHGKDVRKDNRAVQKLRREVEKAKRSLSNSHSARIDIESFYDGDDFSETL--TRARFEELNMDLFKNTMKPVEKVLQDSDLKKEDVSEIVLVGGSTRIPKIQQLVKELFDGKEPSRGINPDEAVAFGAAVQAGVIGGAEETGDLVLLDVCPLTLGIETVGAVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIVINKDQNRLS-PENIEKMINDAEKFAESDKKLKDKVEAKNELEGYAYSLKTQVNDKTKLGGKL-SADEQKIILDAAQETISWLEKNPQA 618          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000062699.1 (SMESG000062699.1)

HSP 1 Score: 194.126 bits (492), Expect = 3.482e-53
Identity = 157/612 (25.65%), Postives = 302/612 (49.35%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEIV---SMKQYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKF-SRALEDYLLCLYQKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVK--ENSMPNDEHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAFH 1905
            T+IGI  G  Y  + +      E+I N  G   T   V F    + LIG  AK   +++    +  ++ + GR F++      MK +PF+   KN      +++  N++ S+   EEI   +   +K  AE++L  KV    +TVP  F+++Q  +      +AGL +++   +  +A  +Y +++   + N+LV D+   + ++ +++ D    EVI T+  ++ G   F  R +  ++    +K  +    +K+ +  L+REV+  +  L+ ++       S+  G D +E +  TRA+++EL  +      K +   L++ E+K+ DI +IVL+G S  IPK+Q+ ++ FF   E       DEA A G        G  ++   +VL D+    + IE  G +   +I R  ++P KKS+ F+   D+Q  + I V EG++ + + N FLG+ +    P   RG+    +   ++ NG + V+A D  T  + +++I+K   R+N +  E  + + E   ++D++++   + + ++E  AY ++  +        ++ SP D + + ++V+E I W  K   AE  + +  KK+ E  + PI+   + 
Sbjct:   34 TVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVG-NEVKSFAP-EEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIKLYKKKKGKDITDDKRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETL--TRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEAVAFGAAVQAGVIGGVEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKL-SPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000061528.1 (SMESG000061528.1)

HSP 1 Score: 174.866 bits (442), Expect = 2.568e-46
Identity = 164/619 (26.49%), Postives = 294/619 (47.50%), Query Frame = 1
Query:  100 TIIGIHFGRKYVRMSLCDRESSELIPNSIGELKTQILVGFDEHDKVLIGKEAK--YSSSSVMVIDSLEYLAGRTFDEIVSMK---QYPFRFXXXXXXXXXXXXXXTNDMTSYLTIEEILTYIFTYLKTSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAISAIYSYEINET----EEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYGSRKFSRALEDYL-LCLYQKMTETXXXXXXXXXXXXREVKYLQAHLTTSYLTEFRWNSI--GVDVAEVIPITRAKYDELISE----TIFELEKTLISFLKEIELKRSDIAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQFGKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNFDSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVESNGYIFVTATDLETKIQKRLVIRKSFERINVKE-NSMPND-EHMNEKDRELEIAYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFAKYSYAEIADLENVKKRFEANIKPILQNAF 1902
            T+IGI  G  Y  + +      E+IPN  G   T   + F +  + LIG  AK   +++ V  I  ++ L GR + +    K    YPF+    +      + IK  + +     EEI   +   +KT AE +L  KV    +TVP  F+++Q  + K    +AGL +++   +  +A  +Y +++      ++  +LV D+   + ++ +++ DQ   EV+ T+  ++ G   F + + DY  L   +K  +   K+ + I  L+REV+  +  L++   T     S+  G D +E +  TRAK++EL ++    T+  +EK     L++  LK++DIA+IVL+G S  IPK+Q+ +R FF   E       DEA A G          D     ++L D+    + +E+ G +   +I R   +P  K   FT   D+Q  +   V EG++ + + N FLGQ +    P   RG+    +   +++NG + V+A D  T  ++ +VI     R+  ++ + M  D E   E+D  ++   + R E+E   Y ++  +   +    ++ S  DLK   ++V ++I+W      A   D    K   E+ + PI+   +
Sbjct:   36 TVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKS--FQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSLLYKKKKNKDLKKDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETL--TRAKFEELNADLFKSTLIPVEK----VLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEAVAYGAAVQAGVLSGDSTTGDLLLLDVCPLTLGMELEGGVMAKLINRNTPIPTIKKDVFTTVVDNQNTVTTAVYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSD-DLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLY 645          
The following BLAST results are available for this feature:
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA53.138e-5928.06heat shock protein family A (Hsp70) member 5 [Sour... [more]
HSPA61.288e-4625.16heat shock protein family A (Hsp70) member 6 [Sour... [more]
HSPA89.492e-4525.08heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA89.492e-4525.08heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA89.492e-4525.08heat shock protein family A (Hsp70) member 8 [Sour... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-35.993e-5827.36Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-35.993e-5827.36Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-35.993e-5827.36Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-35.993e-5827.36Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-35.993e-5827.36Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-34.570e-5025.90gene:FBgn0001218 transcript:FBtr0073610[more]
Hsc70-34.570e-5025.90gene:FBgn0001218 transcript:FBtr0345166[more]
Hsc70-34.570e-5025.90gene:FBgn0001218 transcript:FBtr0073609[more]
Hsc70-34.570e-5025.90gene:FBgn0001218 transcript:FBtr0073611[more]
Hsc70-34.570e-5025.90gene:FBgn0001218 transcript:FBtr0073608[more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa55.854e-5727.23heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hsc703.797e-4424.23heat shock cognate 70 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
hsc703.797e-4424.23heat shock cognate 70 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
hspa83.009e-4224.60heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa83.009e-4224.60heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsg11.583e-5727.20neuronal vesicle trafficking associated 1 [Source:... [more]
nsg11.641e-5727.23neuronal vesicle trafficking associated 1 [Source:... [more]
nsg11.840e-5727.20neuronal vesicle trafficking associated 1 [Source:... [more]
nsg12.612e-5727.20neuronal vesicle trafficking associated 1 [Source:... [more]
nsg12.688e-5127.59neuronal vesicle trafficking associated 1 [Source:... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa52.083e-5928.06heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95... [more]
Hspa52.083e-5928.06heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95... [more]
Hspa86.392e-4525.08heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa27.791e-4324.84heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa27.791e-4324.84heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P06761|BIP_RAT1.078e-5928.22Endoplasmic reticulum chaperone BiP OS=Rattus norv... [more]
sp|Q24895|BIP_ECHMU3.003e-5926.05Endoplasmic reticulum chaperone BiP OS=Echinococcu... [more]
sp|Q90593|BIP_CHICK4.145e-5927.90Endoplasmic reticulum chaperone BiP OS=Gallus gall... [more]
sp|Q24798|BIP_ECHGR4.600e-5926.21Endoplasmic reticulum chaperone BiP OS=Echinococcu... [more]
sp|Q0VCX2|BIP_BOVIN1.358e-5827.90Endoplasmic reticulum chaperone BiP OS=Bos taurus ... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TVW31.328e-6026.98Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A183TPZ02.036e-5927.94Glucose-regulated protein OS=Schistocephalus solid... [more]
A0A0R3U5K96.372e-5926.73Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FET89.236e-5926.73Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3W3195.502e-5826.37Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa52.786e-5726.52heat shock protein family A (Hsp70) member 5 [Sour... [more]
hsc707.024e-4424.72heat shock cognate 71 kDa protein-like [Source:NCB... [more]
hspa8b5.390e-4325.08heat shock cognate 70 kDa protein-like [Source:NCB... [more]
hspa82.860e-4224.31heat shock cognate 71 kDa protein [Source:NCBI gen... [more]
ENSAMXT00000037064.15.447e-4225.16heat shock 70 kDa protein [Source:NCBI gene;Acc:11... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hspa52.961e-5526.58heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa95.419e-3423.22heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa146.208e-2122.73heat shock protein 14 [Source:NCBI gene;Acc:565232... [more]
hspa138.461e-626.56heat shock protein 70 family, member 13 [Source:ZF... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA31.399e-4424.96ATPase involved in protein folding and the respons... [more]
SSA44.914e-4425.12Heat shock protein that is highly induced upon str... [more]
KAR22.504e-4224.59ATPase involved in protein import into the ER; als... [more]
SSA21.113e-4024.03HSP70 family ATP-binding protein; involved in prot... [more]
SSA12.132e-4024.03ATPase involved in protein folding and NLS-directe... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332961.295e-5627.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445303.648e-4425.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372809.971e-4325.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303231.774e-3824.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477234.306e-3423.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa54.496e-5827.91heat shock protein family A (Hsp70) member 5 [Sour... [more]
hspa54.496e-5827.91heat shock protein family A (Hsp70) member 5 [Sour... [more]
hsp70-31.116e-4425.08heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
hsp70-31.118e-4425.08heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
hsc703.762e-4324.30heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060655.10.000e+099.68SMESG000060655.1[more]
SMESG000068215.12.672e-5427.89SMESG000068215.1[more]
SMESG000068215.12.766e-5427.89SMESG000068215.1[more]
SMESG000062699.13.482e-5325.65SMESG000062699.1[more]
SMESG000061528.12.568e-4626.49SMESG000061528.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004217 ID=SMED30004217|Name=Endoplasmic reticulum chaperone BiP|organism=Schmidtea mediterranea sexual|type=transcript|length=1956bp
TAATTGACCTAGAAAATGGCAGTTTATTTGAATTTATTAAAATTCTCATT
TGTCACTATTTTTGCCATTGTATCAAATGTTGGCTGCGAAACCAGTGAAA
CGATCATTGGAATACATTTCGGGAGGAAATATGTCAGGATGTCTCTTTGT
GACCGTGAAAGTTCGGAGTTGATTCCAAATTCCATTGGAGAATTAAAAAC
TCAAATCCTCGTTGGTTTCGACGAACATGATAAAGTTCTAATAGGCAAGG
AAGCCAAATACAGTTCAAGTTCTGTCATGGTCATAGATAGTTTGGAATAT
TTAGCCGGGAGGACCTTCGATGAAATAGTTTCTATGAAACAATATCCATT
TAGGTTTAAAATCAAGAACAAGTACAACAAACCCTACATTAAAATTAAAA
CAAATGACATGACCTCCTATCTCACAATTGAGGAAATTTTAACTTATATA
TTTACGTATTTAAAGACGAGTGCTGAAAGTTTCCTCAATTCAAAGGTTTT
TTCAATAGCACTTACCGTCCCCGATGATTTCTCTGAATCCCAATTGTTGT
CCATCAAAGCAGGTGCTAATTTGGCAGGGTTGAGAATAGTAAAATCTAGC
AGAGATGCCATATCGGCAATTTATTCGTACGAGATAAATGAAACCGAAGA
GGACATAAACGTGCTGGTCATTGATATTGCCGAAGATTCCACTAATTTAG
TAGTGGTTTCCTGTGATCAAAATGGTCAGGAAGTAATAGGTACACATGTT
ATCAGTAACTATGGATCAAGGAAATTTAGCCGCGCATTAGAAGACTATTT
GCTATGTCTCTATCAAAAAATGACAGAAACAAAATTGAAAAATAAGAAAA
ATATCCTTCATTTAAAACGAGAAGTTAAATATTTACAAGCCCATTTAACC
ACTTCCTATTTGACAGAATTTCGATGGAATTCTATAGGAGTTGATGTTGC
GGAAGTCATTCCGATTACTCGAGCAAAATACGATGAACTCATTTCCGAAA
CAATATTTGAGTTGGAGAAAACCTTAATCAGTTTCCTAAAGGAAATCGAG
TTAAAACGCTCGGATATCGCTCAAATCGTTTTATTAGGGTCTTCATTTAG
CATACCAAAACTGCAAAAGGAAATTCGAAATTTCTTTTATAATCACGAGT
TAAGATCGGAAAACGGTTTCGACGAGGCTCCCGCAATTGGTATTGGTAAA
ATCGGGCTGCAGTTCGGTAAAGACGATCAAATAAATTATGTCGTTCTTCC
AGATATTTTGTATAAGGATATAAGTATTGAGGTCTATGGTTCGATGTCGG
AAGTGATCATTGAAAGAGGTTTAATTCTTCCAAATAAGAAATCAAAGAAC
TTTACCCTGAACTTTGACAGCCAAATTGAAATAATCATAAACGTGTTAGA
AGGAGATAAACTTGTTGCAAGGCGAAATACGTTTCTCGGACAAATTGAAT
TTCGTCGACCTCCAACAGGATTGAGGGGGTTAACATTATTTAATATAGAA
ATCGCAGTGGAATCAAACGGATACATTTTCGTGACCGCCACTGACCTGGA
AACAAAGATACAAAAACGATTGGTTATCCGCAAGAGCTTCGAACGAATAA
ATGTCAAAGAAAATTCTATGCCGAATGATGAGCATATGAATGAAAAAGAT
AGAGAATTGGAAATTGCGTACAAAATTCGTGAAGAAATTGAAGACATTGC
CTATGAAATTCGAGGCCACATCTTACAGAATAGCAGCTTTATTCAACGGG
TTAAATCACCTATTGACCTAAAGATTTTGAAAGAATCTGTCAACGAAATC
ATCGAATGGTTCGCGAAATATTCTTACGCAGAAATCGCTGATTTAGAGAA
TGTAAAAAAGAGATTCGAAGCAAATATCAAACCGATTTTACAAAATGCTT
TCCACTTTTGATTTTACTCAACAGTTTTGTTTTTAGATGTAAACGTTTCA
GTTCAC
back to top

protein sequence of SMED30004217-orf-1

>SMED30004217-orf-1 ID=SMED30004217-orf-1|Name=SMED30004217-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=632bp
MAVYLNLLKFSFVTIFAIVSNVGCETSETIIGIHFGRKYVRMSLCDRESS
ELIPNSIGELKTQILVGFDEHDKVLIGKEAKYSSSSVMVIDSLEYLAGRT
FDEIVSMKQYPFRFKIKNKYNKPYIKIKTNDMTSYLTIEEILTYIFTYLK
TSAESFLNSKVFSIALTVPDDFSESQLLSIKAGANLAGLRIVKSSRDAIS
AIYSYEINETEEDINVLVIDIAEDSTNLVVVSCDQNGQEVIGTHVISNYG
SRKFSRALEDYLLCLYQKMTETKLKNKKNILHLKREVKYLQAHLTTSYLT
EFRWNSIGVDVAEVIPITRAKYDELISETIFELEKTLISFLKEIELKRSD
IAQIVLLGSSFSIPKLQKEIRNFFYNHELRSENGFDEAPAIGIGKIGLQF
GKDDQINYVVLPDILYKDISIEVYGSMSEVIIERGLILPNKKSKNFTLNF
DSQIEIIINVLEGDKLVARRNTFLGQIEFRRPPTGLRGLTLFNIEIAVES
NGYIFVTATDLETKIQKRLVIRKSFERINVKENSMPNDEHMNEKDRELEI
AYKIREEIEDIAYEIRGHILQNSSFIQRVKSPIDLKILKESVNEIIEWFA
KYSYAEIADLENVKKRFEANIKPILQNAFHF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR008916Retrov_capsid_C
IPR013126Hsp_70_fam
IPR029047HSP70_peptide-bd_sf
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005788endoplasmic reticulum lumen
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 408..427
score: 26.04
coord: 164..184
score: 31.29
coord: 29..42
score: 33.38
coord: 351..367
score: 47.43
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 210..380
e-value: 7.5E-62
score: 211.1
NoneNo IPR availableGENE3DG3DSA:3.30.30.30coord: 91..144
e-value: 7.5E-62
score: 211.1
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 250..332
e-value: 7.5E-62
score: 211.1
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 30..392
e-value: 7.5E-62
score: 211.1
NoneNo IPR availablePANTHERPTHR19375:SF380ENDOPLASMIC RETICULUM CHAPERONE BIPcoord: 20..628
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.569
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilyGENE3DG3DSA:2.60.34.10coord: 401..578
e-value: 6.9E-24
score: 86.3
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilySUPERFAMILYSSF100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 406..529
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 30..627
e-value: 2.3E-68
score: 230.8
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 20..628
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 211..397
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 29..208