AAEL003283-PA

Overview
NameAAEL003283-PA
Smed IDSMED30004208
Length (bp)2268
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AAEL003283-PA (SMED30004208) t-SNE clustered cells

Violin plots show distribution of expression levels for AAEL003283-PA (SMED30004208) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AAEL003283-PA (SMED30004208) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AAEL003283-PA (SMED30004208) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004208

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004208SMESG000004656.1 dd_Smed_v4_8909_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004208SMESG000004656.1 dd_Smed_v4_8909_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004208SMESG000004656.1 dd_Smed_v4_8909_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004208SMESG000004656.1 dd_Smed_v4_8909_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AAEL003283-PA vs. Ensembl Human
Match: SYTL5 (synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:15589])

HSP 1 Score: 142.51 bits (358), Expect = 1.490e-34
Identity = 112/398 (28.14%), Postives = 190/398 (47.74%), Query Frame = 2
Query:  992 DQVDAVSKVSSHGGNSLFKKLMSKKSE--NSTISKKSRSDVHSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLS-KYYGDIQVSIKYTINGKSSM------STNSPSDNFSEMSS---TTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA---RNGRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            D  D VS  S     +L K  + +  E  ++ +S +  ++ H + +  + +SLN M  + S         V       G+I++ +SY Y      I +K CRNL I       ++ YVK  L+P        +TK I +  NP+FNE  KY  I +  + +R   ++VWH ++ G++ FLG+V + F  +  ++ T  WF L+ K      P +  +Y G++ V ++Y    ++ M        N       +  S   + G + ++IK+A NL         +S+ K  LLP+ SK    KT +I+K+ NP WN  F F  I   ++ ++ +E+T+ DK+ +   +  LGG+ LN      +G+ V       +E+ +WQ+M   P T  E  L+LR
Sbjct:  336 DSEDTVSIRSKSVPGALDKDSLEETEESIDALVSSQLSTNTHRLASGLSTTSLNSMMSVYSETGDYGNVKV------SGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTK-IRTGTNPEFNETLKY-TISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPK--VEFAPDIGLQYKGELTVVLRYIPPEENLMLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKE-AFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEEQRLWQKMANNPGTPFEGVLMLR 722          
BLAST of AAEL003283-PA vs. Ensembl Human
Match: SYTL5 (synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:15589])

HSP 1 Score: 139.813 bits (351), Expect = 1.186e-33
Identity = 96/320 (30.00%), Postives = 160/320 (50.00%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLS-KYYGDIQVSIKYTINGKSSM------STNSPSDNFSEMSS---TTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA---RNGRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            G+I++ +SY Y      I +K CRNL I       ++ YVK  L+P        +TK I +  NP+FNE  KY  I +  + +R   ++VWH ++ G++ FLG+V + F  +  ++ T  WF L+ K      P +  +Y G++ V ++Y    ++ M        N       +  S   + G + ++IK+A NL         +S+ K  LLP+ SK    KT +I+K+ NP WN  F F  I   ++ ++ +E+T+ DK+ +   +  LGG+ LN      +G+ V       +E+ +WQ+M   P T  E  L+LR
Sbjct:  430 GEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTK-IRTGTNPEFNETLKY-TISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPK--VEFAPDIGLQYKGELTVVLRYIPPEENLMLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKE-AFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEEQRLWQKMANNPGTPFEGVLMLR 744          
BLAST of AAEL003283-PA vs. Ensembl Human
Match: SYTL4 (synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:15588])

HSP 1 Score: 136.346 bits (342), Expect = 1.013e-32
Identity = 86/310 (27.74%), Postives = 144/310 (46.45%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA---RNGRLV-----PIKEKEVWQQMITKPETWIEAKLVLR 2125
            G I   L Y    +   + +K+C  L  A      SNPYVK  L+P    +   +T      +NP ++E  +Y+ I    +  R    +VWH  + G++ FLG+  ++   ++LD    +   L  K        L  + G++ VS+KY    K+ +  +       E     G + +WIK+A NL  +      +S+ K  LLP  +K   +KTP+++K  NP +N  F +  +   +L  + +E+TV D++  L  +  LGG+ L +     NG +V       +E  +WQ+M   P +W E  L LR
Sbjct:  358 GRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYE-IPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGE----GGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDRE-PLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLR 661          
BLAST of AAEL003283-PA vs. Ensembl Human
Match: SYTL4 (synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:15588])

HSP 1 Score: 136.346 bits (342), Expect = 1.013e-32
Identity = 86/310 (27.74%), Postives = 144/310 (46.45%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA---RNGRLV-----PIKEKEVWQQMITKPETWIEAKLVLR 2125
            G I   L Y    +   + +K+C  L  A      SNPYVK  L+P    +   +T      +NP ++E  +Y+ I    +  R    +VWH  + G++ FLG+  ++   ++LD    +   L  K        L  + G++ VS+KY    K+ +  +       E     G + +WIK+A NL  +      +S+ K  LLP  +K   +KTP+++K  NP +N  F +  +   +L  + +E+TV D++  L  +  LGG+ L +     NG +V       +E  +WQ+M   P +W E  L LR
Sbjct:  358 GRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYE-IPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGE----GGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDRE-PLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLR 661          
BLAST of AAEL003283-PA vs. Ensembl Human
Match: SYTL4 (synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:15588])

HSP 1 Score: 136.346 bits (342), Expect = 1.013e-32
Identity = 86/310 (27.74%), Postives = 144/310 (46.45%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA---RNGRLV-----PIKEKEVWQQMITKPETWIEAKLVLR 2125
            G I   L Y    +   + +K+C  L  A      SNPYVK  L+P    +   +T      +NP ++E  +Y+ I    +  R    +VWH  + G++ FLG+  ++   ++LD    +   L  K        L  + G++ VS+KY    K+ +  +       E     G + +WIK+A NL  +      +S+ K  LLP  +K   +KTP+++K  NP +N  F +  +   +L  + +E+TV D++  L  +  LGG+ L +     NG +V       +E  +WQ+M   P +W E  L LR
Sbjct:  358 GRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYE-IPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGE----GGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDRE-PLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLR 661          
BLAST of AAEL003283-PA vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 85.8853 bits (211), Expect = 7.357e-17
Identity = 87/326 (26.69%), Postives = 147/326 (45.09%), Query Frame = 2
Query: 1169 SVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFL-----------KFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNI-ARNGRLVPIKEKEVWQQMITKPETWIEA 2110
            ++ +  E+A E GS   G I + L+Y+  +++ ++ + + +NL+ A+ ++  S+PYVK  L+P         +KTI   LNP++NE+  Y  I  +D   +   VTV   +++G   FLG+  +           KF+L+ L+ A P   + KE+         ++  G I V ++Y I                      GS+ + I +   L+    +   + Y K  L P +SK    KT   ++  NP WN Q  F  +   +LP   ++I V D  L    D  +GGI L+  A++ R         W + I  P T +EA
Sbjct:  814 AITASTESASEPGS--LGSITLTLTYHSADKKLKMHLIRAKNLK-AMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSD-FLGETRIALKKLNDNEMKKFNLY-LESALPVPQQTKEE--------ENEDRGKINVGLQYNIQ--------------------QGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQF-VVPFKDLPKKTLQIGVYDHDLG-KHDDYIGGILLSTSAKDER------GRQWIKCIENPGTLVEA 1098          
BLAST of AAEL003283-PA vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 85.5001 bits (210), Expect = 7.394e-17
Identity = 87/326 (26.69%), Postives = 147/326 (45.09%), Query Frame = 2
Query: 1169 SVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFL-----------KFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNI-ARNGRLVPIKEKEVWQQMITKPETWIEA 2110
            ++ +  E+A E GS   G I + L+Y+  +++ ++ + + +NL+ A+ ++  S+PYVK  L+P         +KTI   LNP++NE+  Y  I  +D   +   VTV   +++G   FLG+  +           KF+L+ L+ A P   + KE+         ++  G I V ++Y I                      GS+ + I +   L+    +   + Y K  L P +SK    KT   ++  NP WN Q  F  +   +LP   ++I V D  L    D  +GGI L+  A++ R         W + I  P T +EA
Sbjct:  670 AITASTESASEPGS--LGSITLTLTYHSADKKLKMHLIRAKNLK-AMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSD-FLGETRIALKKLNDNEMKKFNLY-LESALPVPQQTKEE--------ENEDRGKINVGLQYNIQ--------------------QGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQF-VVPFKDLPKKTLQIGVYDHDLG-KHDDYIGGILLSTSAKDER------GRQWIKCIENPGTLVEA 954          
BLAST of AAEL003283-PA vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 85.5001 bits (210), Expect = 7.944e-17
Identity = 87/326 (26.69%), Postives = 147/326 (45.09%), Query Frame = 2
Query: 1169 SVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFL-----------KFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNI-ARNGRLVPIKEKEVWQQMITKPETWIEA 2110
            ++ +  E+A E GS   G I + L+Y+  +++ ++ + + +NL+ A+ ++  S+PYVK  L+P         +KTI   LNP++NE+  Y  I  +D   +   VTV   +++G   FLG+  +           KF+L+ L+ A P   + KE+         ++  G I V ++Y I                      GS+ + I +   L+    +   + Y K  L P +SK    KT   ++  NP WN Q  F  +   +LP   ++I V D  L    D  +GGI L+  A++ R         W + I  P T +EA
Sbjct:  661 AITASTESASEPGS--LGSITLTLTYHSADKKLKMHLIRAKNLK-AMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSD-FLGETRIALKKLNDNEMKKFNLY-LESALPVPQQTKEE--------ENEDRGKINVGLQYNIQ--------------------QGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQF-VVPFKDLPKKTLQIGVYDHDLG-KHDDYIGGILLSTSAKDER------GRQWIKCIENPGTLVEA 945          
BLAST of AAEL003283-PA vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 85.5001 bits (210), Expect = 7.944e-17
Identity = 87/326 (26.69%), Postives = 147/326 (45.09%), Query Frame = 2
Query: 1169 SVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFL-----------KFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNI-ARNGRLVPIKEKEVWQQMITKPETWIEA 2110
            ++ +  E+A E GS   G I + L+Y+  +++ ++ + + +NL+ A+ ++  S+PYVK  L+P         +KTI   LNP++NE+  Y  I  +D   +   VTV   +++G   FLG+  +           KF+L+ L+ A P   + KE+         ++  G I V ++Y I                      GS+ + I +   L+    +   + Y K  L P +SK    KT   ++  NP WN Q  F  +   +LP   ++I V D  L    D  +GGI L+  A++ R         W + I  P T +EA
Sbjct:  661 AITASTESASEPGS--LGSITLTLTYHSADKKLKMHLIRAKNLK-AMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSD-FLGETRIALKKLNDNEMKKFNLY-LESALPVPQQTKEE--------ENEDRGKINVGLQYNIQ--------------------QGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQF-VVPFKDLPKKTLQIGVYDHDLG-KHDDYIGGILLSTSAKDER------GRQWIKCIENPGTLVEA 945          
BLAST of AAEL003283-PA vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 85.1149 bits (209), Expect = 1.009e-16
Identity = 87/326 (26.69%), Postives = 147/326 (45.09%), Query Frame = 2
Query: 1169 SVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFL-----------KFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNI-ARNGRLVPIKEKEVWQQMITKPETWIEA 2110
            ++ +  E+A E GS   G I + L+Y+  +++ ++ + + +NL+ A+ ++  S+PYVK  L+P         +KTI   LNP++NE+  Y  I  +D   +   VTV   +++G   FLG+  +           KF+L+ L+ A P   + KE+         ++  G I V ++Y I                      GS+ + I +   L+    +   + Y K  L P +SK    KT   ++  NP WN Q  F  +   +LP   ++I V D  L    D  +GGI L+  A++ R         W + I  P T +EA
Sbjct:  736 AITASTESASEPGS--LGSITLTLTYHSADKKLKMHLIRAKNLK-AMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSD-FLGETRIALKKLNDNEMKKFNLY-LESALPVPQQTKEE--------ENEDRGKINVGLQYNIQ--------------------QGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQF-VVPFKDLPKKTLQIGVYDHDLG-KHDDYIGGILLSTSAKDER------GRQWIKCIENPGTLVEA 1020          
BLAST of AAEL003283-PA vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334289)

HSP 1 Score: 149.443 bits (376), Expect = 1.734e-37
Identity = 107/366 (29.23%), Postives = 174/366 (47.54%), Query Frame = 2
Query: 1130 NASSLNDMTIINSSVVSKPENAVELGSDRQGDIMI------GLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTI--NGKSSM-----STNSPSDNF-------------SEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGI--SLNIARN-GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            N SSL+ + + + S+ S    A   G  R G +++       + YNY      + + +C++L       N S+PYVKV L+P        +TK     LNP F+E  ++ +     + SR   +TVWH +  G++ FLG+V +       D+    W+ L+E+        ++ Y GDI V +KY    N KSS      S    S N              SE +S  G + + +K+A +L     +   +++ K  LLP+ ++   +KTP++++  +P WN  F + ++S  EL +  +E+TV D    L  +  +GGI  SL   R+ GR V       KE  +WQ M+ +P  W+E  LVLR
Sbjct:  231 NRSSLSSLGVRSESMASVYSGA---GEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRF-HTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDE--VATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHD-RLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLR 589          
BLAST of AAEL003283-PA vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334288)

HSP 1 Score: 149.058 bits (375), Expect = 4.608e-37
Identity = 107/366 (29.23%), Postives = 174/366 (47.54%), Query Frame = 2
Query: 1130 NASSLNDMTIINSSVVSKPENAVELGSDRQGDIMI------GLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTI--NGKSSM-----STNSPSDNF-------------SEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGI--SLNIARN-GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            N SSL+ + + + S+ S    A   G  R G +++       + YNY      + + +C++L       N S+PYVKV L+P        +TK     LNP F+E  ++ +     + SR   +TVWH +  G++ FLG+V +       D+    W+ L+E+        ++ Y GDI V +KY    N KSS      S    S N              SE +S  G + + +K+A +L     +   +++ K  LLP+ ++   +KTP++++  +P WN  F + ++S  EL +  +E+TV D    L  +  +GGI  SL   R+ GR V       KE  +WQ M+ +P  W+E  LVLR
Sbjct:  339 NRSSLSSLGVRSESMASVYSGA---GEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRF-HTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDE--VATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHD-RLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLR 697          
BLAST of AAEL003283-PA vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334287)

HSP 1 Score: 145.976 bits (367), Expect = 1.748e-35
Identity = 107/366 (29.23%), Postives = 174/366 (47.54%), Query Frame = 2
Query: 1130 NASSLNDMTIINSSVVSKPENAVELGSDRQGDIMI------GLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTI--NGKSSM-----STNSPSDNF-------------SEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGI--SLNIARN-GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
            N SSL+ + + + S+ S    A   G  R G +++       + YNY      + + +C++L       N S+PYVKV L+P        +TK     LNP F+E  ++ +     + SR   +TVWH +  G++ FLG+V +       D+    W+ L+E+        ++ Y GDI V +KY    N KSS      S    S N              SE +S  G + + +K+A +L     +   +++ K  LLP+ ++   +KTP++++  +P WN  F + ++S  EL +  +E+TV D    L  +  +GGI  SL   R+ GR V       KE  +WQ M+ +P  W+E  LVLR
Sbjct: 1148 NRSSLSSLGVRSESMASVYSGA---GEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRF-HTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDE--VATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHD-RLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLR 1506          
BLAST of AAEL003283-PA vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334291)

HSP 1 Score: 143.665 bits (361), Expect = 6.809e-35
Identity = 107/366 (29.23%), Postives = 174/366 (47.54%), Query Frame = 2
Query: 1130 NASSLNDMTIINSSVVSKPENAVELGSDRQGDIMI------GLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTI--NGKSSM-----STNSPSDNF-------------SEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGI--SLNIARN-GRLV-----PIKEKEVWQQMITKPETWIEAKLVLR 2125
            N SSL+ + + + S+ S    A   G  R G +++       + YNY      + + +C++L       N S+PYVKV L+P        +TK     LNP F+E  ++ +     + SR   +TVWH +  G++ FLG+V +       D+    W+ L+E+        ++ Y GDI V +KY    N KSS      S    S N              SE +S  G + + +K+A +L     +   +++ K  LLP+ ++   +KTP++++  +P WN  F + ++S  EL +  +E+TV D    L  +  +GGI  SL   R+ GR V       KE  +WQ M+ +P  W+E  LVLR
Sbjct:  768 NRSSLSSLGVRSESMASVYSGA---GEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRF-HTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDE--VATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHD-RLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLR 1126          
BLAST of AAEL003283-PA vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334290)

HSP 1 Score: 144.05 bits (362), Expect = 7.013e-35
Identity = 107/366 (29.23%), Postives = 174/366 (47.54%), Query Frame = 2
Query: 1130 NASSLNDMTIINSSVVSKPENAVELGSDRQGDIMI------GLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTI--NGKSSM-----STNSPSDNF-------------SEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGI--SLNIARN-GRLV-----PIKEKEVWQQMITKPETWIEAKLVLR 2125
            N SSL+ + + + S+ S    A   G  R G +++       + YNY      + + +C++L       N S+PYVKV L+P        +TK     LNP F+E  ++ +     + SR   +TVWH +  G++ FLG+V +       D+    W+ L+E+        ++ Y GDI V +KY    N KSS      S    S N              SE +S  G + + +K+A +L     +   +++ K  LLP+ ++   +KTP++++  +P WN  F + ++S  EL +  +E+TV D    L  +  +GGI  SL   R+ GR V       KE  +WQ M+ +P  W+E  LVLR
Sbjct: 1198 NRSSLSSLGVRSESMASVYSGA---GEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRF-HTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDE--VATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHD-RLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLR 1556          
BLAST of AAEL003283-PA vs. Ensembl Zebrafish
Match: sytl5 (synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070912-424])

HSP 1 Score: 134.806 bits (338), Expect = 7.357e-34
Identity = 97/347 (27.95%), Postives = 166/347 (47.84%), Query Frame = 2
Query: 1148 DMTIINSSVVSKPENAVELGSDR-QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTT------------GSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            D T INS +    E   + GS R  G+I++ +SY+Y      +++++CR L         ++ YVK  L+P    +   +T   S++ NP FNE  +Y  + +  + +R   V+VWH ++ G + FLG+  L F  ++ D     WF L+ +  +     +  Y G++ V +KY I  + ++S   P D                     G + L +K+A NL T+      + + K  LLP+  K    KT +++++ NP WN  FT+  +  S+L  + +E+TV D++     +  LGG+ L        G+ V       +E+ +WQ+MI  PE   E  L+LR
Sbjct:   21 DTTSINSLMSVYSETG-DYGSVRVSGEILLNISYSYKTGALNVLVRECRCLATGDERRQRTDAYVKTYLLPDKSRQSKRKTSIKSNSTNPVFNENLRYV-VSHSQLETRTLQVSVWHHDRFGHNNFLGETELTFDSWEFDTQIEEWFALQPRIESDYVDSVMHYKGELTVVLKY-IPAERNVSL--PLDQVQVKKGFLKGKKKTITLPKGGMVELLVKEAKNL-TAVKGGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHSDLDSVCLELTVWDRE-PFASNVFLGGVRLGAGTGLSYGKEVDWNDAYGEEQRLWQRMIDNPEVPQECTLMLR 360          
BLAST of AAEL003283-PA vs. Ensembl Zebrafish
Match: sytl5 (synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070912-424])

HSP 1 Score: 139.043 bits (349), Expect = 8.783e-34
Identity = 102/361 (28.25%), Postives = 172/361 (47.65%), Query Frame = 2
Query: 1106 VHSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDR-QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTT------------GSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
             H  TN+S   S   MT INS +    E   + GS R  G+I++ +SY+Y      +++++CR L         ++ YVK  L+P    +   +T   S++ NP FNE  +Y  + +  + +R   V+VWH ++ G + FLG+  L F  ++ D     WF L+ +  +     +  Y G++ V +KY I  + ++S   P D                     G + L +K+A NL T+      + + K  LLP+  K    KT +++++ NP WN  FT+  +  S+L  + +E+TV D++     +  LGG+ L        G+ V       +E+ +WQ+MI  PE   E  L+LR
Sbjct:  309 AHYKTNRS-VCSAQSMTSINSLMSVYSETG-DYGSVRVSGEILLNISYSYKTGALNVLVRECRCLATGDERRQRTDAYVKTYLLPDKSRQSKRKTSIKSNSTNPVFNENLRYV-VSHSQLETRTLQVSVWHHDRFGHNNFLGETELTFDSWEFDTQIEEWFALQPRIESDYVDSVMHYKGELTVVLKY-IPAERNVSL--PLDQVQVKKGFLKGKKKTITLPKGGMVELLVKEAKNL-TAVKGGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHSDLDSVCLELTVWDRE-PFASNVFLGGVRLGAGTGLSYGKEVDWNDAYGEEQRLWQRMIDNPEVPQECTLMLR 661          
BLAST of AAEL003283-PA vs. Ensembl Zebrafish
Match: si:ch211-266g18.6 (si:ch211-266g18.6 [Source:ZFIN;Acc:ZDB-GENE-131121-599])

HSP 1 Score: 136.346 bits (342), Expect = 1.372e-32
Identity = 96/342 (28.07%), Postives = 173/342 (50.58%), Query Frame = 2
Query: 1127 SNASSLNDMTIINSSVVSKPENAVELGS-DRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            ++A SL D T    S++S   +A + G+ + QG +   + Y+ + E   I+I++C++L IA P    ++PYVK  L P        +T      +NP F E  +YK +  E++  ++  ++VWH++  G++VFLGQV L F  +        W+ L+ K  T       +  G + VS+KY            PS +     S+TG I +W+++A  L       + +S+ KC +LP++ K   +KT +++K  +P++N    +      E+ +   E+TV D   + L +  LGG+ L++      G+ V       +E ++W++M+  P +W+E +L LR
Sbjct:  497 ASALSLTDRT---GSLLSVYSDAGDFGTVEVQGSVEFAVMYSPVGE-LIIMIEQCQDLAIANPRKQRTDPYVKTYLYPDKSRRSKRKTTIKKRTVNPVFVESLRYK-VNREELPEKSLNLSVWHNDSRGRNVFLGQVELSFRTWDWGHEALTWYNLQPK--TSENAETKESNGLLSVSLKYV-----------PSASTGGSKSSTGEIHVWLREAKELRRLKPQGV-DSFVKCYILPDTRKKSRQKTRVVKKTQDPVYNHAMVYDGFKTGEVTEACCELTVWDH--NTLANQFLGGVRLSLGTGQSYGKKVDWMDSVDEEVQIWKRMLASPNSWVEGELPLR 817          
BLAST of AAEL003283-PA vs. Ensembl Zebrafish
Match: sytl2b (synaptotagmin-like 2b [Source:ZFIN;Acc:ZDB-GENE-121214-363])

HSP 1 Score: 127.872 bits (320), Expect = 1.090e-31
Identity = 89/312 (28.53%), Postives = 153/312 (49.04%), Query Frame = 2
Query: 1211 DRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNL-LTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKK------LSLLRDGLLGGISLNIARNGRLVPIKEKEVWQQMITKPETWIEAKLVLR 2125
            D QG I   L+Y +   EF I + +C+NL       N S+PYVK  L+P   +    +T      LNP +NE  +Y+ ++ E + S+   ++ WH++  G++ FLG++ L  S +  +D       LK +    + P  S   G ++++I++    + S S N P          +G + +W+K   NL L  S +  P  Y KC +LP++SK   +KT ++++  NPI+N    +      +L +  +E+TV D+       L  LR G+  G S  +  +      +E  +W++M+  P  W+E  L LR
Sbjct:   55 DVQGSIQFSLNYVHKLREFHIFVVQCQNLAAVDAKRNRSDPYVKSYLIPDPANLGKRKTAVKKKTLNPTYNEILRYR-VRMEYLTSQVLNLSAWHNDMFGRNSFLGEIELDLSTWDFNDTERKLLPLKPR--VHLQP--SDLKGQMRLAIRFL--PQISHSKNVPG---------SGEVHIWVKDCKNLPLIRSPTIDP--YVKCFVLPDTSKKSRQKTRVLKRTTNPIFNHTMVYDGFRAEDLKEACVELTVWDRDRLASHSLGGLRLGMGTGRSYGVQVDWMDSTTEEVALWRRMMNSPNEWVEDILPLR 348          
BLAST of AAEL003283-PA vs. Ensembl Zebrafish
Match: sytl2b (synaptotagmin-like 2b [Source:ZFIN;Acc:ZDB-GENE-121214-363])

HSP 1 Score: 128.642 bits (322), Expect = 7.135e-30
Identity = 90/315 (28.57%), Postives = 153/315 (48.57%), Query Frame = 2
Query: 1211 DRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITP---VLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNL-LTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKK------LSLLRDGLLGGISLNIARNGRLVPIKEKEVWQQMITKPETWIEAKLVLR 2125
            D QG I   L+Y +   EF I + +C+NL       N S+PYVK  L+P   +    +T      LNP +NE  +Y+ ++ E + S+   ++ WH++  G++ FLG++ L  S +  +D       LK +   I T      S   G ++++I++    + S S N P          +G + +W+K   NL L  S +  P  Y KC +LP++SK   +KT ++++  NPI+N    +      +L +  +E+TV D+       L  LR G+  G S  +  +      +E  +W++M+  P  W+E  L LR
Sbjct: 1427 DVQGSIQFSLNYVHKLREFHIFVVQCQNLAAVDAKRNRSDPYVKSYLIPDPANLGKRKTAVKKKTLNPTYNEILRYR-VRMEYLTSQVLNLSAWHNDMFGRNSFLGEIELDLSTWDFNDTERKLLPLKPRNLFIQTTNSLQPSDLKGQMRLAIRFL--PQISHSKNVPG---------SGEVHIWVKDCKNLPLIRSPTIDP--YVKCFVLPDTSKKSRQKTRVLKRTTNPIFNHTMVYDGFRAEDLKEACVELTVWDRDRLASHSLGGLRLGMGTGRSYGVQVDWMDSTTEEVALWRRMMNSPNEWVEDILPLR 1727          
BLAST of AAEL003283-PA vs. Ensembl Xenopus
Match: SYTL5 (synaptotagmin like 5 [Source:NCBI gene;Acc:100496000])

HSP 1 Score: 158.303 bits (399), Expect = 5.527e-41
Identity = 96/311 (30.87%), Postives = 168/311 (54.02%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSIT-LWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            G+I++ ++Y+Y      +++K CRNL +A    N ++PYVK  L+P    +   +TK  ++  +PDFNE  KY  I +  + +R   +TVWH+++ G++ FLG+V +       ++     F+L+ K   + + V  +Y G+I V ++Y    K   +   P D  + +   +G +  + IK A NL         +++ K  LLP+++K    KTP+++K  NP WN  FTF ++  S+L ++ +E+TV  K+ SL  +  LGG+ L        G +V       +E+ +WQ+M+  P T +EA L+LR
Sbjct:  163 GEILLNINYSYKTGALNVVVKNCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYV-ISHTQLETRTLQLTVWHNDRFGRNSFLGEVDIPLDSCNFENQEDECFQLQPK-MDLASDVTLQYKGEITVGLRYITPEK---NLTLPLDKKANVKVPSGGLVEVLIKNAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSNVCVELTVWGKE-SLTSNVFLGGVCLGCGSGVSYGDIVDWMDSHGEEQFLWQKMMDNPGTMVEATLMLR 467          
BLAST of AAEL003283-PA vs. Ensembl Xenopus
Match: SYTL5 (synaptotagmin like 5 [Source:NCBI gene;Acc:100496000])

HSP 1 Score: 158.688 bits (400), Expect = 9.437e-40
Identity = 98/322 (30.43%), Postives = 169/322 (52.48%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSS------------TTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
            G+I++ ++Y+Y      +++K CRNL +A    N ++PYVK  L+P    +   +TK  ++  +PDFNE  KY  I +  + +R   +TVWH+++ G++ FLG+V +       ++     F+L+ K   + + V  +Y G+I V ++Y    K   +   P D  +E  S            + G + + IK A NL         +++ K  LLP+++K    KTP+++K  NP WN  FTF ++  S+L ++ +E+TV  K+ SL  +  LGG+ L        G +V       +E+ +WQ+M+  P T +EA L+LR
Sbjct:  464 GEILLNINYSYKTGALNVVVKNCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYV-ISHTQLETRTLQLTVWHNDRFGRNSFLGEVDIPLDSCNFENQEDECFQLQPK-MDLASDVTLQYKGEITVGLRYITPEK---NLTLPLDKVAEKKSFRKSKKANVKVPSGGLVEVLIKNAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSNVCVELTVWGKE-SLTSNVFLGGVCLGCGSGVSYGDIVDWMDSHGEEQFLWQKMMDNPGTMVEATLMLR 779          
BLAST of AAEL003283-PA vs. Ensembl Xenopus
Match: SYTL5 (synaptotagmin like 5 [Source:NCBI gene;Acc:100496000])

HSP 1 Score: 155.992 bits (393), Expect = 1.391e-39
Identity = 95/317 (29.97%), Postives = 170/317 (53.63%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKS-SMSTNSPSDNFSEMSS------TTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            G+I++ ++Y+Y      +++K CRNL +A    N ++PYVK  L+P    +   +TK  ++  +PDFNE  KY  I +  + +R   +TVWH+++ G++ FLG+V +       ++     F+L+ K   + + V  +Y G+I V ++Y    K+ ++  +    +F +         + G + + IK A NL         +++ K  LLP+++K    KTP+++K  NP WN  FTF ++  S+L ++ +E+TV  K+ SL  +  LGG+ L        G +V       +E+ +WQ+M+  P T +EA L+LR
Sbjct:  244 GEILLNINYSYKTGALNVVVKNCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYV-ISHTQLETRTLQLTVWHNDRFGRNSFLGEVDIPLDSCNFENQEDECFQLQPK-MDLASDVTLQYKGEITVGLRYITPEKNLTLPLDKVKKSFRKSKKANVKVPSGGLVEVLIKNAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSNVCVELTVWGKE-SLTSNVFLGGVCLGCGSGVSYGDIVDWMDSHGEEQFLWQKMMDNPGTMVEATLMLR 557          
BLAST of AAEL003283-PA vs. Ensembl Xenopus
Match: SYTL5 (synaptotagmin like 5 [Source:NCBI gene;Acc:100496000])

HSP 1 Score: 154.451 bits (389), Expect = 2.808e-39
Identity = 96/319 (30.09%), Postives = 166/319 (52.04%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSS---------TTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            G+I++ ++Y+Y      +++K CRNL +A    N ++PYVK  L+P    +   +TK  ++  +PDFNE  KY  I +  + +R   +TVWH+++ G++ FLG+V +       ++     F+L+ K   + + V  +Y G+I V ++Y    K   +   P D                + G + + IK A NL         +++ K  LLP+++K    KTP+++K  NP WN  FTF ++  S+L ++ +E+TV  K+ SL  +  LGG+ L        G +V       +E+ +WQ+M+  P T +EA L+LR
Sbjct:  203 GEILLNINYSYKTGALNVVVKNCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYV-ISHTQLETRTLQLTVWHNDRFGRNSFLGEVDIPLDSCNFENQEDECFQLQPK-MDLASDVTLQYKGEITVGLRYITPEK---NLTLPLDKKKSFRKSKKANVKVPSGGLVEVLIKNAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSNVCVELTVWGKE-SLTSNVFLGGVCLGCGSGVSYGDIVDWMDSHGEEQFLWQKMMDNPGTMVEATLMLR 515          
BLAST of AAEL003283-PA vs. Ensembl Xenopus
Match: SYTL5 (synaptotagmin like 5 [Source:NCBI gene;Acc:100496000])

HSP 1 Score: 154.066 bits (388), Expect = 6.221e-39
Identity = 96/319 (30.09%), Postives = 166/319 (52.04%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSS---------TTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            G+I++ ++Y+Y      +++K CRNL +A    N ++PYVK  L+P    +   +TK  ++  +PDFNE  KY  I +  + +R   +TVWH+++ G++ FLG+V +       ++     F+L+ K   + + V  +Y G+I V ++Y    K   +   P D                + G + + IK A NL         +++ K  LLP+++K    KTP+++K  NP WN  FTF ++  S+L ++ +E+TV  K+ SL  +  LGG+ L        G +V       +E+ +WQ+M+  P T +EA L+LR
Sbjct:  251 GEILLNINYSYKTGALNVVVKNCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYV-ISHTQLETRTLQLTVWHNDRFGRNSFLGEVDIPLDSCNFENQEDECFQLQPK-MDLASDVTLQYKGEITVGLRYITPEK---NLTLPLDKKKSFRKSKKANVKVPSGGLVEVLIKNAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSNVCVELTVWGKE-SLTSNVFLGGVCLGCGSGVSYGDIVDWMDSHGEEQFLWQKMMDNPGTMVEATLMLR 563          
BLAST of AAEL003283-PA vs. Ensembl Mouse
Match: Sytl5 (synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:2668451])

HSP 1 Score: 146.362 bits (368), Expect = 5.759e-36
Identity = 102/366 (27.87%), Postives = 176/366 (48.09%), Query Frame = 2
Query: 1082 ISKKSRSDVHSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLS-KYYGDIQVSIKYTI--------NGKSSMSTNSPSDNFSEMSSTTGSI-TLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            +S +  ++ HS+ +  + +SLN M  + S         V       G+I++ +SY Y      I +K CRNL         ++ YVK  L+P        +TK I +  NP+FNE  KY  I +  + +R   ++VWH ++ G++ FLG+V + F  +  ++    WF L+ K    + P +S +Y G++ + ++Y           G+             E SS +G I  ++IK+A NL         +S+ K  LLP+ +K    KT +++K+ NP WN  F F  +   ++ +  +E+T+ DK+ +   +  LGG+ LN       G+ V       +E+ +WQ+M   P T +E  L+LR
Sbjct:  369 VSSRFSANTHSLASGLSTTSLNSMMSVYSETGDYGNVKV------TGEILLHISYCYKTGGLYIFVKSCRNLATGDEKKQRTDAYVKSYLLPDKSRNNKRKTK-IRTGTNPEFNETLKY-TISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPK--VELAPDISLQYKGELTIVLRYIPPEENLIFPAGQRQEKKIFKRGKKKESSSISGGILEVFIKKAKNLTAVKSGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPEWNHTFIFSGLYPQDIKNACLELTIWDKE-AFSSNVFLGGVRLNSGSGMSYGKTVDWMDSHGEEQRLWQKMADNPGTSVEGVLMLR 723          
BLAST of AAEL003283-PA vs. Ensembl Mouse
Match: Sytl5 (synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:2668451])

HSP 1 Score: 145.206 bits (365), Expect = 1.710e-35
Identity = 112/396 (28.28%), Postives = 185/396 (46.72%), Query Frame = 2
Query:  992 DQVDAVSKVSSHGGNSLFKKLMSKKSENSTISKKSRSDVHSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLS-KYYGDIQVSIKYTI--------NGKSSMSTNSPSDNFSEMSSTTGSI-TLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
            D VD VS   S   +SL   L +     S    + RS ++     S+ +SLN M  + S         V       G+I++ +SY Y      I +K CRNL         ++ YVK  L+P        +TK I +  NP+FNE  KY  I +  + +R   ++VWH ++ G++ FLG+V + F  +  ++    WF L+ K    + P +S +Y G++ + ++Y           G+             E SS +G I  ++IK+A NL         +S+ K  LLP+ +K    KT +++K+ NP WN  F F  +   ++ +  +E+T+ DK+ +   +  LGG+ LN       G+ V       +E+ +WQ+M   P T +E  L+LR
Sbjct:  364 DGVDLVSSRFSANTHSLASGLSTNSQAGS---DRKRSYLNVPDADSDTTSLNSMMSVYSETGDYGNVKV------TGEILLHISYCYKTGGLYIFVKSCRNLATGDEKKQRTDAYVKSYLLPDKSRNNKRKTK-IRTGTNPEFNETLKY-TISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPK--VELAPDISLQYKGELTIVLRYIPPEENLIFPAGQRQEKKIFKRGKKKESSSISGGILEVFIKKAKNLTAVKSGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPEWNHTFIFSGLYPQDIKNACLELTIWDKE-AFSSNVFLGGVRLNSGSGMSYGKTVDWMDSHGEEQRLWQKMADNPGTSVEGVLMLR 745          
BLAST of AAEL003283-PA vs. Ensembl Mouse
Match: Sytl4 (synaptotagmin-like 4 [Source:MGI Symbol;Acc:MGI:1351606])

HSP 1 Score: 137.117 bits (344), Expect = 4.029e-33
Identity = 87/310 (28.06%), Postives = 145/310 (46.77%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA---RNGRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            G I   L +    +   I +K+C  L  A      SNPYVK  L+P    +   +T      +NP ++E  +Y+ I    +  R    +VWH  + G++ FLG+  +    ++LD    +   L  K  T  +P L  + G++ VS+KY    K  +  +       E     G + +WIK+A NL  +      +S+ K  LLP  +K   +KTP+++K  +P +N  F +  +   +L  + +E+TV D++  L  +  LGG+ L +     NG +V       +E  +WQ+M   P +W E  L LR
Sbjct:  360 GKIAFSLKFEQKTQTLVIHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETFRYE-ISESLLAQRTLQFSVWHHGRFGRNTFLGEAEVHMDSWKLDKKLDHCLPLHGKISTESSPGLPAHKGELVVSLKYIPASKLPVGGDRKKSKGGE----GGELQVWIKEAKNLTAAKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLSPHYNHTFVYNGVRLEDLQHMCLELTVWDRE-PLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLR 663          
BLAST of AAEL003283-PA vs. Ensembl Mouse
Match: Sytl3 (synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:1933367])

HSP 1 Score: 120.168 bits (300), Expect = 1.207e-28
Identity = 91/331 (27.49%), Postives = 148/331 (44.71%), Query Frame = 2
Query: 1163 NSSVVSKPENAVELG----SDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPN---WFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAK-CLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARNGRLVP---IKEKEVWQQMITKPETWIEAKLVL 2122
            + S++S      E+G    ++  G+I   + Y        I IK C+NL          NPYVK  L+P   S+   +T+   + L+P F E  KY+ +    +++R   V+VWH   L + VFLG+V L  +++   D+T     W+ L+ K       +  +  G++ V  K  +          P +      +  G + L +  A NL   S   L NS+ K CL LP   K+   K+P+++K   P W   F F  +S S+L    +E+TV D+ +  + D LLG   L         P    + K  W ++++ P  W +  LVL
Sbjct:   79 HGSLISINSTCTEMGNFDNANVTGEIEFAIHYCVKSCSLEICIKTCKNLAYGEEKKRKCNPYVKTYLLPDRSSQGKRKTRVQKNTLDPTFEETLKYQ-VDPGQLMTRRLQVSVWHLGTLARRVFLGEVILPLAMWDFKDSTAQNARWYPLRAKAEKYEENI-PQNNGELAVRAKLVL----PAGPRKPQEAQEGQLALNGQLCLVVLGAKNLPVRSDGTL-NSFVKGCLTLPNQQKL-RVKSPVLKKQACPQWKHSFVFNGVSSSQLRQSTLELTVWDQAIFGMNDRLLGEARLGSKGGAAGCPDSGSQSKLQWHRVLSSPNLWTDMTLVL 401          
BLAST of AAEL003283-PA vs. Ensembl Mouse
Match: Sytl1 (synaptotagmin-like 1 [Source:MGI Symbol;Acc:MGI:1933365])

HSP 1 Score: 122.479 bits (306), Expect = 1.239e-28
Identity = 83/311 (26.69%), Postives = 153/311 (49.20%), Query Frame = 2
Query: 1217 QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
            +G ++  L Y     E R+ + +C+ L  A      S+PYVK  L+P   S++  +T     NLNP FNE  ++ +++  D+  R   ++VWH E LG+++FLG+V +    +  D     W  L+ + P     + S+  G + +S+KY   G  S     P          +G +  W+K+A +L+      L ++Y +C +LP+ S+   ++T ++R++ +P++N    +     ++L     E+++ D      R   LGG  L++      G  VP      +EK++WQ ++ +P  W++  L LR
Sbjct:  273 RGSVLFSLRYEPGTSELRVQVIQCQGLAAA--RRRRSDPYVKSYLLPDKQSKR--KTSVKKRNLNPIFNETLRH-SVQQADLPGRVLSLSVWHRESLGRNIFLGEVEVPLDTWNWDSEA-TWLPLQPRVPPSPDELPSR--GLLSLSLKYVPAG--SEGGGQPQ---------SGELHFWVKEAQSLVPLRPGSL-DTYIQCSVLPDDSRASRQRTRVVRRSLSPVFNHTMVYDGFGPADLRQACAELSLWDHGALASRQ--LGGTRLSLGTGSSYGLQVPWMDSTPEEKQLWQTLLERPCEWVDGLLPLR 561          
BLAST of AAEL003283-PA vs. UniProt/SwissProt
Match: sp|Q80T23|SYTL5_MOUSE (Synaptotagmin-like protein 5 OS=Mus musculus OX=10090 GN=Sytl5 PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.196e-34
Identity = 112/396 (28.28%), Postives = 185/396 (46.72%), Query Frame = 2
Query:  992 DQVDAVSKVSSHGGNSLFKKLMSKKSENSTISKKSRSDVHSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLS-KYYGDIQVSIKYTI--------NGKSSMSTNSPSDNFSEMSSTTGSI-TLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
            D VD VS   S   +SL   L +     S    + RS ++     S+ +SLN M  + S         V       G+I++ +SY Y      I +K CRNL         ++ YVK  L+P        +TK I +  NP+FNE  KY  I +  + +R   ++VWH ++ G++ FLG+V + F  +  ++    WF L+ K    + P +S +Y G++ + ++Y           G+             E SS +G I  ++IK+A NL         +S+ K  LLP+ +K    KT +++K+ NP WN  F F  +   ++ +  +E+T+ DK+ +   +  LGG+ LN       G+ V       +E+ +WQ+M   P T +E  L+LR
Sbjct:  364 DGVDLVSSRFSANTHSLASGLSTNSQAGS---DRKRSYLNVPDADSDTTSLNSMMSVYSETGDYGNVKV------TGEILLHISYCYKTGGLYIFVKSCRNLATGDEKKQRTDAYVKSYLLPDKSRNNKRKTK-IRTGTNPEFNETLKY-TISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPK--VELAPDISLQYKGELTIVLRYIPPEENLIFPAGQRQEKKIFKRGKKKESSSISGGILEVFIKKAKNLTAVKSGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPEWNHTFIFSGLYPQDIKNACLELTIWDKE-AFSSNVFLGGVRLNSGSGMSYGKTVDWMDSHGEEQRLWQKMADNPGTSVEGVLMLR 745          
BLAST of AAEL003283-PA vs. UniProt/SwissProt
Match: sp|Q812E4|SYTL5_RAT (Synaptotagmin-like protein 5 OS=Rattus norvegicus OX=10116 GN=Sytl5 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.320e-34
Identity = 109/396 (27.53%), Postives = 184/396 (46.46%), Query Frame = 2
Query:  992 DQVDAVSKVSSHGGNSLFKKLMSKKSENSTISKKSRSDVHSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLS-KYYGDIQVSIKYT---------INGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA---RNGRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
            D VD VS   S   +SL   L +     S    + RS +H     S+ +SLN M  + S         V       G+I++ +SY Y      I +K CRNL I       ++ YVK  L+P        +TK I +  NP+FNE  KY  I +  + +R   ++VWH ++ G++ FLG+V + F  +  ++    WF L+ K    + P +S +Y G++ + ++Y          +                  + + G + ++IK+A NL         +S+ K  LLP+ +K    KT +++K+ NP WN  F F  +   ++ +  +E+T+ DK+ +   +  LGG+ LN      +G+ V       +E+ +WQ+M   P T +E  L+LR
Sbjct:  364 DGVDLVSSRFSANTHSLASGLSTSSQAGS---DRKRSYLHVPDADSDTTSLNSMMSVYSETGDYGNVKV------TGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKTRNNKRKTK-IRTGTNPEFNETLKY-TISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPK--VELAPDISLQYKGELTIVLRYIPPEENLIFPVEQPQGKKIFKKGKKKESPAISGGILEVFIKEAKNLTAVKAGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPQWNHVFIFSGLYPQDIQNACLELTIWDKE-AFSSNIFLGGVRLNSGSGISHGKAVDWMDSRGEEQRLWQKMADNPGTSVEGVLMLR 745          
BLAST of AAEL003283-PA vs. UniProt/SwissProt
Match: sp|Q8TDW5|SYTL5_HUMAN (Synaptotagmin-like protein 5 OS=Homo sapiens OX=9606 GN=SYTL5 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 7.154e-34
Identity = 112/398 (28.14%), Postives = 190/398 (47.74%), Query Frame = 2
Query:  992 DQVDAVSKVSSHGGNSLFKKLMSKKSE--NSTISKKSRSDVHSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLS-KYYGDIQVSIKYTINGKSSM------STNSPSDNFSEMSS---TTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA---RNGRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            D  D VS  S     +L K  + +  E  ++ +S +  ++ H + +  + +SLN M  + S         V       G+I++ +SY Y      I +K CRNL I       ++ YVK  L+P        +TK I +  NP+FNE  KY  I +  + +R   ++VWH ++ G++ FLG+V + F  +  ++ T  WF L+ K      P +  +Y G++ V ++Y    ++ M        N       +  S   + G + ++IK+A NL         +S+ K  LLP+ SK    KT +I+K+ NP WN  F F  I   ++ ++ +E+T+ DK+ +   +  LGG+ LN      +G+ V       +E+ +WQ+M   P T  E  L+LR
Sbjct:  336 DSEDTVSIRSKSVPGALDKDSLEETEESIDALVSSQLSTNTHRLASGLSTTSLNSMMSVYSETGDYGNVKV------SGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTK-IRTGTNPEFNETLKY-TISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPK--VEFAPDIGLQYKGELTVVLRYIPPEENLMLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKE-AFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEEQRLWQKMANNPGTPFEGVLMLR 722          
BLAST of AAEL003283-PA vs. UniProt/SwissProt
Match: sp|Q8VHQ7|SYTL4_RAT (Synaptotagmin-like protein 4 OS=Rattus norvegicus OX=10116 GN=Sytl4 PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.535e-32
Identity = 87/310 (28.06%), Postives = 144/310 (46.45%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            G I   L +    +   I +K+C  L  A      SNPYVK  L+P    +   +T      +NP ++E  +Y+ I    +  R    +VWH  + G++ FLG+  +    ++LD    +   L  K  T  +P L  + G++ VS+KY    K  +  +       E     G + +WIK+A NL  +      +S+ K  LLP  +K   +KTP+++K  NP +N  F +  +   +L  + +E+TV D++  L  +  LGG+ L +      G +V       +E  +WQ+M   P +W E  L LR
Sbjct:  359 GKIAFSLKFEQKTQTLVIHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETFRYE-ISESLLAQRTLQFSVWHHGRFGRNTFLGEAEVHMDSWKLDKKLDHCLPLHGKISTESSPGLPAHKGELVVSLKYIPASKLPVGGDRKKSKGGE----GGELQVWIKEAKNLTAAKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDRE-PLASNDFLGGVRLGVGTGISSGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLR 662          
BLAST of AAEL003283-PA vs. UniProt/SwissProt
Match: sp|Q9R0Q1|SYTL4_MOUSE (Synaptotagmin-like protein 4 OS=Mus musculus OX=10090 GN=Sytl4 PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.819e-32
Identity = 87/310 (28.06%), Postives = 145/310 (46.77%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA---RNGRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            G I   L +    +   I +K+C  L  A      SNPYVK  L+P    +   +T      +NP ++E  +Y+ I    +  R    +VWH  + G++ FLG+  +    ++LD    +   L  K  T  +P L  + G++ VS+KY    K  +  +       E     G + +WIK+A NL  +      +S+ K  LLP  +K   +KTP+++K  +P +N  F +  +   +L  + +E+TV D++  L  +  LGG+ L +     NG +V       +E  +WQ+M   P +W E  L LR
Sbjct:  360 GKIAFSLKFEQKTQTLVIHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETFRYE-ISESLLAQRTLQFSVWHHGRFGRNTFLGEAEVHMDSWKLDKKLDHCLPLHGKISTESSPGLPAHKGELVVSLKYIPASKLPVGGDRKKSKGGE----GGELQVWIKEAKNLTAAKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLSPHYNHTFVYNGVRLEDLQHMCLELTVWDRE-PLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLR 663          
BLAST of AAEL003283-PA vs. TrEMBL
Match: A0A3S1AFW7 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_001356 PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 2.254e-46
Identity = 110/323 (34.06%), Postives = 166/323 (51.39%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMS-------------STTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            GDI   +SY+Y      + +K+CRNL       N S+PYVK  L+P        +TK     LNP F+E  KY NI   ++ SR   + VWH+++LG++ FLG+V +    ++ DDA+P W++L E+ P      L  Y GD+ VS+ Y       M  NSP+   S  S             S TG + + +++A NL     +   N + K  LLP+ S    +KTP+++K  NP WN    FP    S L D G+E+T+ D + +L+ +  LGG+ LN+      GR V       +E + WQ M+ +P  W++A+L LR
Sbjct:  237 GDIQFHMSYDYKNSVLLVHVKQCRNLAPVDVKRNRSDPYVKTYLLPDKSRAGKRKTKIKKHTLNPTFDEVLKY-NISKPELESRVLFLAVWHNDRLGRNDFLGEVTVPLDYYRFDDASPQWYQLAERVPPQEDMSLMVYKGDLFVSLMYL---PPDMVENSPAKKKSGGSFRKKDKDRAKDKPSGTGELHVLVREAQNLTAMRGAAGSNPFCKGYLLPDVSHASKQKTPVLKKTTNPQWNHTLIFPGADMSVLADHGLELTIWDHE-ALVSNDFLGGVRLNLGSGICQGRPVEWMDARGEEVDAWQAMMDQPGQWVDAQLPLR 554          
BLAST of AAEL003283-PA vs. TrEMBL
Match: A0A0L8G3J5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22001081mg PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 7.141e-44
Identity = 116/370 (31.35%), Postives = 187/370 (50.54%), Query Frame = 2
Query: 1067 SENSTISKKSRSDVHSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDR---QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGK----SSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLRKD 2131
             EN     K    + S  + S++  L        S+ S   NA E+   +    GDI  GL Y+Y      I +K+CRNL  A    N S+PYVK  L+P        +TK   ++LNP F+E  +Y   K E + +R   +TVWH+++ G++ FLG+V + F  ++ +  T  W +L+++   +  P    Y G++ +S+K+    K    S+ S     D  SE+S   G + ++IK+A NL         + + K  LLPE ++   +KTP+++KN NP+WN  F F ++S S L D  +E+T+ D    +  +  LGG+ LN+       R V        E  +WQ MI++P TW++  L+LR +
Sbjct:   52 GENHDFLMKGSQSIRSGQSMSSSLGLTSSMGSRDSLSSYYSNAGEVNYGKINVTGDIQFGLDYDYKTSCLEIRVKQCRNLAPADVKKNKSDPYVKSYLLPDKTKTGKRKTKVKKNSLNPTFDETLRYYIAKSE-LENRTLWLTVWHNDRFGRNDFLGEVTIPFDYYRFEGPTLKWHQLQQRQEYL--PSSLSYKGELTLSLKFVTGDKLLTGSTTSLKHSRDGRSEVSDG-GQLHVYIKEAKNLTAVRSGGYSDPFCKGYLLPEKNRSSKQKTPVVKKNCNPVWNHCFIFEDVSASLLADRCLELTLWDYD-RISSNDFLGGVRLNLGSGICSRRYVDWMDAVGDEISLWQSMISRPNTWVDGTLMLRAN 416          
BLAST of AAEL003283-PA vs. TrEMBL
Match: A0A0L8G3G5 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22001081mg PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 9.247e-44
Identity = 105/314 (33.44%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGK----SSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            GDI  GL Y+Y      I +K+CRNL  A    N S+PYVK  L+P        +TK   ++LNP F+E  +Y   K E + +R   +TVWH+++ G++ FLG+V + F  ++ +  T  W +L+++   +  P    Y G++ +S+K+    K    S+ S     D  SE+S   G + ++IK+A NL         + + K  LLPE ++   +KTP+++KN NP+WN  F F ++S S L D  +E+T+ D    +  +  LGG+ LN+       R V        E  +WQ MI++P TW++  L+LR
Sbjct:   91 GDIQFGLDYDYKTSCLEIRVKQCRNLAPADVKKNKSDPYVKSYLLPDKTKTGKRKTKVKKNSLNPTFDETLRYYIAKSE-LENRTLWLTVWHNDRFGRNDFLGEVTIPFDYYRFEGPTLKWHQLQQRQEYL--PSSLSYKGELTLSLKFVTGDKLLTGSTTSLKHSRDGRSEVSDG-GQLHVYIKEAKNLTAVRSGGYSDPFCKGYLLPEKNRSSKQKTPVVKKNCNPVWNHCFIFEDVSASLLADRCLELTLWDYD-RISSNDFLGGVRLNLGSGICSRRYVDWMDAVGDEISLWQSMISRPNTWVDGTLMLR 399          
BLAST of AAEL003283-PA vs. TrEMBL
Match: X1ZGX1 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.934e-43
Identity = 106/310 (34.19%), Postives = 153/310 (49.35%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARNGRL--------VPIKEKEVWQQMITKPETWIEAKLVLR 2125
            G+I   L YNY   +F + +K CR+L  A      S+PYVK  L+P        +TK    +L+P F+E  KY+  K E + +R   +TVW     G++ FLG+V +    +   D TP W KL E+ P + T     Y GD++V++KY          N P D   +   + G + + IK A NL     +   +S+ K  LLPE S    KKTP+I+KN NP+WN  F F N+   +L D  +E+TV D    L  +  LGG+ L++                 KE  +WQ+M+  P  WIE  L LR
Sbjct:   25 GEIQFALEYNYKLGQFEVHVKSCRDLAPADSKKKRSDPYVKTYLLPDKSKTGKRKTKVKKHSLSPCFDETLKYQLTKSE-LETRTLWLTVWSYGNFGRNDFLGEVTIPLDYYHFTDTTPRWHKLLERNPAVSTLA---YKGDLEVALKYI------SPENIPKDKSKKSKESRGELQVMIKGARNLTAVRANGFSDSFCKGYLLPEKSSRVKKKTPVIKKNVNPLWNHNFIFENLPWEDLKDRCLELTVWDHD-RLTSNDFLGGVRLSLGTGNSADKEVDWMDSTGKEISIWQRMLDSPNYWIEDTLSLR 323          
BLAST of AAEL003283-PA vs. TrEMBL
Match: A0A210PMF2 (Synaptotagmin-like protein 5 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07867 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.020e-42
Identity = 98/314 (31.21%), Postives = 169/314 (53.82%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTG----SITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
            G++  GL YNY      I I++C++L  A P  + S+PYVK  L+P        +T+   S L+P F+E  +Y  I   +V +R   VTVWH+++ G++ FLG+V + F  F+  D+ P W+ L+E+  T  T +L+ Y GD+ +S++            SP+    + +   G     + + +K+A NL     +   + + K  LLP+ +K   +KTP+I+++ NP WN  F F ++S  EL +  +E+T+ D    +  +  LGG+ LN+      G++V       +E  +WQ M+ +P++WI+  L+LR
Sbjct:  643 GEVQFGLDYNYRTGSLEIAIRQCKDLAPADPKRHRSDPYVKTYLLPDKTRGGKRKTRVKKSTLSPIFDETLRYL-ISKSEVENRILWVTVWHNDRFGRNDFLGEVSINFDYFRFGDSAPKWYTLQERVETQTTSLLT-YQGDLILSLRLVSKDNVKEILTSPTKTKRKKTRPDGLAGCQLQVLLKEARNLTAVRSNGFSDPFCKAYLLPDKNKGLKQKTPVIKRDCNPQWNYTFIFDDVSPEELKERALELTIWDHD-KISSNDFLGGVRLNLGLGRCYGKIVDWNDAKGEEISIWQAMLDRPDSWIDGTLILR 953          
BLAST of AAEL003283-PA vs. Ensembl Cavefish
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:103044935])

HSP 1 Score: 139.428 bits (350), Expect = 5.513e-34
Identity = 99/359 (27.58%), Postives = 175/359 (48.75%), Query Frame = 2
Query: 1109 HSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDR-QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNF-----------SEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
             S+ +  + SSLN M  + S          + G+ R  G+I++ +SY+Y      +++++CR L         ++PYVK  L+P    +   +T   ++  NP FN+  +Y  + +  + +R   V+VWH ++ G + FLG+  L F  ++ D     WF L+ +    +  ++ +Y G++ V +KY I  + ++S   P D             S      G + L +K+A NL T+  S   + + K  LLP+  K    KT +++++ NP WN  FT+  +  ++L  + +E+TV DK+  L  +  LGG+ L        G+ V       +E+ +WQ+MI  PE   E  L+LR
Sbjct:  319 RSVGSAQSVSSLNSMMSVYSETG-------DYGNARVSGEILLNISYSYKTGALNVLVRECRCLATGDERKQRTDPYVKTYLLPDKSRQSKRKTSIKNNTTNPVFNDNLRYV-VSHSQLETRTLQVSVWHHDRFGHNSFLGETELTFDSWEFDTQIEEWFALQPRAEGSVDSMI-QYKGELTVVLKY-IPAERNLSL--PLDQIQVKKGFLKGKKSITLPKGGMVELLVKEAKNL-TAVKSGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHTDLDSVCLELTVWDKE-PLASNVFLGGVRLGAGTGLSYGKEVDWNDSYGEEQRLWQRMIDNPEVPQECTLMLR 663          
BLAST of AAEL003283-PA vs. Ensembl Cavefish
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:103044935])

HSP 1 Score: 139.428 bits (350), Expect = 6.950e-34
Identity = 98/353 (27.76%), Postives = 172/353 (48.73%), Query Frame = 2
Query: 1127 SNASSLNDMTIINSSVVSKPENAVELGSDR-QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNF-----------SEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
            +  SSLN M  + S          + G+ R  G+I++ +SY+Y      +++++CR L         ++PYVK  L+P    +   +T   ++  NP FN+  +Y  + +  + +R   V+VWH ++ G + FLG+  L F  ++ D     WF L+ +    +  ++ +Y G++ V +KY I  + ++S   P D             S      G + L +K+A NL T+  S   + + K  LLP+  K    KT +++++ NP WN  FT+  +  ++L  + +E+TV DK+  L  +  LGG+ L        G+ V       +E+ +WQ+MI  PE   E  L+LR
Sbjct:  347 AETSSLNSMMSVYSETG-------DYGNARVSGEILLNISYSYKTGALNVLVRECRCLATGDERKQRTDPYVKTYLLPDKSRQSKRKTSIKNNTTNPVFNDNLRYV-VSHSQLETRTLQVSVWHHDRFGHNSFLGETELTFDSWEFDTQIEEWFALQPRAEGSVDSMI-QYKGELTVVLKY-IPAERNLSL--PLDQIQVKKGFLKGKKSITLPKGGMVELLVKEAKNL-TAVKSGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHTDLDSVCLELTVWDKE-PLASNVFLGGVRLGAGTGLSYGKEVDWNDSYGEEQRLWQRMIDNPEVPQECTLMLR 685          
BLAST of AAEL003283-PA vs. Ensembl Cavefish
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:103045066])

HSP 1 Score: 127.872 bits (320), Expect = 3.578e-30
Identity = 89/315 (28.25%), Postives = 158/315 (50.16%), Query Frame = 2
Query: 1211 DRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITP-VLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA----RNGRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            D  G+I+  L Y+   +   +++K+CR L  A       NPYVK  L+P    +   +T T S  +NP +NE  KY +I    +++R   ++VWH ++ G++ FLG+V L      +D A      L+ K    + P   ++Y G++ +S+KY    K+           +E   + G + + IK+A NL         +S+ K  LLP   K   KKT +++K  NP ++  F + ++S  +L  + +E+TV D++ ++  +  LGG+ L+      + G+   +     +E  VW++M+  P++W E  L LR
Sbjct:  339 DVSGEIVFSLHYDETAQSLAVMVKECRGLAYADAAKKKCNPYVKSYLLPDKSRQSKKKTATKSKTINPTYNETLKY-SISRSQLMTRTLQLSVWHYDRFGRNAFLGEVQLPLDCHDIDSAHEECVILRGKAAGSLAPSAFAQYKGELVISLKYVSEKKAPSEKQKAKKAKAE---SGGELHVLIKEAKNLSAMKAGGTSDSFVKGYLLPSKGKSTKKKTQVVKKTLNPHYDHTFIYKDLSLDQLRGVCLELTVWDRE-AMSSNDFLGGVRLSSGAAHLKEGKQEWVADSTGEEVSVWEKMMQFPDSWAEGTLPLR 648          
BLAST of AAEL003283-PA vs. Ensembl Cavefish
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:103045066])

HSP 1 Score: 125.946 bits (315), Expect = 1.565e-29
Identity = 89/315 (28.25%), Postives = 158/315 (50.16%), Query Frame = 2
Query: 1211 DRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITP-VLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA----RNGRLVPI-----KEKEVWQQMITKPETWIEAKLVLR 2125
            D  G+I+  L Y+   +   +++K+CR L  A       NPYVK  L+P    +   +T T S  +NP +NE  KY +I    +++R   ++VWH ++ G++ FLG+V L      +D A      L+ K    + P   ++Y G++ +S+KY    K+           +E   + G + + IK+A NL         +S+ K  LLP   K   KKT +++K  NP ++  F + ++S  +L  + +E+TV D++ ++  +  LGG+ L+      + G+   +     +E  VW++M+  P++W E  L LR
Sbjct:  410 DVSGEIVFSLHYDETAQSLAVMVKECRGLAYADAAKKKCNPYVKSYLLPDKSRQSKKKTATKSKTINPTYNETLKY-SISRSQLMTRTLQLSVWHYDRFGRNAFLGEVQLPLDCHDIDSAHEECVILRGKAAGSLAPSAFAQYKGELVISLKYVSEKKAPSEKQKAKKAKAE---SGGELHVLIKEAKNLSAMKAGGTSDSFVKGYLLPSKGKSTKKKTQVVKKTLNPHYDHTFIYKDLSLDQLRGVCLELTVWDRE-AMSSNDFLGGVRLSSGAAHLKEGKQEWVADSTGEEVSVWEKMMQFPDSWAEGTLPLR 719          
BLAST of AAEL003283-PA vs. Ensembl Cavefish
Match: sytl1 (synaptotagmin-like protein 1 [Source:NCBI gene;Acc:103029374])

HSP 1 Score: 119.783 bits (299), Expect = 5.468e-28
Identity = 85/310 (27.42%), Postives = 153/310 (49.35%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLV-----PIKEKEVWQQMITKPETWIEAKLVLR 2125
            G I + L Y+  +EE  + +  C++L  A   +N S+PYVKV L+P   S    +T      LNP ++E  KYK ++  ++ +R   V+VWH E++ +++FLG+V +    +    + P W+ L+ +       ++S+  G I  S+K+   G       S    F      TG + +W+++   LL      +PN++ K ++LP+ S V  ++T ++R + +P++N    +  +  S+L     EITV +          LGG+ L+       G+ V       +E  VW  +I  P +W++A L +R
Sbjct:  242 GRIQLSLHYDPKKEELHVRVCCCQDL--APARNNRSDPYVKVYLLPDNTSRSKKKTAVKRKTLNPVYDETLKYK-VRKSELQARVLSVSVWHMERVRRNLFLGEVEVGLDQWDWGRSQPTWYSLQPRVQMNPDAIISR--GTILFSMKFIPPG-------SEGGGF----PLTGELHIWLREVIGLLPPKRG-IPNTHVKSVVLPDESGVSGQQTRVVRGSVSPVFNHTMVYDGLQSSDLLQACAEITVWNSS------NCLGGVRLSTGSGVSYGQKVCWMDSTEEEISVWNTIIGNPNSWVDAALPVR 528          
BLAST of AAEL003283-PA vs. Ensembl Sea Lamprey
Match: sytl2a (synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-130723-2])

HSP 1 Score: 117.857 bits (294), Expect = 9.777e-30
Identity = 82/272 (30.15%), Postives = 144/272 (52.94%), Query Frame = 2
Query: 1334 YVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKL----SLLRDGLLGGISLNIARNGRLVPIKEKE--VWQQMITKPETWIEAKLVLRKD 2131
            YVK  L+P    +   +T    +NLNP +NE  KYK I   ++ SR   ++VWH++K GK+ FLG+V ++ S +   +   NWF L+ +    +  + S+ Y  + +++K+     +S++  +P   F+  S   G I +W+K+A NLL     H  +++ KC +LP+ S+   +KT  ++K+ NP++N    +      ++ +  +E+TV D+++     L    L  G  ++  +    +  +E E  VW  MIT+P  W EA L LR D
Sbjct:    1 YVKTYLLPDKSRQSKKKTTVRKNNLNPVYNEILKYK-IPARELQSRVLNLSVWHNDKFGKNSFLGEVEMELSTWDWGNTAYNWFDLQPRTSPALKDLTSRGY--LNLALKFI--PANSVAPPTPEGQFTPAS---GEIHIWVKEAKNLLPLK-PHGVDAFVKCYILPDLSRKSRQKTRTVKKSMNPVFNHTMVYDGFQDEDMREACVELTVWDQEMFSNQFLGGLRLGLGGGMSYGKPVDWMDSREGEVAVWHNMITRPGEWTEALLPLRPD 263          
BLAST of AAEL003283-PA vs. Ensembl Sea Lamprey
Match: sytl2a (synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-130723-2])

HSP 1 Score: 114.775 bits (286), Expect = 1.076e-28
Identity = 79/272 (29.04%), Postives = 141/272 (51.84%), Query Frame = 2
Query: 1334 YVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKL----SLLRDGLLGGISLNIARNGRLVPIKEKE--VWQQMITKPETWIEAKLVLRKD 2131
            YVK  L+P    +   +T    +NLNP +NE  KYK I   ++ SR   ++VWH++K GK+ FLG+V ++ S +   +   NWF L+ +       + S+ Y  + +++K+            P+++  +  + +G I +W+K+A NLL     H  +++ KC +LP+ S+   +KT  ++K+ NP++N    +      ++ +  +E+TV D+++     L    L  G  ++  +    +  +E E  VW  MIT+P  W EA L LR D
Sbjct:    1 YVKTYLLPDKSRQSKKKTTVRKNNLNPVYNEILKYK-IPARELQSRVLNLSVWHNDKFGKNSFLGEVEMELSTWDWGNTAYNWFDLQPRVHISQEDLTSRGY--LNLALKFI-----------PANSVGKTKNASGEIHIWVKEAKNLLPLK-PHGVDAFVKCYILPDLSRKSRQKTRTVKKSMNPVFNHTMVYDGFQDEDMREACVELTVWDQEMFSNQFLGGLRLGLGGGMSYGKPVDWMDSREGEVAVWHNMITRPGEWTEALLPLRPD 257          
BLAST of AAEL003283-PA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006493.1 (pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1 gene:ENSPMAG00000005868.1 transcript:ENSPMAT00000006493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 6.058e-16
Identity = 45/166 (27.11%), Postives = 78/166 (46.99%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEK-GPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDN 1714
            GDI   +SY+Y      + +++CRNL      +   +PYVKV L+P    +   +TK   + +NP FNE  KY  I +  +  R   ++VWH +    + FLGQ  L      L+     W  L+ +        + +KY G++ +++KY    +     + P ++
Sbjct:    3 GDINFSVSYDYRVGVLSLTLRQCRNLAYGEERTKRCDPYVKVYLLPDKSRQGKRKTKIKKNTINPVFNETLKYA-ISHTQLEVRCVHLSVWHHDSFRHNSFLGQASLPLDCCDLERGDDRWCALQPRVTRNPFAAINNKYKGELILALKYIAPTEQPQPESPPGES 167          
BLAST of AAEL003283-PA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004426.1 (pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941:1 gene:ENSPMAG00000004026.1 transcript:ENSPMAT00000004426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 3.053e-10
Identity = 42/151 (27.81%), Postives = 73/151 (48.34%), Query Frame = 2
Query: 1175 VSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPP---------IFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEK 1600
            V+KP + +       G+I + +S++       I + + R L     N+  S+P+VKV L+P            SE   RTK I   LNP++N+   YKNI  +++  +    +VW  ++   + FLG+V ++ S     D    W+ L+E+
Sbjct:  152 VTKPSHPIT------GEIQLQMSFDRHSGNLIIHVLQARGL-APRDNNGFSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVWDYDRFSSNDFLGEVRIELSDVSHLDGAQRWYPLREQ 295          
BLAST of AAEL003283-PA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004430.1 (pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941:1 gene:ENSPMAG00000004026.1 transcript:ENSPMAT00000004430.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 3.096e-10
Identity = 42/151 (27.81%), Postives = 73/151 (48.34%), Query Frame = 2
Query: 1175 VSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPP---------IFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEK 1600
            V+KP + +       G+I + +S++       I + + R L     N+  S+P+VKV L+P            SE   RTK I   LNP++N+   YKNI  +++  +    +VW  ++   + FLG+V ++ S     D    W+ L+E+
Sbjct:  149 VTKPSHPIT------GEIQLQMSFDRHSGNLIIHVLQARGL-APRDNNGFSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVWDYDRFSSNDFLGEVRIELSDVSHLDGAQRWYPLREQ 292          
BLAST of AAEL003283-PA vs. Ensembl Nematostella
Match: EDO29765 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2P9])

HSP 1 Score: 92.8189 bits (229), Expect = 1.445e-20
Identity = 77/309 (24.92%), Postives = 136/309 (44.01%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSL--FQLDDATPNWFKLKEKGPTIITPVLS--KYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNI---ARNGRLVPIKEKEVWQQMITKPETWIEAKLVLR 2125
            G++ +GL Y+Y  E+  + + + R++         S+PY    L+P    +   +T TI  NLNP +N    Y ++  E+++ R+  +TVW  ++   + FLG V L      +        WF     G   + P +   K  G++ V+ +         S            ++ G + + I +A NL       + + + K  LLP+       KT II++  NP W+    +  +SQ EL    +EI++ D  ++  RD  LGG+ L +   A         E ++W  M+T+   WI+  + LR
Sbjct:   21 GEVQVGLRYDYKHEKLEVQVHRARDIAPVDTKKKRSDPY----LLPDKGRKSKRKTPTIRKNLNPQWNFPFTYDDVTLEELMDRSLELTVWDWDRGASNDFLGGVRLGMETRNYSSRHRVRYWFV----GMCTMAPGVGRGKNKGEVYVTAEKVKRKSKRQSI-----------ASKGELHVHIMEAKNLPGKDADGMSDPFCKITLLPDKKGKTRHKTAIIKRTLNPSWDYNLIYEELSQEELRQRVLEISIWDHDIA-SRDEFLGGLRLGLGTSANEWDDSSKDEAQIWHTMLTRTNVWIQVVVPLR 309          
BLAST of AAEL003283-PA vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 88.1965 bits (217), Expect = 3.373e-19
Identity = 69/291 (23.71%), Postives = 130/291 (44.67%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARNGRLVPIKEKEVWQQMITKP 2092
            G +   L Y  ++    +++   + L+  + +  +S+PYVK+ L+P        R+ T    LNP FNE   Y  I  E++ S+   + V+ ++ +G++ F+G+  +   L  L+      FK       + +P      G IQ+++KY                    ++  G + + + + + L +   +   + Y KC L P+  K   ++T I +K  NP +N +F + +I+  EL    +E+TV D  +    D  +GG+ LNI   G  +     + W  M+  P
Sbjct:   20 GLLEFTLRYQKLDSRLDVVLHDAKGLK-PMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINLKL--LNSNPTQTFKRSLIPKALDSP--HSPLGRIQLALKY--------------------NTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVY-DIAHHELAKKSLEVTVWDYDVGKSND-FIGGVILNINAEGSAL-----KHWYDMLKGP 278          
BLAST of AAEL003283-PA vs. Ensembl Nematostella
Match: EDO41231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Y1])

HSP 1 Score: 71.2478 bits (173), Expect = 7.153e-13
Identity = 76/298 (25.50%), Postives = 131/298 (43.96%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKH-FRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQL-DDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARNGRLVPIKEKEVWQQMITKPETWIE 2107
            G I + L Y     +  + I +CR+L       N+S+PYV++  +P   S +H  RT  +++NLNP FNE      +   +V      + V H+E + ++V +G+V +  S  +L  D    W  L+   P     +L    G++ +S+ +                       +  +++ + QA NL   S+ ++ + Y K  L    S+V  KKT + +K  NP +   FTF   + S L  + M  TV  +  S   +  +G + L+ + +G      E   W Q+I  P   IE
Sbjct:  304 GRIHVSLQYKKTTCDLFVKILQCRDLPAKDLRRNTSSPYVRIYALP---SRRHNHRTNIVTNNLNPTFNELFIISGLTLMEVQQLALQILVIHNEVISRNVVIGEVMVALSGLELTGDEISIWRDLR---PYHFQNIL----GELHISVCH--------------------QPLSSRLSVTVLQARNLPKISHLNIGDPYVKVELFSSRSRVGKKKTRVKKKTVNPKFAQTFTFDLAADSVLDMMTMTFTVMVQDASGCHE-RIGQVVLSASSDG-----PEFGHWSQVIANPHCPIE 565          
BLAST of AAEL003283-PA vs. Ensembl Nematostella
Match: EDO49802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY4])

HSP 1 Score: 67.0106 bits (162), Expect = 7.870e-12
Identity = 66/271 (24.35%), Postives = 123/271 (45.39%), Query Frame = 2
Query: 1208 SDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPN--SNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDAT-PNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTS-SYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLG 2008
             D +GDI + L YN+ E+   + + + R+L   +P   +  S+PYV +ELVP    E   +T+     LNP FNE  ++K + + ++       T+W  +  G+  F G+  +  S    ++ T  +WF L+ +    IT       G++ V+++Y                   +   T ++T  I +A NL +S S ++  ++Y +C ++P +               NP +   F F  + + EL    ++  V  K+ +L++D  LG
Sbjct:   27 GDIKGDIEMSLKYNHREQLLLVKVIRARDL---VPRDLNGKSDPYVVLELVPDRLEEGTKKTRFKQKTLNPVFNEIFQFK-VPHNNLTDTKLCATIWDHDFFGEDDFNGEAVVDLSRVNFNNGTHTDWFMLQLQTDFSIT-------GELDVTVEY-------------------LEPDTLAVT--IHKATNLKSSNSMANTSDAYVRCSVIPGT--------------LNPEFAEIFEF-EVPREELDHRAIQFHVFGKE-TLVQDVSLG 249          
BLAST of AAEL003283-PA vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 66.6254 bits (161), Expect = 1.119e-11
Identity = 65/251 (25.90%), Postives = 112/251 (44.62%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCD 1972
            G I   L Y++ +    + I +  ++  A   S SS+PYVK+ L+P    +K + TK     LNP FNEQ  +KNI Y ++ +R  L+ ++  ++  +H  +G+  L      L      W  L     +          GDI  S++Y            PS         +G + + I +A +L +   +   + Y K  L+ E  K+  KKT + ++  NP +N  FTF  ++  ++    + I+V D
Sbjct:   85 GRINFTLDYSFTDNTLTVGIIRAEDIP-AKDFSGSSDPYVKIMLLPD--KKKKYETKVHRKTLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEARLPLIDVDLASNINEWRVLTPPSGSGGAGHSKSDLGDICFSLRYV-----------PS---------SGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTF-TVAFEKIEQTSLIISVLD 311          
BLAST of AAEL003283-PA vs. Ensembl Medaka
Match: ENSORLT00000041991.1 (synaptotagmin-like protein 2 [Source:NCBI gene;Acc:101169380])

HSP 1 Score: 145.591 bits (366), Expect = 2.070e-35
Identity = 100/349 (28.65%), Postives = 177/349 (50.72%), Query Frame = 2
Query: 1109 HSMTNKSNASSLNDMTIINSSVVSK-PENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLV------PIKEKEVWQQMITKPETWIEAKLVLR 2125
            H +TN  ++ S   MT ++ SV++    + VE+    QG+I   ++Y     EF I + +CR+L    P    S+PYVK  LVP   +    +T      LNP FNE  +Y+ ++ + + ++  +++VWH +  G++ FLG+V +  S +  D    N+  LK K    + P   +  G+++++I++       +   S S+  ++  S +G I +W+K    L     +  P  Y KC +LP++S+   +KT ++R+  +P++N    +  IS ++L +  +E+TV D+    L   LLGG+ L +      G LV      P  E  +W +M+  P  W+E  L LR
Sbjct:  895 HPVTNLRSSPS---MTSLSGSVMTMYSGDLVEV----QGNIHFSINYVQRLREFHIFVSECRDLAAVDPKRGRSDPYVKSYLVPDKANLGKRKTSVKKKTLNPTFNEILRYR-VRMDYLQTQMLVLSVWHHDTFGRNSFLGEVDVDLSKWDFDHTQMNYLALKAKTMPTVEPTNGR--GEMRLAIRF-------LPQISHSEGVAKDISNSGEIHIWVKDCKGLPLIRATIDP--YVKCFVLPDTSRKGRQKTRVLRRTVDPVFNHTMVYDGISMADLTEACVELTVWDR--DRLASNLLGGVRLGVGTGRSYGTLVDWMDSGPY-EVALWDRMMASPNEWVEGVLPLR 1221          
BLAST of AAEL003283-PA vs. Ensembl Medaka
Match: ENSORLT00000043719.1 (synaptotagmin-like protein 2 [Source:NCBI gene;Acc:101169380])

HSP 1 Score: 145.591 bits (366), Expect = 2.070e-35
Identity = 100/349 (28.65%), Postives = 177/349 (50.72%), Query Frame = 2
Query: 1109 HSMTNKSNASSLNDMTIINSSVVSK-PENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLV------PIKEKEVWQQMITKPETWIEAKLVLR 2125
            H +TN  ++ S   MT ++ SV++    + VE+    QG+I   ++Y     EF I + +CR+L    P    S+PYVK  LVP   +    +T      LNP FNE  +Y+ ++ + + ++  +++VWH +  G++ FLG+V +  S +  D    N+  LK K    + P   +  G+++++I++       +   S S+  ++  S +G I +W+K    L     +  P  Y KC +LP++S+   +KT ++R+  +P++N    +  IS ++L +  +E+TV D+    L   LLGG+ L +      G LV      P  E  +W +M+  P  W+E  L LR
Sbjct:  895 HPVTNLRSSPS---MTSLSGSVMTMYSGDLVEV----QGNIHFSINYVQRLREFHIFVSECRDLAAVDPKRGRSDPYVKSYLVPDKANLGKRKTSVKKKTLNPTFNEILRYR-VRMDYLQTQMLVLSVWHHDTFGRNSFLGEVDVDLSKWDFDHTQMNYLALKAKTMPTVEPTNGR--GEMRLAIRF-------LPQISHSEGVAKDISNSGEIHIWVKDCKGLPLIRATIDP--YVKCFVLPDTSRKGRQKTRVLRRTVDPVFNHTMVYDGISMADLTEACVELTVWDR--DRLASNLLGGVRLGVGTGRSYGTLVDWMDSGPY-EVALWDRMMASPNEWVEGVLPLR 1221          
BLAST of AAEL003283-PA vs. Ensembl Medaka
Match: ENSORLT00000029248.1 (synaptotagmin-like protein 2 [Source:NCBI gene;Acc:101169380])

HSP 1 Score: 143.665 bits (361), Expect = 7.594e-35
Identity = 90/312 (28.85%), Postives = 158/312 (50.64%), Query Frame = 2
Query: 1217 QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLV------PIKEKEVWQQMITKPETWIEAKLVLR 2125
            QG+I   ++Y     EF I + +CR+L    P    S+PYVK  LVP   +    +T      LNP FNE  +Y+ ++ + + ++  +++VWH +  G++ FLG+V +  S +  D    N+  LK K    + P   +  G+++++I++       +   S S+  ++  S +G I +W+K    L     +  P  Y KC +LP++S+   +KT ++R+  +P++N    +  IS ++L +  +E+TV D+    L   LLGG+ L +      G LV      P  E  +W +M+  P  W+E  L LR
Sbjct:  896 QGNIHFSINYVQRLREFHIFVSECRDLAAVDPKRGRSDPYVKSYLVPDKANLGKRKTSVKKKTLNPTFNEILRYR-VRMDYLQTQMLVLSVWHHDTFGRNSFLGEVDVDLSKWDFDHTQMNYLALKAKTMPTVEPTNGR--GEMRLAIRF-------LPQISHSEGVAKDISNSGEIHIWVKDCKGLPLIRATIDP--YVKCFVLPDTSRKGRQKTRVLRRTVDPVFNHTMVYDGISMADLTEACVELTVWDR--DRLASNLLGGVRLGVGTGRSYGTLVDWMDSGPY-EVALWDRMMASPNEWVEGVLPLR 1192          
BLAST of AAEL003283-PA vs. Ensembl Medaka
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:101155809])

HSP 1 Score: 139.428 bits (350), Expect = 9.507e-34
Identity = 104/357 (29.13%), Postives = 169/357 (47.34%), Query Frame = 2
Query: 1127 SNASSLNDMTIINSSVVSKPENAVELGSDR-QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEK--GPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFS---------EMSSTT----GSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
            +  SS+N MT + S          + G+ R  G+I++ +SY+Y      +++K+C NL         ++ YVK  L+P    +   +T   ++ +NP FNE  +Y  I +  +  R   V+VWH ++ G + FLG+V L F  ++ D     W+ L+ +  G T  T     Y G++ V +KY     + ++T  P D            + SS T    G + L +K A NL         + + K  LLP+S+K    KT + R+  NP WN  FT+  +   +L ++ +E+TV DK+ +L  +  LGG+ L        G  V       +E+ VWQ+MI  P    E  L+LR
Sbjct:  392 AETSSINSMTSMYSETG-------DYGNARVSGEILMNISYSYKTGALNVLVKECHNLATGDERKQRTDAYVKTYLLPDKSRQSKRKTSIKANTINPVFNESLRYV-ISHSQLELRTLQVSVWHHDRFGYNSFLGEVELSFDSWEFDSQIEEWYALQPRVDGSTDST---MHYKGELTVVLKYI---PAEINTTPPPDQVQVKKGFLKGKKTSSFTLPKGGMVELLVKGAKNLTAVKAGGYSDPFVKGYLLPDSNKSTKHKTAVERRTVNPHWNHTFTYCGLQPGDLNNICLELTVWDKE-ALASNVFLGGVRLGAGTGNSYGNEVDWMDSYGEEQRVWQRMIETPGVPHECTLLLR 733          
BLAST of AAEL003283-PA vs. Ensembl Medaka
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:101155809])

HSP 1 Score: 138.658 bits (348), Expect = 1.151e-33
Identity = 104/361 (28.81%), Postives = 172/361 (47.65%), Query Frame = 2
Query: 1115 MTNKSNASSLNDMTIINSSVVSKPENAVELGSDR-QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEK--GPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFS---------EMSSTT----GSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARN---GRLVP-----IKEKEVWQQMITKPETWIEAKLVLR 2125
            +++  + SS+N MT + S          + G+ R  G+I++ +SY+Y      +++K+C NL         ++ YVK  L+P    +   +T   ++ +NP FNE  +Y  I +  +  R   V+VWH ++ G + FLG+V L F  ++ D     W+ L+ +  G T  T     Y G++ V +KY     + ++T  P D            + SS T    G + L +K A NL         + + K  LLP+S+K    KT + R+  NP WN  FT+  +   +L ++ +E+TV DK+ +L  +  LGG+ L        G  V       +E+ VWQ+MI  P    E  L+LR
Sbjct:  325 LSSAVSTSSINSMTSMYSETG-------DYGNARVSGEILMNISYSYKTGALNVLVKECHNLATGDERKQRTDAYVKTYLLPDKSRQSKRKTSIKANTINPVFNESLRYV-ISHSQLELRTLQVSVWHHDRFGYNSFLGEVELSFDSWEFDSQIEEWYALQPRVDGSTDST---MHYKGELTVVLKYI---PAEINTTPPPDQVQVKKGFLKGKKTSSFTLPKGGMVELLVKGAKNLTAVKAGGYSDPFVKGYLLPDSNKSTKHKTAVERRTVNPHWNHTFTYCGLQPGDLNNICLELTVWDKE-ALASNVFLGGVRLGAGTGNSYGNEVDWMDSYGEEQRVWQRMIETPGVPHECTLLLR 670          
BLAST of AAEL003283-PA vs. Planmine SMEST
Match: SMESG000004656.1 (SMESG000004656.1)

HSP 1 Score: 1320.06 bits (3415), Expect = 0.000e+0
Identity = 675/677 (99.70%), Postives = 676/677 (99.85%), Query Frame = 2
Query:  101 MSVVSGQWSGKSQRTSKSNGAKIIAPNGSIISRYPHETASVLSTNSKPASNLKKSTIQGSIISHTKSETLPPRSGKANSVLSGVSSQVARRKKQKESMDNLSQTMKERAMSATSLNRRKSIESAKISSQLKRYSQSDMSIAVKSEIQLMTKEERSKLLQIMEKYKKIQEIEKNRKTVIDMKIKEIQSLRPPYSQFQSNICYICQRTFWPIIYVKHSCSRCKIFVCKNCFKEYKKDTVCNSCFEEMIYXXXXXXXXXXXXYXXXXXXXXXXXXXTLKKIIRQTEKYESEVPPDDFTLMDQVDAVSKVSSHGGNSLFKKLMSKKSENSTISKKSRSDVHSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARNGRLVPIKEKEVWQQMITKPETWIEAKLVLRKD 2131
            MSVVSGQWSGKSQRTSKSNGAKIIAPNGSIISR PHETASVLSTNSKPASNLKKSTIQGSIISHTKSETLPPRSGKANSVLSGVSSQVARRKKQKESMDNLSQTMKERAMSATSLNRRKSIESAKISSQLKRYSQSDMSIAVKSEIQLMTKEERSKLLQIMEKYKKIQEIEKNRKTVIDMKIKEIQSLRPPYSQFQSNICYICQRTFWPIIYVKHSCSRCKIFVCKNCFKEYKKDTVCNSCFEEMIYLSKSDLLLKKRKYNDDSDSDDNIDVDTLKKIIRQTEKYESEVPPDDFTLMDQVDAVSKVSSHGGNSLFKKLMSKKSENSTISKKSRSDVHSMTNKSNASSLND+TIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARNGRLVPIKEKEVWQQMITKPETWIEAKLVLRKD
Sbjct:    1 MSVVSGQWSGKSQRTSKSNGAKIIAPNGSIISRNPHETASVLSTNSKPASNLKKSTIQGSIISHTKSETLPPRSGKANSVLSGVSSQVARRKKQKESMDNLSQTMKERAMSATSLNRRKSIESAKISSQLKRYSQSDMSIAVKSEIQLMTKEERSKLLQIMEKYKKIQEIEKNRKTVIDMKIKEIQSLRPPYSQFQSNICYICQRTFWPIIYVKHSCSRCKIFVCKNCFKEYKKDTVCNSCFEEMIYLSKSDLLLKKRKYNDDSDSDDNIDVDTLKKIIRQTEKYESEVPPDDFTLMDQVDAVSKVSSHGGNSLFKKLMSKKSENSTISKKSRSDVHSMTNKSNASSLNDLTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARNGRLVPIKEKEVWQQMITKPETWIEAKLVLRKD 677          
BLAST of AAEL003283-PA vs. Planmine SMEST
Match: SMESG000010162.1 (SMESG000010162.1)

HSP 1 Score: 119.398 bits (298), Expect = 1.106e-27
Identity = 89/300 (29.67%), Postives = 155/300 (51.67%), Query Frame = 2
Query: 1217 QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVP---PIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNW--FKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLN-IARNGRLVPIKEKEV--WQQMITKP 2092
            QG+I++ + +       +I+I KCRNL IA    N++NPY+K+ L+P   P    K    K I+S   P FNE+  YK I    ++ R   V+VWH E L  ++FLG+  +     +L++A   W   K KE  P I++  L +Y G+I + +++  N K        S+  SE    TG + ++I+   ++      ++PNS+ +C +     +V  K+T ++    NPIW+  FTF +I +  L +  +E+ + +KK  L++  +LG + L+       +   +EK+V  W + +  P
Sbjct:  324 QGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITS---PIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILS--LYQYKGEILIGLQFIQNTKR-----RNSETISEYE--TGKLNIFIQSGKHI--GDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVFTFNDIDKLSLGETEIELCILNKK--LIKTQILGKLLLSTTCSETNVATCREKDVLLWTKFLITP 606          
BLAST of AAEL003283-PA vs. Planmine SMEST
Match: SMESG000074360.1 (SMESG000074360.1)

HSP 1 Score: 115.546 bits (288), Expect = 1.541e-26
Identity = 89/325 (27.38%), Postives = 153/325 (47.08%), Query Frame = 2
Query: 1064 KSENSTISKKSRSDVHSMTNKSNASSLNDMTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSK---YYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIA 2029
            KSE   +  +S++  H + + +N  +L  M+  ++S+ S+  ++ + G    GD++  + YN   +   I + +C+NL +A  N   +NPY+K  L+P        ++ +  SN+NP F E   Y N+  E + +R   V VWH   +  + FLG+V +  +   L    P W+ L+EK   +  P  S    Y G++ + +KY            PS          GS+ + I +A  L     S   N Y K  LLP+ S    KKTP+ +   N  W+    F +++  EL D  +E+++   +  L  +  LGG+ LN+ 
Sbjct:  251 KSETLELQPRSQTSAHYL-HPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCQNLAVADRNKRQTNPYIKTYLLPDKTKTSKKKSTSKRSNINPIFKETLIY-NVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEK---VRYPNRSGGHIYKGELIIKLKY-----------KPSTR----RDGKGSLHVLIVEAQQLEFDGQS--LNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYR-RLKSNEFLGGVRLNLG 552          
BLAST of AAEL003283-PA vs. Planmine SMEST
Match: SMESG000013300.1 (SMESG000013300.1)

HSP 1 Score: 103.99 bits (258), Expect = 8.298e-24
Identity = 80/284 (28.17%), Postives = 145/284 (51.06%), Query Frame = 2
Query: 1334 YVKVELVPPIFSEKHFRTKTISSN---LNPDFNEQCKYK-NIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPN---WFKLKEKGPTIITPVLSKYY-GDIQVSIKYTINGKSSMSTNSPS-DNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKV-PSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARNGRLVPI--------KEKEVWQQMITKPETWIEAKLVLRKD 2131
            ++++E+ P +    H + K ++S+   ++ +     K+K +    ++  R  LV ++   +  K +F+GQ F+  +++Q   +T N   W+  + K P+I   + S  Y GD+ +++KY     +S + N  S DN       T  + LWIK+A NL +   + L N++ K  LLP   K+ P +KT  I+   NP WN+   F +I+   L  +G++I + + ++SL R   +GG+ LN+        I         E  +W+QM+ +P TWI  ++ LR D
Sbjct:   88 FLRIEVYPDV----HKKIKVVTSDEMLISSNIQLNKKFKLHTDITEIDERKILVELFVTSRFKKILFIGQTFI--NIWQ--QSTFNDLEWYDFQNKPPSIYYFISSLVYRGDLHIALKYA----TSTTINVTSIDNLDP----TNQVMLWIKKAENLFSGQVNKLCNAFVKVQLLPTDKKLHPIQKTKCIKNTCNPSWNVILKFEDINLQSLRQMGLQILIYN-RISLFRKLFIGGVRLNLGPTTTKRAIINWMDASSIETIIWRQMLNRPNTWICGEIRLRPD 354          
BLAST of AAEL003283-PA vs. Planmine SMEST
Match: SMESG000014370.1 (SMESG000014370.1)

HSP 1 Score: 72.4034 bits (176), Expect = 8.006e-13
Identity = 86/394 (21.83%), Postives = 162/394 (41.12%), Query Frame = 2
Query: 1220 GDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSN----PYVKVELVPPIFSEKHFRTKTISSN-LNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKL-GKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSK-------------------YYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNL----------------------------------------LTSSYSHLPNS--YAKCLLLPESSKVPSKKTPIIRKNFNP---IWNIQFTFPNISQSELPDLGMEITV-CDKKLS----LLRDGLLGGISLNIARNGR---------------LVPIKEKEVWQQMITKPETWIEAKLVLRKD 2131
            G+++I L +N+   +F II+++C+NL    P  ++ N    PY+ V L+P   S+K  RT ++  N   P F++  KY +I + ++ SR+ LV + H + L  + + LGQV +  S          W+  +     +I P LS+                   Y+G+I ++IK+   G S  +  + +D+F       G + +W+K   N+                                        L S+ +    +   A+  LLP  + + S  +P   ++ N    +W+    F N+   EL    +E+T+  + K      ++    +GG+ L   R GR                  + E+++W  M+ +  TW++  + L+ D
Sbjct:  286 GEVLIELDFNFRMSQFIIILRQCKNL----PQIDTINSIICPYLFVLLLPD-RSKKSRRTTSVKKNCFCPIFDQIFKY-SINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQ----LLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSF-------GELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAIAQFGQNQPVARVCLLPYRTSMQS-TSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPRCVGGVRL--CRGGRDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMD 659          
The following BLAST results are available for this feature:
BLAST of AAEL003283-PA vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYTL51.490e-3428.14synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL51.186e-3330.00synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL41.013e-3227.74synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL41.013e-3227.74synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL41.013e-3227.74synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of AAEL003283-PA vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbf-17.357e-1726.69Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
rbf-17.394e-1726.69Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
rbf-17.944e-1726.69Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
rbf-17.944e-1726.69Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
rbf-11.009e-1626.69Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
back to top
BLAST of AAEL003283-PA vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btsz1.734e-3729.23gene:FBgn0266756 transcript:FBtr0334289[more]
btsz4.608e-3729.23gene:FBgn0266756 transcript:FBtr0334288[more]
btsz1.748e-3529.23gene:FBgn0266756 transcript:FBtr0334287[more]
btsz6.809e-3529.23gene:FBgn0266756 transcript:FBtr0334291[more]
btsz7.013e-3529.23gene:FBgn0266756 transcript:FBtr0334290[more]
back to top
BLAST of AAEL003283-PA vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl57.357e-3427.95synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
sytl58.783e-3428.25synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
si:ch211-266g18.61.372e-3228.07si:ch211-266g18.6 [Source:ZFIN;Acc:ZDB-GENE-131121... [more]
sytl2b1.090e-3128.53synaptotagmin-like 2b [Source:ZFIN;Acc:ZDB-GENE-12... [more]
sytl2b7.135e-3028.57synaptotagmin-like 2b [Source:ZFIN;Acc:ZDB-GENE-12... [more]
back to top
BLAST of AAEL003283-PA vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYTL55.527e-4130.87synaptotagmin like 5 [Source:NCBI gene;Acc:1004960... [more]
SYTL59.437e-4030.43synaptotagmin like 5 [Source:NCBI gene;Acc:1004960... [more]
SYTL51.391e-3929.97synaptotagmin like 5 [Source:NCBI gene;Acc:1004960... [more]
SYTL52.808e-3930.09synaptotagmin like 5 [Source:NCBI gene;Acc:1004960... [more]
SYTL56.221e-3930.09synaptotagmin like 5 [Source:NCBI gene;Acc:1004960... [more]
back to top
BLAST of AAEL003283-PA vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sytl55.759e-3627.87synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:26... [more]
Sytl51.710e-3528.28synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:26... [more]
Sytl44.029e-3328.06synaptotagmin-like 4 [Source:MGI Symbol;Acc:MGI:13... [more]
Sytl31.207e-2827.49synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:19... [more]
Sytl11.239e-2826.69synaptotagmin-like 1 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of AAEL003283-PA vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80T23|SYTL5_MOUSE1.196e-3428.28Synaptotagmin-like protein 5 OS=Mus musculus OX=10... [more]
sp|Q812E4|SYTL5_RAT1.320e-3427.53Synaptotagmin-like protein 5 OS=Rattus norvegicus ... [more]
sp|Q8TDW5|SYTL5_HUMAN7.154e-3428.14Synaptotagmin-like protein 5 OS=Homo sapiens OX=96... [more]
sp|Q8VHQ7|SYTL4_RAT1.535e-3228.06Synaptotagmin-like protein 4 OS=Rattus norvegicus ... [more]
sp|Q9R0Q1|SYTL4_MOUSE2.819e-3228.06Synaptotagmin-like protein 4 OS=Mus musculus OX=10... [more]
back to top
BLAST of AAEL003283-PA vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1AFW72.254e-4634.06Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0L8G3J57.141e-4431.35Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8G3G59.247e-4433.44Uncharacterized protein (Fragment) OS=Octopus bima... [more]
X1ZGX12.934e-4334.19Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210PMF22.020e-4231.21Synaptotagmin-like protein 5 OS=Mizuhopecten yesso... [more]
back to top
BLAST of AAEL003283-PA vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl55.513e-3427.58synaptotagmin like 5 [Source:NCBI gene;Acc:1030449... [more]
sytl56.950e-3427.76synaptotagmin like 5 [Source:NCBI gene;Acc:1030449... [more]
sytl43.578e-3028.25synaptotagmin like 4 [Source:NCBI gene;Acc:1030450... [more]
sytl41.565e-2928.25synaptotagmin like 4 [Source:NCBI gene;Acc:1030450... [more]
sytl15.468e-2827.42synaptotagmin-like protein 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of AAEL003283-PA vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl2a9.777e-3030.15synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
sytl2a1.076e-2829.04synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
ENSPMAT00000006493.16.058e-1627.11pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1... [more]
ENSPMAT00000004426.13.053e-1027.81pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941... [more]
ENSPMAT00000004430.13.096e-1027.81pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941... [more]
back to top
BLAST of AAEL003283-PA vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAEL003283-PA vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO297651.445e-2024.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419333.373e-1923.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412317.153e-1325.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498027.870e-1224.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317461.119e-1125.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AAEL003283-PA vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041991.12.070e-3528.65synaptotagmin-like protein 2 [Source:NCBI gene;Acc... [more]
ENSORLT00000043719.12.070e-3528.65synaptotagmin-like protein 2 [Source:NCBI gene;Acc... [more]
ENSORLT00000029248.17.594e-3528.85synaptotagmin-like protein 2 [Source:NCBI gene;Acc... [more]
sytl59.507e-3429.13synaptotagmin like 5 [Source:NCBI gene;Acc:1011558... [more]
sytl51.151e-3328.81synaptotagmin like 5 [Source:NCBI gene;Acc:1011558... [more]
back to top
BLAST of AAEL003283-PA vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004656.10.000e+099.70SMESG000004656.1[more]
SMESG000010162.11.106e-2729.67SMESG000010162.1[more]
SMESG000074360.11.541e-2627.38SMESG000074360.1[more]
SMESG000013300.18.298e-2428.17SMESG000013300.1[more]
SMESG000014370.18.006e-1321.83SMESG000014370.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004208 ID=SMED30004208|Name=AAEL003283-PA|organism=Schmidtea mediterranea sexual|type=transcript|length=2268bp
GCTAAAAGGACGCTGTTGATAGGCTGGTTTAAATCATCATTGCTCAGTAC
ATTGATTATACCAATTTAGATTTTAATTTTTTCTATTACGTCACAATATC
ATGTCCGTTGTAAGTGGACAGTGGTCAGGTAAATCTCAGAGAACCTCAAA
AAGTAATGGAGCTAAAATTATTGCTCCAAACGGAAGCATTATTAGCCGGT
ATCCACATGAAACTGCAAGCGTCTTGTCAACCAACAGTAAACCCGCTTCA
AATTTAAAAAAGTCTACAATTCAAGGATCTATAATTTCTCATACAAAATC
GGAAACCTTACCGCCTCGCTCTGGTAAAGCTAACAGTGTTTTGTCAGGCG
TAAGCAGTCAAGTCGCTCGAAGAAAAAAACAAAAAGAAAGTATGGATAAT
TTATCTCAGACAATGAAAGAAAGAGCAATGAGTGCAACGTCTCTGAATCG
TCGAAAGTCTATCGAATCAGCAAAGATTTCTTCACAGTTAAAGCGATACA
GTCAATCGGATATGTCGATTGCTGTAAAATCCGAGATTCAGTTAATGACC
AAAGAAGAGCGAAGCAAATTGTTACAAATTATGGAAAAATATAAAAAAAT
TCAGGAAATTGAAAAAAATCGGAAAACAGTCATTGATATGAAAATAAAAG
AAATTCAATCATTGAGACCACCATATTCACAATTTCAGTCAAATATTTGT
TACATTTGTCAAAGAACCTTTTGGCCAATTATATATGTGAAGCATTCTTG
TAGCCGTTGTAAAATATTCGTTTGTAAAAACTGTTTTAAGGAATATAAAA
AAGACACAGTTTGTAATTCATGTTTTGAAGAAATGATATACTTATCGAAA
TCTGATTTGCTGCTAAAGAAGCGCAAATATAATGACGACTCAGACTCTGA
TGACAACATTGACGTTGACACGCTAAAGAAAATAATAAGACAAACAGAAA
AATATGAAAGTGAGGTTCCACCGGATGATTTTACTTTAATGGATCAAGTC
GATGCCGTATCCAAGGTTTCGTCTCATGGTGGAAATTCATTATTTAAAAA
GTTAATGTCAAAGAAAAGTGAAAATTCAACTATATCAAAGAAATCTCGTT
CTGATGTGCATTCCATGACCAATAAATCAAATGCTTCATCTTTGAATGAT
ATGACTATTATTAATTCTTCTGTAGTTTCGAAACCAGAGAACGCCGTTGA
ATTAGGTTCAGATAGACAAGGAGACATTATGATCGGTCTTTCATATAATT
ATATTGAAGAAGAATTTCGAATAATTATTAAGAAGTGTAGAAATTTAGAA
ATAGCAATACCTAATTCAAATTCATCTAATCCCTACGTTAAAGTGGAACT
TGTGCCTCCTATCTTTTCGGAGAAACACTTTAGAACTAAAACAATTAGTT
CTAATCTCAATCCGGATTTCAACGAGCAATGTAAATACAAGAATATTAAG
TATGAAGATGTAGTTTCAAGAAATGCATTAGTAACAGTGTGGCATGATGA
AAAATTGGGAAAACATGTCTTTCTCGGTCAAGTATTTTTAAAATTTAGCT
TATTCCAACTTGATGATGCAACTCCAAATTGGTTCAAATTAAAGGAAAAG
GGCCCCACTATAATAACTCCAGTGCTTTCAAAATACTATGGTGACATACA
AGTCAGTATTAAATACACGATTAATGGAAAATCATCGATGTCTACTAACA
GTCCGTCTGATAATTTTTCCGAAATGTCCAGTACTACCGGCTCTATTACT
TTGTGGATAAAACAAGCCAACAATCTTCTCACATCATCATATTCGCACCT
TCCAAACTCTTATGCAAAATGTCTTCTTTTACCCGAAAGTTCCAAGGTAC
CATCCAAAAAAACACCAATTATTCGTAAAAACTTCAATCCAATTTGGAAT
ATTCAATTCACATTTCCAAACATATCTCAAAGTGAATTACCAGATCTAGG
AATGGAAATAACAGTTTGTGATAAAAAACTGAGTCTTTTACGTGATGGGC
TTCTTGGAGGAATTTCTTTGAACATTGCTAGAAATGGTCGTTTAGTGCCA
ATAAAAGAAAAAGAAGTATGGCAGCAGATGATCACTAAACCGGAGACATG
GATTGAGGCTAAATTGGTTTTAAGAAAAGATTTGAAATAATTTTTTTTCA
TCTCTTTCATATTGAAATATACAGATGATCACTAAACCGGAGACATGGAT
TGAGGCTAAATTGGTTTTAAGAAAAGATTTGAAATAATTTTTTTTCATCT
CTTTCATATTGAAATATA
back to top

protein sequence of SMED30004208-orf-1

>SMED30004208-orf-1 ID=SMED30004208-orf-1|Name=SMED30004208-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=680bp
MSVVSGQWSGKSQRTSKSNGAKIIAPNGSIISRYPHETASVLSTNSKPAS
NLKKSTIQGSIISHTKSETLPPRSGKANSVLSGVSSQVARRKKQKESMDN
LSQTMKERAMSATSLNRRKSIESAKISSQLKRYSQSDMSIAVKSEIQLMT
KEERSKLLQIMEKYKKIQEIEKNRKTVIDMKIKEIQSLRPPYSQFQSNIC
YICQRTFWPIIYVKHSCSRCKIFVCKNCFKEYKKDTVCNSCFEEMIYLSK
SDLLLKKRKYNDDSDSDDNIDVDTLKKIIRQTEKYESEVPPDDFTLMDQV
DAVSKVSSHGGNSLFKKLMSKKSENSTISKKSRSDVHSMTNKSNASSLND
MTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLE
IAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIK
YEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEK
GPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSIT
LWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWN
IQFTFPNISQSELPDLGMEITVCDKKLSLLRDGLLGGISLNIARNGRLVP
IKEKEVWQQMITKPETWIEAKLVLRKDLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR041282FYVE_2
IPR000008C2_dom
IPR013083Znf_RING/FYVE/PHD
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0017137Rab GTPase binding
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 548..657
e-value: 3.5E-8
score: 43.2
coord: 388..494
e-value: 2.4E-11
score: 53.7
IPR000008C2 domainPFAMPF00168C2coord: 389..497
e-value: 3.2E-13
score: 49.9
coord: 547..657
e-value: 2.0E-11
score: 44.1
IPR000008C2 domainPROSITEPS50004C2coord: 385..479
score: 12.38
IPR000008C2 domainPROSITEPS50004C2coord: 534..639
score: 12.188
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 133..279
e-value: 1.8E-15
score: 58.6
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 369..503
e-value: 1.7E-28
score: 101.2
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 508..678
e-value: 3.9E-24
score: 87.0
IPR041282FYVE-type zinc fingerPFAMPF02318FYVE_2coord: 149..244
e-value: 6.8E-8
score: 32.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..117
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..88
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 103..117
NoneNo IPR availablePANTHERPTHR45716FAMILY NOT NAMEDcoord: 22..677
NoneNo IPR availableCDDcd00065FYVE_like_SFcoord: 200..242
e-value: 9.50587E-7
score: 44.06
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 514..675
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 371..502
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 149..247