SAM-dependent methyltransferase

Overview
NameSAM-dependent methyltransferase
Smed IDSMED30004206
Length (bp)1793
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SAM-dependent methyltransferase (SMED30004206) t-SNE clustered cells

Violin plots show distribution of expression levels for SAM-dependent methyltransferase (SMED30004206) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SAM-dependent methyltransferase (SMED30004206) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SAM-dependent methyltransferase (SMED30004206) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SAM-dependent methyltransferase vs. Ensembl Zebrafish
Match: zgc:162396 (zgc:162396 [Source:ZFIN;Acc:ZDB-GENE-030131-1190])

HSP 1 Score: 65.0846 bits (157), Expect = 3.222e-11
Identity = 44/162 (27.16%), Postives = 79/162 (48.77%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYP-ETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGD-VIEASLEKIL 1552
             +   + + +P  DAS+DL+TAA   HWFD ++F  E  R L+ HG LA+  + +   I  E+    D+LN  + ++       L PY   K   A   L  +  + P     R E++ I  ++++  +  + ++ S YQA+ + N      ++E +  +IL
Sbjct:   89 TYRVGTAEELPFPDASVDLLTAASAAHWFDAERFVKEAQRVLKPHGCLALFGYNDSMKIHHESCG--DQLNIIYEEL----KQELQPYTSTKVTGASTKLKDLFEVIPFPDKERIETIPIKEQLSVKNILGFFQTFSMYQAYLRANPKAATALLEKTASRIL 244          
BLAST of SAM-dependent methyltransferase vs. Ensembl Zebrafish
Match: zgc:162396 (zgc:162396 [Source:ZFIN;Acc:ZDB-GENE-030131-1190])

HSP 1 Score: 65.0846 bits (157), Expect = 3.222e-11
Identity = 44/162 (27.16%), Postives = 79/162 (48.77%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYP-ETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGD-VIEASLEKIL 1552
             +   + + +P  DAS+DL+TAA   HWFD ++F  E  R L+ HG LA+  + +   I  E+    D+LN  + ++       L PY   K   A   L  +  + P     R E++ I  ++++  +  + ++ S YQA+ + N      ++E +  +IL
Sbjct:   89 TYRVGTAEELPFPDASVDLLTAASAAHWFDAERFVKEAQRVLKPHGCLALFGYNDSMKIHHESCG--DQLNIIYEEL----KQELQPYTSTKVTGASTKLKDLFEVIPFPDKERIETIPIKEQLSVKNILGFFQTFSMYQAYLRANPKAATALLEKTASRIL 244          
BLAST of SAM-dependent methyltransferase vs. Ensembl Zebrafish
Match: zgc:162780 (zgc:162780 [Source:ZFIN;Acc:ZDB-GENE-070410-92])

HSP 1 Score: 58.9214 bits (141), Expect = 3.765e-9
Identity = 44/165 (26.67%), Postives = 72/165 (43.64%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDE-----LNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEKIL 1552
            ++  +  + +P +D S+DLVTA    HWFD  +F  E DR L+ HG LA++ +      +E    N  E      N F+  +    D +LGP   E  K  +       L YP     ++   +   V L+     ++S ST+Q   K +  +   +   +E  L
Sbjct:   89 SFRESPAEELPFEDGSVDLVTAMSAFHWFDHSRFLQEADRVLKPHGCLALLNY---TLDMELTYGNCSEALNLICNEFYAALHPLRDPHLGPSSFELYKRTYD-----SLQYP-VKEWHDMFGVKKAVPLSGYIGMVKSFSTFQTLLKKDPEEARRLSQDIEDRL 244          
BLAST of SAM-dependent methyltransferase vs. Ensembl Zebrafish
Match: BX004815.1 (pep chromosome:GRCz11:CHR_ALT_CTG9_1_15:28681632:28683418:1 gene:ENSDARG00000111484.1 transcript:ENSDART00000188353.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX004815.1)

HSP 1 Score: 53.1434 bits (126), Expect = 8.006e-8
Identity = 21/53 (39.62%), Postives = 33/53 (62.26%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITF 1231
            ++  +  + +P +D S+DLVTA    HWFD  +F  E DR L+ HG LA++ +
Sbjct:   89 SFRESPAEELPFEDGSVDLVTAMSAFHWFDHSRFLQEADRVLKPHGCLALLNY 141          
BLAST of SAM-dependent methyltransferase vs. Ensembl Zebrafish
Match: si:ch211-93g23.2 (si:ch211-93g23.2 [Source:ZFIN;Acc:ZDB-GENE-090312-164])

HSP 1 Score: 48.9062 bits (115), Expect = 9.074e-6
Identity = 47/194 (24.23%), Postives = 89/194 (45.88%), Query Frame = 2
Query: 1076 WHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILE--ENNKNIDEL-NHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRN----ESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASL-EKILGFLGNPESRLDTEVHINFAVSLIMCSK 1633
            +  +  +++P +D+  DLV++    HWFD  +F  EVDR L+  G LA++++    F LE  E+   ++ +   F+  +  F   Y+G             L   K +Y   S  +    E L     + L++    + + STYQ + + +  K   +  ++ +++L  +G   S  DTE+ +      I+ SK
Sbjct:   90 YRESPAEDLPFEDSIADLVSSMSAAHWFDHPRFLQEVDRILKPGGCLALLSYTMD-FELEYGESTSKLNNICEEFYAALHPFRKAYIG----------SSSLQVYKNIYDSISYADKEWHECLKSRRIMPLSKFIGLVETFSTYQGFLEKDPVKAKKLSKTITDRLLEAMGA--SSTDTELTVIVKYFYILASK 270          
BLAST of SAM-dependent methyltransferase vs. Ensembl Xenopus
Match: stc1 (stanniocalcin 1 [Source:Xenbase;Acc:XB-GENE-949749])

HSP 1 Score: 72.4034 bits (176), Expect = 1.426e-13
Identity = 46/144 (31.94%), Postives = 72/144 (50.00%), Query Frame = 2
Query: 1076 WHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLY---PET-SIRNESLSIDFKVTLNRLGNYLRSTSTYQAW 1495
            +  ++ + IPA++AS+DL+TA   VHWFDI+KF  E DR L+  G LA  T+      L     +    +   TQV     D L PY HEK      ++ G K ++   P T   R E++     ++L  +   +++ S YQ +
Sbjct:   90 YRVSAAEEIPAENASVDLITACAAVHWFDIEKFLKEADRVLKPCGCLAFFTY------LPNMEVHYKHQSQQLTQVITELQDVLSPYVHEK---VQHVISGYKDIFNAIPYTDKKRVENIDSKISMSLKDMLGLIQTFSMYQTF 224          
BLAST of SAM-dependent methyltransferase vs. Ensembl Xenopus
Match: krt61 (keratin 61 [Source:Xenbase;Acc:XB-GENE-876246])

HSP 1 Score: 63.1586 bits (152), Expect = 1.989e-10
Identity = 48/195 (24.62%), Postives = 87/195 (44.62%), Query Frame = 2
Query: 1061 CTIDN---WHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFG-EGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPE--------TSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEK-ILGFLGNPESRLDTEVHINF 1606
            CT  N   +  A  + +P +DAS+DL+ A L  HWF+ +KF  E  R L+  G LA+ +F  E     +E ++ +  + +   +  W              +F  K++  +K +YPE           R  S+   F +T+  + ++L++   Y+ + + + +K       LEK  L  LG        E H+++
Sbjct:   82 CTSHNNIYYQIAQAEELPLEDASVDLINAGLAAHWFNPEKFVQEAARVLKHGGCLALHSFSLEYEIQYKEKSEELTAVFNEACETIW--------------EFNRKVVGEMKAMYPELFRAIPFADKQRISSICEVFLLTVPEILSFLQAICLYKEFLEQDKDKATAFLQDLEKRFLDILGESACDDSLEFHVHY 262          
BLAST of SAM-dependent methyltransferase vs. Ensembl Xenopus
Match: stc1 (stanniocalcin 1 [Source:Xenbase;Acc:XB-GENE-949749])

HSP 1 Score: 62.003 bits (149), Expect = 5.717e-10
Identity = 25/52 (48.08%), Postives = 36/52 (69.23%), Query Frame = 2
Query: 1076 WHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITF 1231
            +  ++ + IPA++AS+DL+TA   VHWFDI+KF  E DR L+  G LA  T+
Sbjct:   90 YRVSAAEEIPAENASVDLITACAAVHWFDIEKFLKEADRVLKPCGCLAFFTY 141          
BLAST of SAM-dependent methyltransferase vs. Ensembl Xenopus
Match: krt61 (keratin 61 [Source:Xenbase;Acc:XB-GENE-876246])

HSP 1 Score: 61.2326 bits (147), Expect = 8.608e-10
Identity = 47/195 (24.10%), Postives = 87/195 (44.62%), Query Frame = 2
Query: 1061 CTIDN---WHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFG-EGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPET--------SIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEK-ILGFLGNPESRLDTEVHINF 1606
            CT  N   +  A  + +P +DAS+DL+ A L  HWF+ +KF  E  R L+  G LA+ +F  E     +E ++ +  + +   +  W              +F  K++  +K +YPE           R  S+   F +T+ ++ ++L++   Y  + + + +K       L+K  L  LG        E H+++
Sbjct:   82 CTSHNNIYYQIAQAEELPLEDASVDLINAGLAAHWFNPEKFVQEAARVLKHGGCLALHSFSLEYEIQYKEKSEELTAVFNEACETIW--------------EFNRKVVGEMKAMYPELFRAIPFADKQRISSICEVFLLTVPKILSFLQTICLYYEFLEQDKDKATAFLQDLKKRFLDILGESACDDSLEFHVHY 262          
BLAST of SAM-dependent methyltransferase vs. Ensembl Xenopus
Match: krt61 (keratin 61 [Source:Xenbase;Acc:XB-GENE-876246])

HSP 1 Score: 61.2326 bits (147), Expect = 8.608e-10
Identity = 47/195 (24.10%), Postives = 87/195 (44.62%), Query Frame = 2
Query: 1061 CTIDN---WHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFG-EGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPET--------SIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEK-ILGFLGNPESRLDTEVHINF 1606
            CT  N   +  A  + +P +DAS+DL+ A L  HWF+ +KF  E  R L+  G LA+ +F  E     +E ++ +  + +   +  W              +F  K++  +K +YPE           R  S+   F +T+ ++ ++L++   Y  + + + +K       L+K  L  LG        E H+++
Sbjct:   82 CTSHNNIYYQIAQAEELPLEDASVDLINAGLAAHWFNPEKFVQEAARVLKHGGCLALHSFSLEYEIQYKEKSEELTAVFNEACETIW--------------EFNRKVVGEMKAMYPELFRAIPFADKQRISSICEVFLLTVPKILSFLQTICLYYEFLEQDKDKATAFLQDLKKRFLDILGESACDDSLEFHVHY 262          
BLAST of SAM-dependent methyltransferase vs. UniProt/SwissProt
Match: sp|A6ZRD1|TMT1_YEAS7 (Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=TMT1 PE=3 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.443e-7
Identity = 51/204 (25.00%), Postives = 90/204 (44.12%), Query Frame = 2
Query: 1058 LCTIDNWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPE------------TSIRN---------ESLSIDFKVTLNRLGNYLRSTSTYQAWKKD--NHNKGDVIEASLEKILGFLGNPESRLDTEVHI 1600
            + + D++     D++  D   ID++TA  C HWFD +KF       LR+ G +AI  + +  F       +  E +    +V  +    LGPY+ + G+   + +     L PE              +R+         + L I  +VTL    +Y+R+ S Y  WK+D  N +K DV +  +++ L     PE   +T++ +
Sbjct:   95 ISSSDDFKFLGADSV--DKQKIDMITAVECAHWFDFEKFQRSAYANLRKDGTIAIWGYADPIF------PDYPEFDDLMIEVP-YGKQGLGPYWEQPGRSRLRNMLKDSHLDPELFHDIQVSYFCAEDVRDKVKLHQHTKKPLLIRKQVTLMEFADYVRTWSAYHQWKQDPKNKDKEDVADWFIKESL--RRRPELSTNTKIEV 287          
BLAST of SAM-dependent methyltransferase vs. UniProt/SwissProt
Match: sp|P32643|TMT1_YEAST (Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TMT1 PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.927e-7
Identity = 51/204 (25.00%), Postives = 90/204 (44.12%), Query Frame = 2
Query: 1058 LCTIDNWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPE------------TSIRN---------ESLSIDFKVTLNRLGNYLRSTSTYQAWKKD--NHNKGDVIEASLEKILGFLGNPESRLDTEVHI 1600
            + + D++     D++  D   ID++TA  C HWFD +KF       LR+ G +AI  + +  F       +  E +    +V  +    LGPY+ + G+   + +     L PE              +R+         + L I  +VTL    +Y+R+ S Y  WK+D  N +K DV +  +++ L     PE   +T++ +
Sbjct:   95 ISSSDDFKFLGADSV--DKQKIDMITAVECAHWFDFEKFQRSAYANLRKDGTIAIWGYADPIF------PDYPEFDDLMIEVP-YGKQGLGPYWEQPGRSRLRNMLKDSHLDPELFHDIQVSYFCAEDVRDKVKLHQHTKKPLLIRKQVTLVEFADYVRTWSAYHQWKQDPKNKDKEDVADWFIKESL--RRRPELSTNTKIEV 287          
BLAST of SAM-dependent methyltransferase vs. UniProt/SwissProt
Match: sp|Q55EX9|Y8948_DICDI (Putative methyltransferase DDB_G0268948 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268948 PE=1 SV=2)

HSP 1 Score: 53.5286 bits (127), Expect = 1.927e-6
Identity = 48/188 (25.53%), Postives = 89/188 (47.34%), Query Frame = 2
Query: 1076 WHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEKILGF--LGNPESRLDTEVHINFAVSLIMCSK 1633
            +  ++ + I     S+DL+T A   HWF++  FY E  R LR++G L I ++G  + I   N+  +    H++  +    D Y  P    + K+       IK  +  T+   +++S+   +++N +  Y  S S Y A+ K  +   DV+    E +L      + +S+L   + +NF V +I+  K
Sbjct:   90 YRLSAAEKIDLPSGSVDLITVAQAAHWFNLPVFYEESKRLLRENGSLIIWSYGLMK-ITNNNDAQVVHEKHYYETI---GDQYWAP----ERKYIDDEYVDIKPSFENTT--RKTISLPKSMSINDMIGYYSSWSGYAAFIKAGNK--DVLPEIKETLLKAYKTTDGDSKL---IDVNFPVYMILSKK 262          
BLAST of SAM-dependent methyltransferase vs. TrEMBL
Match: A0A0D2WJF3 (Methyltransf_11 domain-containing protein OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_000954 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 6.444e-13
Identity = 58/187 (31.02%), Postives = 89/187 (47.59%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEKILGFLGNPESRLDTEVHINFAVSLIMCSK 1633
            N+   S D IPA   + D+VT A  +HWFD+ KFYAEVDR L+  G LA+I +G  +   +E NK I +          F+   L PY+ ++  +       +KL Y E   R +  +I  + +L  +  YL S S Y  + K N    D + A    +L       S  D EV + + + +++  K
Sbjct:   85 NYTVGSADAIPAQTNTADVVTVAQAMHWFDLPKFYAEVDRVLKPGGTLAVIGYGNCKLANQEANKVIQQ----------FYSGTLKPYWSDRRFWLDNEYADVKLPY-EDRARWDG-AIVLRYSLEGILGYLSSWSGYHTYLKQNPTLPDPLIAVKADLLRAYAT-SSTTDVEVDLTWPLFMLLGKK 258          
BLAST of SAM-dependent methyltransferase vs. TrEMBL
Match: J7R8Q1 (Methyltransf_25 domain-containing protein OS=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) OX=1071383 GN=KNAG0G01930 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.679e-12
Identity = 56/172 (32.56%), Postives = 82/172 (47.67%), Query Frame = 2
Query: 1124 DLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGK-----------FAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKD--NHNKGDVIEASLEKILGFLGNPESRLDTEVHI 1600
            DLVTA  C HWFD +KF   V   L   G +A+  + +    L     ++DEL   F     + DD+LGPY+ + G+           F   L   ++ +Y   +    +LSI  +  L   G YLR+ S Y +WK D  N +K DV +  L  I+    +P   LD+EVH+
Sbjct:  124 DLVTAVECAHWFDFNKFQESVAGALTTGGTVAVWGYADQ---LITGYPDLDELYLDFA----YGDDHLGPYWQQPGRSLLRTLLKGCEFRKDLFRDVQEVYSHATDTQGALSITKRCILREYGEYLRTFSAYHSWKADVANKDKTDVCDEFLHAIM--QRHPGMELDSEVHL 286          
BLAST of SAM-dependent methyltransferase vs. TrEMBL
Match: A0A1L8EX65 (Methyltransf_11 domain-containing protein OS=Xenopus laevis OX=8355 GN=XELAEV_18045033mg PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.779e-12
Identity = 52/179 (29.05%), Postives = 87/179 (48.60%), Query Frame = 2
Query: 1076 WHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPET-SIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKG-DVIEASLEKILGFLGNPESRLDTEVHINF 1606
            +   + + +P  DAS+DL+TA   VHWF+I+KF  EVDR L+ HG LA  T+      L +   +  + +   TQV     D L PY +EK +        I  + P T   R E++   F ++L  +   +++ S YQ + K    K  D++E + ++ L  +    +    E+  N+
Sbjct:   90 YKACAAEELPVQDASVDLITACAAVHWFNIEKFLKEVDRVLKPHGCLAFYTY------LPDMEVHYKDRSQQLTQVMKEVQDALSPYVNEKVQLVRSGYKEIFDVIPYTDKQRVENIVSSFSMSLKDVLGLIQTFSMYQTFLKVEPEKAKDLLETTEKRFLEIMQVSSTETIVELQHNY 262          
BLAST of SAM-dependent methyltransferase vs. TrEMBL
Match: A0A267F6E9 (Methyltransf_11 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027926g1 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.158e-12
Identity = 43/143 (30.07%), Postives = 76/143 (53.15%), Query Frame = 2
Query: 1076 WHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKF---AWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAW 1495
            +H   C ++   D S DL+T A  +HWFD+ KFY EV RCL+  G LA++ +G     L   + + +   +   Q ++  ++Y+GPY+  + +    A+K LP    ++ E      +  +  + TL++  +YL+S S YQ +
Sbjct:  104 FHVGDCYSLRCPDKSADLITVAQALHWFDVPKFYNEVGRCLKPTGALALLCYGFCSLRLHGVDSSNEIRANQLIQEYFQGENYIGPYWDARRELVDTAYKTLP----MFNENKCIRLTEEMPLETTLSQFVSYLKSHSAYQTY 242          
BLAST of SAM-dependent methyltransferase vs. TrEMBL
Match: A0A1S3IYE0 (putative methyltransferase DDB_G0268948 OS=Lingula unguis OX=7574 GN=LOC106168153 PE=4 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.954e-12
Identity = 54/199 (27.14%), Postives = 95/199 (47.74%), Query Frame = 2
Query: 1085 ASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWK------LLPGIKLLYPETS----------IRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEKILGFLGNPESRLDTEVHINFAVSLIMCSK 1633
             S ++ P DD S+DLVT+A   HWFD+DKFYAE +R LR HG +A++  G    +L+ N                 H + L  Y  +     WK      +   +   YP+            +R+E+LS+++  TL     Y+ S S Y  +  + + +  ++E   E +L  + + E+ + +E+H+ F + +++  K
Sbjct:   93 GSGESFPVDDHSVDLVTSAQAAHWFDLDKFYAETERVLRPHGCVALL--GYAVPVLDSNP----------------HGEILSKYIRDFYGRLWKTSCWDEMRKHVDNRYPDERFACRLPLREYVRDETLSMEYDTTLEHFIGYVSSWSGYNKY-MEKYPESKILEDLQENLLKTM-DREATIHSELHVTFPIFMLLGRK 271          
BLAST of SAM-dependent methyltransferase vs. Ensembl Cavefish
Match: zgc:162396 (putative methyltransferase DDB_G0268948 [Source:NCBI gene;Acc:103038316])

HSP 1 Score: 63.1586 bits (152), Expect = 1.425e-10
Identity = 43/180 (23.89%), Postives = 92/180 (51.11%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGI--KLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKK-DNHNKGDVIEASLEKILGFLG--NPESRLDTEVH 1597
            ++ T + + +P  D S+DL+TAA   HWFD   F  E  R L+ HG +A++ + + +F L   +   D+L+  +++V       L PY   +   A   L  +   + +P+   R ES+ +  ++++      + S S YQ +++ +      +++++  ++L  +G  + +++LD  +H
Sbjct:   89 SYRTGTAEQLPFPDGSVDLLTAASAAHWFDPQGFLKEASRVLKPHGCMALLGYTD-QFYLNYGSCG-DKLDSIYSEVI----KALLPYTSSQIAVANSKLQDLYEAIPFPDKE-RVESIPVKLQMSVRAAIGLVESFSMYQTFQRAEPQAAAALLKSTTTRLLKEMGVSSVDTKLDVTMH 261          
BLAST of SAM-dependent methyltransferase vs. Ensembl Cavefish
Match: zgc:162396 (putative methyltransferase DDB_G0268948 [Source:NCBI gene;Acc:103038316])

HSP 1 Score: 62.3882 bits (150), Expect = 2.280e-10
Identity = 40/181 (22.10%), Postives = 84/181 (46.41%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGI--KLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAW-KKDNHNKGDVIEASLEKILGFLGNPESRLDTEVHINF 1606
            ++     + +P  DAS+DL+TAA   HWFD + F  E  R L+  G +A+  +      L+  + +          ++      + PY   +   +   L  +   + +P+   R E + +  +VT+N +   L++ ST+QA+ + D     ++IE+++ + L  +G   +    E+ + +
Sbjct:   89 SYRAGPAEELPFPDASVDLLTAASAAHWFDAEPFLKEATRVLKPRGCMALFGY------LDTYDLHYGSCGDRLNTIYEEMKKSMLPYSSGRVSVSNSKLQELYEAISFPDKD-RIEVIPVKEEVTVNNIVGLLKTHSTFQAYHRADPQGAANLIESTMARFLKEMGVTSTETKLEIRLEY 262          
BLAST of SAM-dependent methyltransferase vs. Ensembl Cavefish
Match: zgc:162396 (putative methyltransferase DDB_G0268948 [Source:NCBI gene;Acc:103038316])

HSP 1 Score: 62.3882 bits (150), Expect = 2.368e-10
Identity = 40/181 (22.10%), Postives = 84/181 (46.41%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGI--KLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAW-KKDNHNKGDVIEASLEKILGFLGNPESRLDTEVHINF 1606
            ++     + +P  DAS+DL+TAA   HWFD + F  E  R L+  G +A+  +      L+  + +          ++      + PY   +   +   L  +   + +P+   R E + +  +VT+N +   L++ ST+QA+ + D     ++IE+++ + L  +G   +    E+ + +
Sbjct:   89 SYRAGPAEELPFPDASVDLLTAASAAHWFDAEPFLKEATRVLKPRGCMALFGY------LDTYDLHYGSCGDRLNTIYEEMKKSMLPYSSGRVSVSNSKLQELYEAISFPDKD-RIEVIPVKEEVTVNNIVGLLKTHSTFQAYHRADPQGAANLIESTMARFLKEMGVTSTETKLEIRLEY 262          
BLAST of SAM-dependent methyltransferase vs. Ensembl Cavefish
Match: zgc:162396 (putative methyltransferase DDB_G0268948 [Source:NCBI gene;Acc:103038316])

HSP 1 Score: 62.3882 bits (150), Expect = 2.547e-10
Identity = 40/181 (22.10%), Postives = 84/181 (46.41%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGI--KLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAW-KKDNHNKGDVIEASLEKILGFLGNPESRLDTEVHINF 1606
            ++     + +P  DAS+DL+TAA   HWFD + F  E  R L+  G +A+  +      L+  + +          ++      + PY   +   +   L  +   + +P+   R E + +  +VT+N +   L++ ST+QA+ + D     ++IE+++ + L  +G   +    E+ + +
Sbjct:   89 SYRAGPAEELPFPDASVDLLTAASAAHWFDAEPFLKEATRVLKPRGCMALFGY------LDTYDLHYGSCGDRLNTIYEEMKKSMLPYSSGRVSVSNSKLQELYEAISFPDKD-RIEVIPVKEEVTVNNIVGLLKTHSTFQAYHRADPQGAANLIESTMARFLKEMGVTSTETKLEIRLEY 262          
BLAST of SAM-dependent methyltransferase vs. Ensembl Cavefish
Match: zgc:162780 (uncharacterized methyltransferase-like C25B8.10 [Source:NCBI gene;Acc:103038930])

HSP 1 Score: 50.447 bits (119), Expect = 2.373e-6
Identity = 30/112 (26.79%), Postives = 51/112 (45.54%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFG-EGRFILEENNKNIDELNHFFTQVFWFHDD-YLGPYFHEKGKFAWKLLPGIKLLYPET 1402
            ++     + +P +D ++DLVT     HWFD  +F  E DR L+  G LAI+ +  +      +  K + +++  +  +   H   YLG              PG K+LY +T
Sbjct:   90 SYRECPAEELPFEDGTVDLVTVMSAFHWFDHSRFLQEADRILKPRGCLAILNYSLDIELSYGDCTKELKKISREYHDILQSHRHAYLG--------------PGSKVLYEQT 187          
BLAST of SAM-dependent methyltransferase vs. Ensembl Sea Lamprey
Match: zgc:162396 (zgc:162396 [Source:ZFIN;Acc:ZDB-GENE-030131-1190])

HSP 1 Score: 51.2174 bits (121), Expect = 1.729e-7
Identity = 43/187 (22.99%), Postives = 82/187 (43.85%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYP-ETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWK-KDNHNKGDVIEASLEKILGFLGNPESRLDTEVHINFAVSLIMC 1627
            ++     + +P DD S+ L+TA +  HWFD+  F  EV+R L+  G L I ++      +   +      +   TQ+ W   + L PY   K     +    +    P     R E++     + L  L  ++ S + YQA K +D      ++E + +++   LG+  +  + ++ +   V L+ C
Sbjct:   46 SYIVGPAETLPVDDGSVSLLTAFVSAHWFDLPAFMHEVERVLQPRGCLVIYSY------MYPFDIECGVFSEKLTQILWKVIEDLRPYESHKMNHVREDYTAMYEAIPFVDKKRLENVRFIALLKLPELMGFIGSFAEYQALKAEDPLAAQALMEGTEKRVQETLGDAAATAEMKIVVK-TVLLLAC 225          
BLAST of SAM-dependent methyltransferase vs. Ensembl Sea Lamprey
Match: zgc:162396 (zgc:162396 [Source:ZFIN;Acc:ZDB-GENE-030131-1190])

HSP 1 Score: 49.6766 bits (117), Expect = 3.536e-7
Identity = 38/162 (23.46%), Postives = 67/162 (41.36%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWK----LLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEK 1546
             +     + +P DD S+ L+TA +  HWFD+  F  EV+R L+  G L I ++      +   +      +   TQ+ W   + L PY   K     +    +   I     ++   N+   I   ++L  L  ++ S + YQA K ++      +    EK
Sbjct:   46 TYIVGPAETLPVDDGSVSLLTAFVSAHWFDLPAFMHEVERVLQPRGCLVIYSY------MYPFDIECGVFSEKLTQILWKVIEDLRPYESHKMNHVREDYTAMYEAIPFADKKSIFCND---IKSNISLPELMGFIGSFAEYQALKAEDPLTAQALMEETEK 198          
BLAST of SAM-dependent methyltransferase vs. Ensembl Sea Lamprey
Match: zgc:162396 (zgc:162396 [Source:ZFIN;Acc:ZDB-GENE-030131-1190])

HSP 1 Score: 48.521 bits (114), Expect = 1.495e-6
Identity = 38/159 (23.90%), Postives = 66/159 (41.51%), Query Frame = 2
Query: 1076 WHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWK----LLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASL 1540
            +   + + +P  D S+ L+ A    + F++  F  E  R L+  G LA+        +L         ++   T +     + L PY HE+ +        +  GI     E   R E + +  ++TL  L  ++   S YQA +K+N  +GD    SL
Sbjct:   90 YTVGTAEKLPFLDGSVGLLCATSAANVFNLPDFVREAARVLQPGGCLAVYA------MLYPMRLKYGGVSSELTAILQEMLEELRPYEHERMRHLRNGYADIYTGITFADKE---RKEGIELSVQMTLQDLLRFIGCFSEYQALRKENPKRGDTFMQSL 239          
BLAST of SAM-dependent methyltransferase vs. Ensembl Yeast
Match: TMT1 (Trans-aconitate methyltransferase; cytosolic enzyme that catalyzes the methyl esterification of 3-isopropylmalate, an intermediate of the leucine biosynthetic pathway, and trans-aconitate, which inhibits the citric acid cycle [Source:SGD;Acc:S000000977])

HSP 1 Score: 56.6102 bits (135), Expect = 2.774e-9
Identity = 51/204 (25.00%), Postives = 90/204 (44.12%), Query Frame = 2
Query: 1058 LCTIDNWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPE------------TSIRN---------ESLSIDFKVTLNRLGNYLRSTSTYQAWKKD--NHNKGDVIEASLEKILGFLGNPESRLDTEVHI 1600
            + + D++     D++  D   ID++TA  C HWFD +KF       LR+ G +AI  + +  F       +  E +    +V  +    LGPY+ + G+   + +     L PE              +R+         + L I  +VTL    +Y+R+ S Y  WK+D  N +K DV +  +++ L     PE   +T++ +
Sbjct:   95 ISSSDDFKFLGADSV--DKQKIDMITAVECAHWFDFEKFQRSAYANLRKDGTIAIWGYADPIF------PDYPEFDDLMIEVP-YGKQGLGPYWEQPGRSRLRNMLKDSHLDPELFHDIQVSYFCAEDVRDKVKLHQHTKKPLLIRKQVTLVEFADYVRTWSAYHQWKQDPKNKDKEDVADWFIKESL--RRRPELSTNTKIEV 287          
BLAST of SAM-dependent methyltransferase vs. Ensembl Medaka
Match: zgc:162396 (putative methyltransferase DDB_G0268948 [Source:NCBI gene;Acc:101157984])

HSP 1 Score: 57.3806 bits (137), Expect = 2.637e-9
Identity = 27/76 (35.53%), Postives = 45/76 (59.21%), Query Frame = 2
Query: 1082 TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEG--RFILEENNKNIDELNHFFTQV 1303
            T + + +P  D S+DL+ AA   HWFD+ KF AE +R L+  G +A++ FG+   +F  ++     D+LN  + +V
Sbjct:   84 TGTAEKLPFPDGSVDLLAAASAAHWFDVPKFLAEANRVLKPGGCMALLGFGDNCPKFTYKDCG---DKLNSIYQEV 156          
BLAST of SAM-dependent methyltransferase vs. Ensembl Medaka
Match: si:ch211-93g23.2 (putative methyltransferase DDB_G0268948 [Source:NCBI gene;Acc:101159172])

HSP 1 Score: 54.6842 bits (130), Expect = 8.829e-8
Identity = 45/181 (24.86%), Postives = 79/181 (43.65%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELN----HFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLE-KILGFLGNPESRLDTEVHI 1600
            ++     + +P  +  +DLVTA    HWFD  +F  E DR LR  G LA++++     +  E     D LN     F+  +  +   Y+G            L       YPE    N  + +   VTL+     +++ S+Y+  K+ +  + + +   ++ K+L  +    S LDTEV +
Sbjct:   88 SYRECPAEELPFANGEVDLVTAMTAAHWFDRQRFLQEADRVLRPGGCLALLSYTMDMKL--EYGDISDSLNDICEEFYATLLPYRSSYIG---SSSKNIYLDLFNSCS--YPEKEWNN-CVPVRRAVTLSAYIGMVQTFSSYECLKQKDPEEAERLSNDIQNKLLSVMKT--SSLDTEVTM 258          
BLAST of SAM-dependent methyltransferase vs. Ensembl Medaka
Match: si:ch211-93g23.2 (putative methyltransferase DDB_G0268948 [Source:NCBI gene;Acc:101159172])

HSP 1 Score: 50.0618 bits (118), Expect = 2.823e-6
Identity = 40/174 (22.99%), Postives = 75/174 (43.10%), Query Frame = 2
Query: 1073 NWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELN----HFFTQVFWFHDDYLGP-------------YFHEKGKFAWKLLPGIKLL---YPET----SIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGD 1522
            ++     + +P  +  +DLVTA    HWFD  +F  E DR LR  G LA++++     +  E     D LN     F+  +  +   Y+G               + EK    +  +P + +L   Y E+    + RN  + +   VTL+     +++ S+Y+  K+ +  + +
Sbjct:   88 SYRECPAEELPFANGEVDLVTAMTAAHWFDRQRFLQEADRVLRPGGCLALLSYTMDMKL--EYGDISDSLNDICEEFYATLLPYRSSYIGSSSKNIYLDLFNSCSYPEKEWCVFLDVPVVGILMEIYSESMYKFAPRNNCVPVRRAVTLSAYIGMVQTFSSYECLKQKDPEEAE 259          
BLAST of SAM-dependent methyltransferase vs. Planmine SMEST
Match: SMESG000029118.1 (SMESG000029118.1)

HSP 1 Score: 384.8 bits (987), Expect = 1.202e-131
Identity = 184/185 (99.46%), Postives = 184/185 (99.46%), Query Frame = 2
Query: 1082 TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEKILGFLGNPESRLDTEVHINFAVSLIMCSKF 1636
            TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNK DVIEASLEKILGFLGNPESRLDTEVHINFAVSLIMCSKF
Sbjct:   43 TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKRDVIEASLEKILGFLGNPESRLDTEVHINFAVSLIMCSKF 227          
BLAST of SAM-dependent methyltransferase vs. Planmine SMEST
Match: SMESG000029144.1 (SMESG000029144.1)

HSP 1 Score: 329.331 bits (843), Expect = 3.132e-110
Identity = 158/167 (94.61%), Postives = 163/167 (97.60%), Query Frame = 2
Query: 1082 TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEKILG-FLGNPESR 1579
            TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQ+GVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNK DVIEASLEKILG  + +P++R
Sbjct:   43 TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQYGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKRDVIEASLEKILGSSISSPKTR 209          
BLAST of SAM-dependent methyltransferase vs. Planmine SMEST
Match: SMESG000029118.1 (SMESG000029118.1)

HSP 1 Score: 323.553 bits (828), Expect = 3.731e-108
Identity = 154/155 (99.35%), Postives = 154/155 (99.35%), Query Frame = 2
Query: 1082 TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEK 1546
            TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNK DVIEASLEK
Sbjct:   43 TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKRDVIEASLEK 197          
BLAST of SAM-dependent methyltransferase vs. Planmine SMEST
Match: SMESG000029168.1 (SMESG000029168.1)

HSP 1 Score: 252.677 bits (644), Expect = 9.111e-80
Identity = 113/189 (59.79%), Postives = 146/189 (77.25%), Query Frame = 2
Query: 1067 IDNWHTASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEKILGFLGNPESRLDTEVHINFAVSLIMCSK 1633
            +  +   SC +IP  DAS+DL+TAA CVHWFDI+KFY E+DRCL Q GVLA++T+G+GRFI++ + K ++ELN F T+  W  D+YLG Y   K K++W  LPG+K LYPET +R+ES +I+FK+TL R GNYLRSTS YQAWKK+N +K D I+ SLE+IL +LGNP+S LDTEV INF V +IMCSK
Sbjct:   76 VPKYMVGSCYDIPVSDASVDLITAAQCVHWFDIEKFYTEIDRCLCQCGVLAVLTYGKGRFIIDRSEKKVNELNQFVTRDLWLSDEYLGTYVGNKPKWSWNFLPGLKFLYPETGLRDESSAIEFKLTLKRYGNYLRSTSMYQAWKKNNQDKRDFIKVSLERILTYLGNPKSGLDTEVQINFPVCMIMCSK 264          
BLAST of SAM-dependent methyltransferase vs. Planmine SMEST
Match: SMESG000020236.1 (SMESG000020236.1)

HSP 1 Score: 176.022 bits (445), Expect = 1.578e-50
Identity = 86/184 (46.74%), Postives = 117/184 (63.59%), Query Frame = 2
Query: 1082 TASCDNIPADDASIDLVTAALCVHWFDIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFWFHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLGNYLRSTSTYQAWKKDNHNKGDVIEASLEKILGFLGNPESRLDTEVHINFAVSLIMCSK 1633
             ASC N+PA D+SID++TAA CVHWFD+DKFYAEVDR L+  GVL I  + +G FI++     + ++N       W  D Y G + +++ KFA     GI  LYP T +RNE L+I    TL R  NYL S+S YQ W+K N N+ D+ +  +++IL  +GNP + LDTEV  +  + LIMCSK
Sbjct:   82 VASCYNLPALDSSIDIITAAQCVHWFDLDKFYAEVDRSLKVGGVLVISVYKKGHFIIDLEYDQLAKINKLIQYDIWNDDKYFGSFINDRLKFAATGYAGIPYLYPITGVRNEKLNIKMSFTLKRYKNYLCSSSVYQRWRKCNLNEIDIADIIIKEILCLMGNPTTELDTEVEFHLPLCLIMCSK 265          
The following BLAST results are available for this feature:
BLAST of SAM-dependent methyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAM-dependent methyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAM-dependent methyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAM-dependent methyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1623963.222e-1127.16zgc:162396 [Source:ZFIN;Acc:ZDB-GENE-030131-1190][more]
zgc:1623963.222e-1127.16zgc:162396 [Source:ZFIN;Acc:ZDB-GENE-030131-1190][more]
zgc:1627803.765e-926.67zgc:162780 [Source:ZFIN;Acc:ZDB-GENE-070410-92][more]
BX004815.18.006e-839.62pep chromosome:GRCz11:CHR_ALT_CTG9_1_15:28681632:2... [more]
si:ch211-93g23.29.074e-624.23si:ch211-93g23.2 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
back to top
BLAST of SAM-dependent methyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stc11.426e-1331.94stanniocalcin 1 [Source:Xenbase;Acc:XB-GENE-949749... [more]
krt611.989e-1024.62keratin 61 [Source:Xenbase;Acc:XB-GENE-876246][more]
stc15.717e-1048.08stanniocalcin 1 [Source:Xenbase;Acc:XB-GENE-949749... [more]
krt618.608e-1024.10keratin 61 [Source:Xenbase;Acc:XB-GENE-876246][more]
krt618.608e-1024.10keratin 61 [Source:Xenbase;Acc:XB-GENE-876246][more]
back to top
BLAST of SAM-dependent methyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAM-dependent methyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A6ZRD1|TMT1_YEAS71.443e-725.00Trans-aconitate 3-methyltransferase OS=Saccharomyc... [more]
sp|P32643|TMT1_YEAST1.927e-725.00Trans-aconitate 3-methyltransferase OS=Saccharomyc... [more]
sp|Q55EX9|Y8948_DICDI1.927e-625.53Putative methyltransferase DDB_G0268948 OS=Dictyos... [more]
back to top
BLAST of SAM-dependent methyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0D2WJF36.444e-1331.02Methyltransf_11 domain-containing protein OS=Capsa... [more]
J7R8Q11.679e-1232.56Methyltransf_25 domain-containing protein OS=Kazac... [more]
A0A1L8EX651.779e-1229.05Methyltransf_11 domain-containing protein OS=Xenop... [more]
A0A267F6E92.158e-1230.07Methyltransf_11 domain-containing protein OS=Macro... [more]
A0A1S3IYE04.954e-1227.14putative methyltransferase DDB_G0268948 OS=Lingula... [more]
back to top
BLAST of SAM-dependent methyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1623961.425e-1023.89putative methyltransferase DDB_G0268948 [Source:NC... [more]
zgc:1623962.280e-1022.10putative methyltransferase DDB_G0268948 [Source:NC... [more]
zgc:1623962.368e-1022.10putative methyltransferase DDB_G0268948 [Source:NC... [more]
zgc:1623962.547e-1022.10putative methyltransferase DDB_G0268948 [Source:NC... [more]
zgc:1627802.373e-626.79uncharacterized methyltransferase-like C25B8.10 [S... [more]
back to top
BLAST of SAM-dependent methyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1623961.729e-722.99zgc:162396 [Source:ZFIN;Acc:ZDB-GENE-030131-1190][more]
zgc:1623963.536e-723.46zgc:162396 [Source:ZFIN;Acc:ZDB-GENE-030131-1190][more]
zgc:1623961.495e-623.90zgc:162396 [Source:ZFIN;Acc:ZDB-GENE-030131-1190][more]
back to top
BLAST of SAM-dependent methyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TMT12.774e-925.00Trans-aconitate methyltransferase; cytosolic enzym... [more]
back to top
BLAST of SAM-dependent methyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAM-dependent methyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1623962.637e-935.53putative methyltransferase DDB_G0268948 [Source:NC... [more]
si:ch211-93g23.28.829e-824.86putative methyltransferase DDB_G0268948 [Source:NC... [more]
si:ch211-93g23.22.823e-622.99putative methyltransferase DDB_G0268948 [Source:NC... [more]
back to top
BLAST of SAM-dependent methyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029118.11.202e-13199.46SMESG000029118.1[more]
SMESG000029144.13.132e-11094.61SMESG000029144.1[more]
SMESG000029118.13.731e-10899.35SMESG000029118.1[more]
SMESG000029168.19.111e-8059.79SMESG000029168.1[more]
SMESG000020236.11.578e-5046.74SMESG000020236.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004206 ID=SMED30004206|Name=SAM-dependent methyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1793bp
TATCAAAATTTAAAACTTATCAAAGGCGGTTAACGTTAATTATTACTACA
ACTTTCTGCAGATTGAATAGGGCCGTTCCTCTATGAGTTCTTGGGGAAGA
AATCGGTTGACAACCATTCATCACGGCATTCCTATAAGTCCCTCTTCAGT
GGTTGTACTAATTATAAGACGTTAAGTATTATTTTACTACTATGCAAATG
AGGTGAGTCGAAAGCTACGATCTACTAGGTATTGACGTCTATAAAGTTAG
CGGTTGTTAAGTGTATAGTAGCCAGGTTTATTAGAACTCATTTAGAAGTT
ACTAACTGCCTAGCGTTGGCCTTTACCAACATTAAGTTATCGTTTATAAT
ATATCTAGTGCCAATATTTGTTAAAAATCAATCTTTAGAAATCTAATGGG
TACAAAGTGTTGCCATTTATTTACGGGTATTTCAAATTTGCTAGACATAT
AATGTTAGTTAATCTTAATTCAAGGTTGCTATCTATATGAGGTTGACATT
GATTAACGTATTTTTACAAGTTACTAATGTATGATATAGATATTGGTTAA
TTAAACTCTAAAATTTATTATTACGGGATATTGACCTTGATTTAATTAAA
TTTCCGAATTTACTAGATAGGACATCCACCTTCATTTAGGTGAACGCATT
TAATTAGTGTGGAGGTATCCACATCCGCTATGGATATGTCGGTGTTTATG
TTAAGGGCATTTGGTCTACGTACAATGTCGACGGAAATTCTATGATCACG
CGAATTCGTTTAATTTGGATGTGCGGCTTCCGGTAGATTCGCCTTATATC
GTAAATAAATGTTAAGCAAAATCGGCTATTTCTAATGTCGCATCCTGTTC
ATATCACTTATGCATACTTTGATTGTCGAACATTACAGTAGATGGGTTCG
TCGCCGTGCAGTGGATCGGTTTTGGGTAGACTACTCATATTTATTGCGGA
TTTCAATGAACTACCTCTCGGCACCTCTGTACAATCCCTATCTCTGGAAT
TTATCAATTTGGGATGTTTTAGTTACTACTCTCTCAGGGCTGTTTGGAAC
TATTTTATTATGCACTATCGACAATTGGCATACAGCTAGCTGTGATAATA
TTCCAGCAGATGATGCGTCCATTGATTTAGTTACCGCTGCGCTCTGTGTT
CATTGGTTCGATATTGATAAATTTTATGCGGAAGTTGATAGATGTCTTCG
TCAACATGGAGTTTTGGCAATAATAACTTTCGGAGAGGGTCGATTCATTT
TAGAAGAGAATAATAAAAATATTGATGAACTCAATCACTTCTTTACACAA
GTATTTTGGTTTCATGATGATTATCTTGGACCATACTTTCACGAGAAAGG
CAAATTTGCTTGGAAGTTGCTTCCTGGAATAAAATTACTTTATCCAGAAA
CAAGCATTCGGAATGAAAGTTTATCGATTGATTTTAAAGTTACATTGAAT
AGATTAGGAAATTATTTGCGCTCTACATCTACGTATCAAGCTTGGAAGAA
AGACAACCACAATAAAGGAGACGTGATTGAAGCGTCATTGGAAAAGATAC
TGGGTTTCCTAGGAAATCCGGAATCCAGACTTGATACGGAGGTGCACATC
AATTTTGCAGTTTCTTTGATAATGTGCTCCAAATTCTAGCGTAATTATTA
ATTAATTGAATAATGCTCTCCGATAAAAGTTTAGAATTGCAATAAAATTT
TGATTTTTTTTATCAATAAATTCTTATTAAATTATTTTTAACTGCCAATC
TTTGTGCTGGTATTAAAATAATTACAGTAGAACCTCGTTATAA
back to top

protein sequence of SMED30004206-orf-1

>SMED30004206-orf-1 ID=SMED30004206-orf-1|Name=SMED30004206-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MHTLIVEHYSRWVRRRAVDRFWVDYSYLLRISMNYLSAPLYNPYLWNLSI
WDVLVTTLSGLFGTILLCTIDNWHTASCDNIPADDASIDLVTAALCVHWF
DIDKFYAEVDRCLRQHGVLAIITFGEGRFILEENNKNIDELNHFFTQVFW
FHDDYLGPYFHEKGKFAWKLLPGIKLLYPETSIRNESLSIDFKVTLNRLG
NYLRSTSTYQAWKKDNHNKGDVIEASLEKILGFLGNPESRLDTEVHINFA
VSLIMCSKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR013216Methyltransf_11
IPR029063SAM-dependent_MTases
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0032259methylation